BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A07 (981 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 42 6e-04 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 42 6e-04 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 33 0.003 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 40 0.004 03_02_0446 - 8567436-8567567,8567649-8567768,8569837-8569914,857... 40 0.004 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 40 0.004 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 39 0.005 01_07_0331 + 42804385-42804659,42806175-42806340,42806424-428065... 39 0.005 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 39 0.005 10_08_0323 + 16743358-16743566,16744536-16744704,16744834-167449... 39 0.007 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 38 0.009 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 38 0.009 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 38 0.009 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 38 0.016 02_03_0120 + 15463163-15465250 38 0.016 11_01_0621 - 4981070-4981136,4982906-4983825 37 0.021 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 37 0.021 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 37 0.021 08_01_0059 - 394001-394708 37 0.021 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 37 0.021 07_01_0080 + 587674-588510 37 0.021 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 37 0.021 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 37 0.021 03_01_0515 - 3864796-3865425 37 0.021 02_05_0686 - 30900748-30902167,30903442-30904742 37 0.028 12_02_1174 - 26696869-26698191 36 0.037 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 36 0.037 12_02_0299 - 17051570-17052474,17053542-17053755 36 0.049 11_06_0610 - 25449085-25453284 36 0.049 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 36 0.049 03_02_0350 - 7734494-7734952,7735765-7736133 36 0.049 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 36 0.065 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 36 0.065 07_03_0890 - 22332768-22333382 36 0.065 07_03_0560 + 19479597-19480667 36 0.065 07_03_0177 - 14770777-14772045 36 0.065 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 36 0.065 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 36 0.065 02_05_1277 - 35408097-35409080 36 0.065 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 36 0.065 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 36 0.065 01_01_0570 - 4231100-4232560 36 0.065 06_03_0790 - 24636805-24637770 35 0.086 10_01_0360 - 3970796-3971248,3972080-3972436 35 0.11 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 35 0.11 08_01_0202 - 1638978-1639571 35 0.11 07_03_1533 + 27523811-27524710 35 0.11 07_03_0559 + 19475893-19476783 35 0.11 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 35 0.11 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 35 0.11 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 35 0.11 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 35 0.11 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 35 0.11 01_06_1377 + 36764461-36765339 35 0.11 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 35 0.11 12_01_0841 - 7873458-7874225 34 0.15 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 34 0.15 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 34 0.15 11_01_0133 + 1121392-1122731,1123417-1123858 34 0.15 10_08_0116 + 14935582-14936089,14936850-14937188,14937914-149379... 34 0.15 09_01_0037 - 604001-604957 34 0.15 08_01_0546 - 4746118-4746580,4747335-4747342 34 0.15 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 34 0.15 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 34 0.15 06_01_0486 - 3455030-3455770 34 0.15 05_07_0031 - 27183252-27183317,27183542-27184282 34 0.15 05_01_0380 + 2978256-2979284 34 0.15 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 34 0.15 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 34 0.15 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 34 0.15 03_01_0023 + 198414-198968 34 0.15 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 34 0.15 01_05_0490 + 22672241-22674679 34 0.15 12_02_1114 - 26171876-26172493 34 0.20 12_02_0848 + 23636478-23638058 34 0.20 09_06_0283 + 22024779-22026134,22026181-22026714 34 0.20 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 34 0.20 06_03_0212 + 17986660-17986986 34 0.20 06_02_0175 - 12624608-12625297 34 0.20 04_04_1413 - 33386049-33386339 34 0.20 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 34 0.20 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 34 0.20 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 34 0.20 02_04_0400 - 22608519-22608844,22609044-22609122 34 0.20 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 34 0.20 01_06_1293 - 36050847-36051304,36052343-36052826 34 0.20 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 34 0.20 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 34 0.20 01_01_0070 - 542603-542686,542803-543441 34 0.20 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 33 0.26 11_06_0578 + 25176304-25176388,25176503-25177032,25177267-251779... 33 0.26 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 33 0.26 09_02_0543 + 10427321-10428315,10428440-10429154 33 0.26 08_02_0602 + 19183549-19184919 33 0.26 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 33 0.26 05_03_0458 + 14280953-14281866,14281964-14282912 33 0.26 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 33 0.26 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 33 0.26 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 33 0.26 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 33 0.26 01_06_0840 + 32343700-32344138,32345329-32345419,32345584-323458... 33 0.26 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 33 0.35 10_03_0023 - 7151465-7152111,7152222-7152405 33 0.35 08_02_1615 + 28257275-28258428,28258523-28259144 33 0.35 07_03_0558 + 19461369-19462448 33 0.35 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 33 0.35 05_04_0303 - 20010761-20011756 33 0.35 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 33 0.35 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 33 0.35 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 33 0.35 03_06_0599 + 34984869-34985319,34986581-34987563 33 0.35 12_01_0135 + 1042889-1044255,1045368-1045809 33 0.46 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 33 0.46 10_08_0214 - 15915156-15915713 33 0.46 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 33 0.46 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 33 0.46 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 33 0.46 08_02_1256 + 25645085-25645396 33 0.46 06_03_1326 - 29355467-29355817 33 0.46 06_03_0696 + 23617687-23617851,23618838-23619536 33 0.46 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 33 0.46 04_04_1542 - 34264994-34265331,34266195-34267029 33 0.46 04_03_1022 - 21778315-21779007 33 0.46 03_06_0642 + 35239658-35240083,35240167-35240238,35240305-352409... 33 0.46 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 33 0.46 02_04_0021 + 18975992-18976408 33 0.46 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 33 0.46 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 33 0.46 01_06_0317 + 28425408-28426079,28426286-28426351 33 0.46 01_01_0929 - 7344911-7345978 33 0.46 12_01_0252 + 1868670-1869200,1870167-1871120 32 0.61 11_01_0252 + 1934505-1935032,1936001-1936957 32 0.61 10_08_0514 + 18465474-18465760,18465888-18465978,18466670-184667... 32 0.61 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 32 0.61 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 32 0.61 05_07_0219 - 28474661-28475146,28475979-28476644 32 0.61 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 32 0.61 03_05_0576 + 25765137-25766420 32 0.61 02_04_0520 - 23628183-23628195,23629354-23630036 32 0.61 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 32 0.61 01_02_0031 + 10364487-10365407 32 0.61 01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878,589... 32 0.61 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 32 0.80 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 32 0.80 11_06_0016 - 19284810-19284926,19285527-19286879 32 0.80 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 32 0.80 11_01_0066 - 536281-537196,537397-537452 32 0.80 10_08_0738 - 20212220-20212282,20212387-20212593,20212690-202128... 32 0.80 09_04_0580 + 18681019-18681475,18682637-18682920,18683088-186833... 32 0.80 09_04_0365 - 16962608-16963174,16963301-16963486,16963824-169638... 32 0.80 09_03_0145 - 12749288-12751510 32 0.80 08_02_1330 + 26191062-26191314,26191894-26191961,26192125-261923... 32 0.80 08_02_0796 - 21300251-21300373,21300846-21301721 32 0.80 08_02_0036 - 11455762-11455802,11455996-11456104,11456207-114568... 32 0.80 07_03_0527 - 19085828-19086319 32 0.80 07_03_0154 + 14509979-14512033 32 0.80 07_01_0714 - 5451246-5451408,5453401-5453534,5453608-5453796,545... 32 0.80 07_01_0516 - 3850252-3852870 32 0.80 06_02_0120 + 12055076-12055175,12055322-12055725 32 0.80 06_01_0178 + 1386981-1387505 32 0.80 05_04_0235 + 19291204-19291769,19291860-19292250 32 0.80 04_04_1582 - 34590698-34591199,34593849-34594690 32 0.80 04_04_1414 - 33394518-33394847 32 0.80 04_04_0360 - 24684159-24684565,24684654-24685089 32 0.80 04_04_0057 + 22410167-22411330 32 0.80 04_01_0354 - 4646826-4647314 32 0.80 04_01_0197 + 2323790-2324098,2324145-2324774 32 0.80 03_02_1033 + 13550955-13551700,13552837-13553290,13553451-135536... 32 0.80 03_02_1031 + 13541327-13542072,13543209-13543662,13543823-135440... 32 0.80 03_02_0738 - 10824121-10825572 32 0.80 03_02_0719 + 10654842-10654977,10655039-10655124,10655226-106570... 32 0.80 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 32 0.80 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 32 0.80 02_02_0682 - 12923103-12923747,12924607-12924870,12924953-129252... 32 0.80 01_06_1602 - 38559661-38559936,38560008-38560137,38562550-385627... 32 0.80 01_06_0561 + 30251547-30252173,30252248-30252405,30253250-302541... 32 0.80 01_01_0715 - 5542648-5543219,5543352-5543544 32 0.80 01_01_0046 - 331758-332627 32 0.80 12_02_1070 - 25814741-25815850 31 1.1 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 31 1.1 12_02_0687 + 22123216-22123760,22125021-22125330 31 1.1 11_06_0202 - 21184217-21184503,21184622-21184982 31 1.1 11_01_0281 + 2086674-2087652,2089200-2089483 31 1.1 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 31 1.1 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 31 1.1 10_06_0179 - 11508235-11508245,11508555-11508942 31 1.1 10_02_0009 + 4128909-4130123 31 1.1 09_02_0369 - 8012470-8013120 31 1.1 08_02_1084 - 24232968-24234779 31 1.1 08_02_1019 - 23657175-23658047 31 1.1 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 31 1.1 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 31 1.1 06_03_1153 - 28047125-28047751 31 1.1 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 31 1.1 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 31 1.1 06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734,916... 31 1.1 05_06_0078 - 25412770-25413852 31 1.1 05_05_0101 - 22398814-22399164 31 1.1 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 31 1.1 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 31 1.1 04_04_0146 + 23106325-23108154 31 1.1 04_01_0034 - 401208-402923 31 1.1 03_05_0843 + 28126480-28127007,28127092-28127457,28129388-281294... 31 1.1 03_05_0630 + 26260159-26260272,26260520-26260894 31 1.1 03_03_0193 - 15312568-15312753,15312811-15312933,15313112-153131... 31 1.1 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 31 1.1 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 31 1.1 03_02_0765 + 11000724-11002496 31 1.1 03_01_0343 - 2699518-2700114 31 1.1 02_05_0407 + 28715332-28715385,28715528-28715680,28715810-287158... 31 1.1 02_02_0338 + 9105725-9106581,9106950-9107091 31 1.1 02_01_0158 - 1103461-1104186 31 1.1 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 31 1.1 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 31 1.4 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 31 1.4 12_01_0838 - 7830944-7831444 31 1.4 12_01_0415 + 3292576-3293727 31 1.4 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 31 1.4 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 31 1.4 10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904... 31 1.4 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 31 1.4 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 31 1.4 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 31 1.4 09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155... 31 1.4 09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763... 31 1.4 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 31 1.4 08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695... 31 1.4 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 31 1.4 08_01_1038 + 10540185-10540709 31 1.4 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 31 1.4 08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287,164... 31 1.4 07_03_1751 - 29215074-29216270 31 1.4 07_03_0906 + 22481456-22481802,22482105-22482186,22482299-224824... 31 1.4 06_03_1506 + 30641428-30642168 31 1.4 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 31 1.4 06_03_0429 - 20701107-20701534,20701628-20701847 31 1.4 06_02_0126 + 12130409-12130532,12131015-12131373 31 1.4 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 31 1.4 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 31 1.4 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 31 1.4 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 31 1.4 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 31 1.4 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 31 1.4 04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463,871... 31 1.4 04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479... 31 1.4 03_06_0467 + 34145126-34145187,34145403-34145759,34146161-341462... 31 1.4 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 31 1.4 03_05_0252 - 22403504-22404676 31 1.4 03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539,117... 31 1.4 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 31 1.4 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 31 1.4 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 31 1.4 02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396,105... 31 1.4 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 31 1.4 01_01_0082 + 625198-625719 31 1.4 12_01_0981 + 9931542-9931606,9931779-9933105 27 1.8 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 31 1.9 10_08_0638 - 19503580-19503990 31 1.9 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 31 1.9 10_08_0213 - 15912048-15912716 31 1.9 10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 31 1.9 09_04_0608 + 18924648-18924899,18926341-18926435,18926903-189272... 31 1.9 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 31 1.9 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 31 1.9 08_01_0134 + 1067826-1068158 31 1.9 07_01_0862 - 7172083-7172931 31 1.9 06_03_1370 + 29645598-29646288,29646364-29646752 31 1.9 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 31 1.9 05_04_0337 - 20372378-20373094,20373320-20373379,20373992-203742... 31 1.9 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 31 1.9 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.9 04_04_1125 + 31085106-31085714 31 1.9 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 31 1.9 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 31 1.9 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 31 1.9 02_05_0405 + 28708077-28708391,28708478-28708573,28709030-287094... 31 1.9 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 31 1.9 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 31 1.9 01_06_1321 + 36280691-36281269 31 1.9 01_01_0445 - 3319451-3320035 31 1.9 12_02_1057 + 25733376-25735439 30 2.5 11_01_0359 - 2731522-2732346 30 2.5 10_08_0880 + 21267034-21267537 30 2.5 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 30 2.5 09_06_0083 + 20753191-20754480 30 2.5 09_04_0506 - 18188785-18190599 30 2.5 09_04_0324 - 16686872-16687074,16687479-16687521,16687735-166880... 30 2.5 09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443,404... 30 2.5 08_02_1040 - 23873354-23874509,23875645-23875796 30 2.5 08_01_0434 + 3809681-3810016,3810039-3811100 30 2.5 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 30 2.5 07_01_0479 + 3606663-3607448 30 2.5 07_01_0389 - 2915191-2915604,2915696-2915752,2915867-2915922,291... 30 2.5 06_03_0743 + 24069752-24070483,24071890-24072345 30 2.5 06_03_0729 + 23927656-23927661,23927774-23927923,23928316-239285... 30 2.5 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 30 2.5 06_02_0127 + 12140843-12140966,12141170-12141567 30 2.5 06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 30 2.5 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 30 2.5 06_01_0690 + 5033943-5034740 30 2.5 06_01_0553 + 3942907-3943617 30 2.5 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 30 2.5 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 30 2.5 04_04_1560 - 34432491-34432837,34433097-34433292 30 2.5 03_06_0301 - 32974276-32974638,32974842-32974967,32975056-329751... 30 2.5 03_01_0178 + 1437263-1438017,1438754-1438858,1438950-1439072,143... 30 2.5 02_02_0444 + 10340927-10341063,10341157-10341241,10341480-103415... 30 2.5 01_06_1705 + 39312648-39314246 30 2.5 01_06_0289 + 28233327-28233815 30 2.5 01_06_0146 + 26969011-26969995,26970878-26970930 30 2.5 01_05_0024 - 17262504-17263308,17264251-17264399,17264879-172649... 30 2.5 12_02_1219 + 27096477-27096590,27096704-27097078 30 3.2 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 30 3.2 11_06_0692 + 26327487-26328509 30 3.2 10_08_0127 - 15010125-15011068,15011328-15011835 30 3.2 09_06_0125 - 21011757-21012428 30 3.2 09_02_0327 - 7284829-7284889,7284946-7286126 30 3.2 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 30 3.2 08_02_1204 - 25267546-25268219,25268319-25268452,25269567-252696... 30 3.2 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 30 3.2 08_02_0737 - 20572068-20572290,20572785-20572841,20573482-205736... 30 3.2 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 30 3.2 06_03_1172 - 28147957-28148274,28149362-28149877 30 3.2 06_03_1133 - 27886823-27887088,27887837-27888629,27888674-27889000 30 3.2 06_03_0905 + 25843547-25844314 30 3.2 06_01_0586 - 4203024-4203425,4203527-4203595,4203681-4203746,420... 30 3.2 05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 30 3.2 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 30 3.2 05_05_0293 + 23896011-23896207,23896309-23896366,23896502-238966... 30 3.2 05_01_0210 + 1583176-1584177 30 3.2 04_04_1478 - 33882625-33883639,33883725-33883849,33883935-338841... 30 3.2 04_04_0267 + 24048649-24049140,24049521-24049835 30 3.2 02_05_0750 - 31479876-31480985 30 3.2 02_05_0432 + 28936293-28936796,28937382-28939250 30 3.2 02_03_0279 + 17250347-17252098 30 3.2 02_01_0016 + 110796-110979,111252-111768,111847-112213 30 3.2 01_07_0122 - 41196081-41196205,41197561-41198245,41198961-411993... 30 3.2 01_06_1809 - 40029628-40030539 30 3.2 01_06_1236 + 35613123-35613816,35615809-35615952,35616032-356161... 30 3.2 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 30 3.2 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 30 3.2 01_01_0656 + 5013609-5014256 30 3.2 01_01_0073 + 555485-556315 30 3.2 12_02_0233 - 16023062-16023253,16023528-16023609,16023699-160238... 29 4.3 11_06_0506 - 24380469-24380632,24381737-24383893,24384488-243845... 29 4.3 10_08_0222 - 15983756-15984313 29 4.3 10_07_0161 - 13674631-13675433,13675793-13675862 29 4.3 09_04_0180 + 15367737-15367755,15368874-15369739 29 4.3 08_02_0839 + 21693348-21694853 29 4.3 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 29 4.3 08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572,460... 29 4.3 07_03_1433 + 26513728-26514135,26525534-26526280 29 4.3 07_03_1012 + 23295976-23296264,23296475-23296548,23296972-232969... 29 4.3 07_03_0190 + 14893243-14893582,14893684-14893808 29 4.3 07_01_0466 - 3518315-3521428 29 4.3 06_03_1515 - 30707600-30707613,30708093-30708167,30708596-307086... 29 4.3 06_03_1211 - 28448429-28449295,28449825-28449860,28451010-284511... 29 4.3 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 4.3 06_03_0395 - 20354713-20355570 29 4.3 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 29 4.3 06_03_0219 - 18227559-18227858,18227864-18228340 29 4.3 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 29 4.3 05_01_0162 - 1095020-1095202,1096114-1096188,1096939-1097039,109... 29 4.3 04_04_1400 - 33259716-33260069,33260172-33260219,33260471-332605... 29 4.3 04_04_0746 + 27726736-27727118,27727518-27727544,27728042-277281... 29 4.3 04_04_0675 + 27183826-27184443 29 4.3 04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 29 4.3 04_03_0098 + 11183039-11183752 29 4.3 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 4.3 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 29 4.3 03_05_0292 + 22846273-22846377,22847161-22847823 29 4.3 03_02_0761 - 10963045-10963482,10963713-10963889,10964151-109642... 29 4.3 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 29 4.3 03_01_0092 - 731069-731434,731569-733080 29 4.3 02_05_0246 + 27136590-27138610,27138933-27139056,27139401-271396... 29 4.3 02_05_0201 + 26687369-26689228 29 4.3 02_04_0563 - 23895573-23895614,23896330-23896390,23896901-238970... 29 4.3 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 29 4.3 02_02_0240 + 8196140-8198248,8198381-8198650 29 4.3 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 4.3 01_06_0922 - 33022709-33023545 29 4.3 12_02_1177 - 26708215-26708309,26708355-26708392,26708476-267095... 29 5.7 12_02_1007 - 25248653-25249078,25249956-25250021,25250108-252502... 29 5.7 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 29 5.7 12_01_0495 - 3935395-3937110 29 5.7 12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 29 5.7 11_04_0415 - 17395988-17396161,17397349-17397444,17397489-173980... 29 5.7 11_03_0163 - 10970459-10970725 29 5.7 10_08_0221 - 15980370-15980927 29 5.7 10_08_0220 - 15977247-15977804 29 5.7 10_08_0216 - 15942379-15942852,15942956-15943033 29 5.7 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 29 5.7 09_02_0495 + 9880714-9881196 29 5.7 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 29 5.7 08_02_1390 - 26665605-26665933,26665939-26666023 29 5.7 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 29 5.7 08_02_0224 + 14457427-14457879 29 5.7 07_01_0812 + 6381428-6381880 29 5.7 06_03_1048 + 27146475-27146652,27146739-27146804,27146880-271469... 29 5.7 06_03_0248 - 18696184-18696199,18696920-18697314 29 5.7 06_01_0978 + 7595641-7595843,7595952-7596072,7596176-7596253,759... 29 5.7 06_01_0944 + 7264833-7265120,7265511-7265600,7265702-7265798,726... 29 5.7 05_07_0302 - 29091666-29092331 29 5.7 05_07_0125 + 27861368-27862282 29 5.7 05_05_0354 - 24347550-24347870 29 5.7 05_04_0399 - 20955319-20955838,20955939-20956201 29 5.7 05_03_0398 - 13515850-13516302 29 5.7 05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605,518... 29 5.7 04_04_1421 - 33449539-33449994 29 5.7 04_04_0900 + 29232365-29232931 29 5.7 04_04_0351 + 24615858-24616448 29 5.7 04_03_0874 + 20467608-20468306,20468575-20468736,20470083-204701... 29 5.7 04_01_0047 - 519802-519817,519897-519939,519983-520025,520193-52... 29 5.7 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 29 5.7 03_05_0543 - 25404630-25405408,25405461-25405605 29 5.7 03_03_0278 - 16126803-16129049 29 5.7 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 29 5.7 03_02_0342 - 7645323-7645909,7646323-7646491 29 5.7 02_05_0664 + 30717551-30719491 29 5.7 02_05_0149 + 26290236-26290880 29 5.7 02_04_0242 + 21210062-21210541 29 5.7 01_06_1794 - 39919363-39920025 29 5.7 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 29 5.7 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 5.7 01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664,876... 29 5.7 01_01_0995 + 7875273-7875495,7876196-7876274,7876422-7876536,787... 29 5.7 05_04_0011 + 17139322-17139451,17139552-17140174 25 6.9 12_02_1274 - 27480012-27480383 29 7.5 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 7.5 11_06_0081 + 19886848-19888050,19888243-19888896 29 7.5 10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626... 29 7.5 10_08_0543 - 18649894-18650233,18651446-18651981 29 7.5 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 29 7.5 10_08_0233 - 16061182-16061714,16062765-16063578 29 7.5 10_08_0218 - 15967064-15967906 29 7.5 10_08_0217 - 15962192-15962884 29 7.5 10_03_0012 - 7037088-7037282,7037453-7037954,7038079-7038081,704... 29 7.5 10_01_0291 + 3010685-3010838,3010954-3011489 29 7.5 10_01_0290 + 2999775-2999928,3000281-3000816 29 7.5 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 29 7.5 09_04_0072 + 14323449-14324274,14324351-14324447,14325175-143252... 29 7.5 09_02_0603 - 11150739-11150746,11150791-11151340 29 7.5 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 29 7.5 08_02_0697 + 20144063-20144341,20144755-20145366 29 7.5 07_03_1771 - 29404972-29405175,29405282-29405677 29 7.5 07_03_1382 - 26170563-26170631,26171151-26171843 29 7.5 07_03_1094 + 23919878-23920520,23921297-23921363,23921364-239214... 29 7.5 07_01_0973 - 8193002-8193261,8193388-8193485,8194117-8194401,819... 29 7.5 07_01_0753 - 5799733-5799741,5799938-5800642 29 7.5 07_01_0678 - 5103836-5104613,5104697-5104888,5104994-5105036,510... 29 7.5 07_01_0015 + 108338-109186 29 7.5 06_03_1146 - 28004896-28005554,28005664-28005844 29 7.5 06_03_0809 + 24814590-24816593 29 7.5 06_02_0125 + 12122812-12122911,12123647-12123993 29 7.5 06_01_0931 + 7192519-7194075 29 7.5 06_01_0760 - 5676973-5677830 29 7.5 05_05_0334 + 24156532-24156565,24156681-24156782,24157145-241572... 29 7.5 05_03_0665 - 16774043-16774522 29 7.5 05_03_0031 - 7534327-7534480,7535546-7535649,7535724-7535793,753... 29 7.5 05_02_0122 - 6840840-6841307 29 7.5 05_01_0142 - 940421-940701,941262-941574 29 7.5 04_04_1292 - 32413046-32413807,32413901-32413936,32414037-324141... 29 7.5 04_04_1126 + 31095651-31096115 29 7.5 04_04_1107 - 30954647-30954769,30955052-30955141,30955309-309556... 29 7.5 04_04_0708 - 27441373-27442611 29 7.5 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 29 7.5 04_03_0904 + 20717005-20718087 29 7.5 03_05_0688 + 26762668-26762893,26763027-26763101,26763865-267640... 29 7.5 03_05_0267 - 22538631-22539452 29 7.5 03_03_0208 + 15459260-15459922 29 7.5 02_02_0582 - 11798252-11798908 29 7.5 02_02_0029 + 6204557-6204734,6205105-6205207,6205970-6206108 29 7.5 02_01_0584 - 4326072-4326094,4326306-4326885 29 7.5 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 29 7.5 01_06_0046 + 25943183-25943590 29 7.5 01_06_0027 - 25742122-25742310,25742481-25742553,25743219-25744159 29 7.5 01_06_0004 + 25507739-25508206,25509346-25509477,25509910-255100... 29 7.5 01_05_0230 + 19543410-19543722,19544165-19544238 29 7.5 01_05_0214 - 19362812-19363477 29 7.5 01_03_0005 + 11568545-11569119,11569179-11569191 29 7.5 03_03_0188 + 15269347-15270213 25 8.9 04_04_1630 - 34896021-34896143,34896329-34896403,34896500-348965... 24 9.5 12_01_0442 + 3495333-3496484 28 9.9 12_01_0373 + 2897874-2898911 28 9.9 11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973... 28 9.9 11_04_0474 + 18162538-18163731,18163800-18163855,18163951-181640... 28 9.9 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 28 9.9 10_08_0922 - 21593030-21593225,21593319-21594142 28 9.9 10_08_0809 - 20725858-20725950,20726375-20726545,20726895-207271... 28 9.9 10_08_0544 - 18655186-18655567,18656835-18657151 28 9.9 10_08_0226 - 16001958-16002527 28 9.9 10_08_0223 - 15986763-15987575 28 9.9 09_06_0127 + 21019266-21019670 28 9.9 09_04_0168 - 15295442-15295477,15295478-15295552,15295660-152957... 28 9.9 09_02_0322 - 7240125-7241568,7242043-7243253,7245782-7246144,724... 28 9.9 08_02_1455 + 27230134-27231110,27231195-27231327,27231417-272315... 28 9.9 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 28 9.9 08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541... 28 9.9 08_01_0060 - 413088-413999 28 9.9 07_03_1636 + 28290642-28291574 28 9.9 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/32 (59%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPS-TRPXLALSXPXXPPPPPXP 743 PPPP P PPPS +P A S P PPPPP P Sbjct: 544 PPPPPPPPPPPSGNKP--AFSPPPPPPPPPPP 573 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP + A S P PPPPP Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXP----PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P PP P + P PPPPP P Sbjct: 638 PPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P + PPPPP P Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PP T PPP P Sbjct: 762 PAPPPPPPQAPKPPGTVPPPPP 783 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP+ R P PPPPP P Sbjct: 689 PPPPPPPPLPPANRTN-GPGVPSAPPPPPPP 718 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPXPXXPPP--STRPXLALSXPXXPPPPP 737 PPPP P PP + P + + P PPPPP Sbjct: 690 PPPPPPPLPPANRTNGPGVPSAPPPPPPPPP 720 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPP P ++ P PPPPP P Sbjct: 600 PSPPPPPPPPPILPNRSV-PPPPPPPPPLP 628 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P S P A + PPPPP P Sbjct: 665 PPPPPPPPRSSSRTPTGAATSSKGPPPPPPP 695 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P+ L S P PPPPP Sbjct: 585 PPPPPPPPPLPN---CLVPSPPPPPPPPP 610 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P T A S PPPPP P Sbjct: 666 PPPPPPPRSSSRTPTGAATSSKGPPPPPPPP 696 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = +3 Query: 921 PPPPPXXPXPP----PXTSPPPXP 980 PPPPP P PP P SPPP P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPP 567 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXP------PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P PP P L PPPPP P Sbjct: 605 PPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPP 641 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + P PPPP P Sbjct: 618 PPPPPP--PPPLPNHSVLPPPPPPPPPPSLP 646 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXX--------PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 571 PPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPP 609 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPPXXP-------XPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLP 628 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 619 PPPPPPPPLPNHSVLPPPPP 638 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPP S P P PPP P Sbjct: 709 PSAPPPPPPPPPANRSNGPSAPAPPLPPPLP 739 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPPXXP-------XPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPPP 573 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPPX-------XPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPPXXP-------XPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 567 PPPPPPPPLPQSNYASSQPPPPPPPPPLP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXP---XPPPXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPPPP 610 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 915 PLPPPPPXXP----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 619 PPPPPPPPLPNHSVLPPPPPPPPP 642 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LP P P PPP PPP P Sbjct: 534 LPSPSPTAAAPPPPPPPPPPP 554 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS-----PPPXP 980 P PPPPP P P P ++ PPP P Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPP 589 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP--------PPPPXP 743 PPPP P PPP + P + P P PPPP P Sbjct: 634 PPPPPP--PPPPSLPNRLVPPPPAPGIGNKFPAPPPPPP 670 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 5/27 (18%) Frame = +3 Query: 915 PLPPPPP-----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 620 PPPPPPPLPNHSVLPPPPPPPPPPSLP 646 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L + PPPPP P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L+ PPPPP P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPP--XTSPPPXP 980 P PPPPP P PPP T+P P P Sbjct: 352 PPPPPPPPPPPPPPKLNTAPKPPP 375 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 349 PPPPPPPPPPPP---PPPPP 365 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 349 PPPPPPPPPPPPPP---PPP 365 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP T P PP PPP Sbjct: 362 PPPPKLNTAPKPPPPPPP 379 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPPXXPXPP-------PXTSPPPXP 980 P PPPPP P PP P PPP P Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 P PP P PPPS L P PP P Sbjct: 371 PKPPPPPPPPPSVPSNNNLPKPAEPPAVP 399 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P P P PPP PPP P Sbjct: 340 PRPVQPSNAPPPPPPPPPPPPP 361 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 681 PSTRPXLALSXPXXPPPPPXP 743 PS RP + P PPPPP P Sbjct: 338 PSPRPVQPSNAPPPPPPPPPP 358 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PS P P PPPPP P Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPP 365 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXXPPPST---RPXLALSXPXXPPPPP 737 PPPP P PPP+ + P PPPPP Sbjct: 368 PPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPP 399 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P S PP P P Sbjct: 397 PPPPTPPPPPPLLAPKQQSSGGPILPPAPAP 427 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPPP + P Sbjct: 395 PPPPPPTPPPPPPLLAP 411 Score = 29.9 bits (64), Expect(2) = 0.003 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 365 PPPPPPPPPPPPPP 378 Score = 29.1 bits (62), Expect(2) = 0.003 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 933 PXXPXPPPXTSPPPXP 980 P P PPP T PPP P Sbjct: 392 PAVPPPPPPTPPPPPP 407 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPP 973 PPPP T PPPP + P Sbjct: 395 PPPPPPTPPPPPPLLAP 411 Score = 28.7 bits (61), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXI 964 PPPPP PPPP + Sbjct: 366 PPPPPPPPPPPPPAV 380 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-----LSXPXXPPPPPXP 743 PPPP P PPP P LA P PP P P Sbjct: 395 PPPPPPTPPPPP--PLLAPKQQSSGGPILPPAPAPP 428 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PP T Sbjct: 365 PPPPPP---PPPPPPPPAVT 381 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT 962 P PPPPP P PP T Sbjct: 366 PPPPPPPPPPPPPAVT 381 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P L+ S P PPPPP P Sbjct: 1161 PPSPPPATPPPP--PPLSPSLPPPPPPPPLP 1189 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PP--PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP PP P PPP+T P P PPPPP P Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P L P P PPP P Sbjct: 1172 PPPLSPSLPPPPPPPPLPSGPPPQPAPPPLP 1202 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +3 Query: 651 PPPPXPXXPPPS-TRPXLALSXPXXPPPP 734 PPPP P PPP P L + P PPPP Sbjct: 1184 PPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP +PPP P Sbjct: 1181 PPPPPPPLPSGPPPQPAPPPLP 1202 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPP------PSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P +P L S P PPPP P Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPP 1174 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/25 (64%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPP-PPPXXPXPPPXTSP--PPXP 980 PLPP PPP P PPP SP PP P Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPP 1183 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP PPP P Sbjct: 1170 PPPPPLSPSLPPPPPPPPLP 1189 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/27 (59%), Positives = 16/27 (59%), Gaps = 5/27 (18%) Frame = +3 Query: 915 PLP---PP--PPXXPXPPPXTSPPPXP 980 PLP PP PP P PPP T PPP P Sbjct: 1148 PLPSDSPPCQPPLPPSPPPATPPPPPP 1174 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP PPP PPP Sbjct: 1168 TPPPPPPLSPSLPPPPPPPP 1187 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPP-XTSPPPXP 980 PLP PP P PPP PPP P Sbjct: 1187 PLPSGPPPQPAPPPLPIQPPPIP 1209 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PP PP T PPPP + P Sbjct: 1161 PPSPPPATPPPPPPLSP 1177 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PS P P PPP P Sbjct: 1180 PPPPPPPPLPSGPPPQPAPPPLPIQPPPIP 1209 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PP PPP P Sbjct: 1193 PPQPAPPPLPIQPPPIPPPPVP 1214 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P P P SPP P Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQP 1158 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS-PPPXP 980 PL P P P PPP S PPP P Sbjct: 1174 PLSPSLPPPPPPPPLPSGPPPQP 1196 >03_02_0446 - 8567436-8567567,8567649-8567768,8569837-8569914, 8570018-8570122,8570214-8570306,8570464-8570619 Length = 227 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/64 (29%), Positives = 28/64 (43%) Frame = +1 Query: 235 RNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGG 414 R+ + + + ++ F VE FW H+ L +F G RP+WE A GG Sbjct: 67 RSQSYEDNIKKIVDFSTVESFWVCYCHLTRPVSLPSPTDLHLFKEGIRPLWEDPANRSGG 126 Query: 415 XWXI 426 W I Sbjct: 127 KWII 130 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPP 377 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 357 PPPPPPPPPPPPPPPRPPPPPP 378 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 358 PPPPPPPPPPPPPPRPPPPPPP 379 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 354 PPPPPPPPPPPPPPPPPPRP 373 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 353 PPPPPPPPPPPPPPP----PPPPRPPPPPPP 379 Score = 36.3 bits (80), Expect = 0.037 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +PPPPP P PPP PPP Sbjct: 352 MPPPPPPPPPPPPPPPPPP 370 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PPPP P PPP PPP P Sbjct: 351 LMPPPPPPPPPPPPPPPPPPP 371 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPP 374 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPP 375 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPP 376 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P PPP P Sbjct: 361 PPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPP P Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT--SPPPXP 980 P PPPP P PPP +PPP P Sbjct: 366 PPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 353 PPPPP----PPPPPPPPP 366 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG GG GG GGG G G C G G G Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSG 83 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGG 66 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGG 61 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 44 GGGGGGGSGGGGGGGGGGGGGG 65 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 60 GGGGGGGSGGGCGGGGGGGG 79 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGG 62 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 42 GGGGGGGGGSGGGGGGGGGGGG 63 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 43 GGGGGGGGSGGGGGGGGGGGGG 64 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSG 68 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 57 GGGGGGGGGGSGGGCGGGGGGG 78 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 58 GGGGGGGGGSGGGCGGGGGGGG 79 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 53 GGGGGGGGGGGGGGSGGGCGGG 74 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 54 GGGGGGGGGGGGGSGGGCGGGG 75 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 56 GGGGGGGGGGGSGGGCGGGGGG 77 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 50 GSGGGGGGGGGGGGGGGSGG 69 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 48 GGGSGGGGGGGGGGGGGGGSGG 69 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGG G G Sbjct: 49 GGSGGGGGGGGGGGGGGGSGGG 70 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GG G GGGGG Sbjct: 61 GGGGGGSGGGCGGGGGGGGG 80 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGG G Sbjct: 62 GGGGGSGGGCGGGGGGGGGSSG 83 >01_07_0331 + 42804385-42804659,42806175-42806340,42806424-42806549, 42807142-42807207,42807645-42807698,42808843-42809019, 42809100-42809102 Length = 288 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/58 (32%), Positives = 23/58 (39%) Frame = +1 Query: 247 WXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXW 420 W + + TF VE FW L ++I S L G F P WE GG W Sbjct: 74 WGSSIRPIHTFSTVEDFWSLYNNIHHPSKLVVGADFHCFKNKIEPKWEDPICANGGKW 131 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP TSPPP P Sbjct: 430 PPPPPEHPPPPESTSPPPPP 449 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP ST P + P PPP P Sbjct: 431 PPPPEHPPPPESTSPPPPPTSDPPPVPPPPP 461 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXXPPP---STRPXLALSXPXXPPPPP 737 PPPP PPP S P P PPPPP Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPPVPPPPP 461 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP + PPP P Sbjct: 438 PPPESTSPPPPPTSDPPPVP 457 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPPXT 979 T PPPPP + PPP PPP T Sbjct: 443 TSPPPPPT-SDPPPVPPPPPTT 463 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +3 Query: 654 PPPXPXXP--PPSTR----PXLALSXPXXPPPPPXP 743 PPP P P PP + P P PPPPP P Sbjct: 506 PPPFPSAPNTPPGFQGLAGPFYGPPYPAPPPPPPPP 541 >10_08_0323 + 16743358-16743566,16744536-16744704,16744834-16744959, 16745813-16745878,16745997-16746047 Length = 206 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/60 (31%), Positives = 23/60 (38%) Frame = +1 Query: 247 WXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 W L + TF VE FW L I S + +F G P WE GG W + Sbjct: 52 WGTSLRKAYTFDTVEEFWGLYDQIFRPSKVTVNADFHLFKAGVEPKWEDPECANGGKWTV 111 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +R P PPPPP P Sbjct: 327 PPPAPPPPPPPPSRFNNTTPKPPPPPPPPEP 357 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL--SXPXXPPPPPXP 743 PP P PPP P + P PPPPP P Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPP 355 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P T+P P P Sbjct: 329 PAPPPPPPPPSRFNNTTPKPPP 350 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 107 PPPPPPPPSPPPSAPPPPPP 126 Score = 36.3 bits (80), Expect = 0.037 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP ++PPP P Sbjct: 106 PPPPPPPPPSPPPSAPPPPP 125 Score = 35.1 bits (77), Expect = 0.086 Identities = 26/112 (23%), Positives = 28/112 (25%), Gaps = 4/112 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-LSXPXXPPPP---PXPXXXXXXXXXXXXXXXXXXXXXXXXX 818 PPP P PPP +P + P PPP P P Sbjct: 22 PPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQ 81 Query: 819 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPP 974 P PPP P PPP T PPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 33.9 bits (74), Expect = 0.20 Identities = 26/113 (23%), Positives = 27/113 (23%), Gaps = 3/113 (2%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXX 821 PPP P PPP P L+ P PPP P P Sbjct: 31 PPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYY 90 Query: 822 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PP P Sbjct: 91 QPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +2 Query: 920 PPPPPXXTXPP--PPXIPPPXT 979 PPPPP + PP PP PPP T Sbjct: 108 PPPPPPPSPPPSAPPPPPPPPT 129 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPP PP Sbjct: 82 PPPPPQMYYQPPPPPPP 98 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 38.3 bits (85), Expect = 0.009 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXPXXPP-PSTRPXLALSXPXXPPPPP 737 P P P PP PS P LA S P PPPPP Sbjct: 56 PTSPPPASPPLPSATPPLAASPPPPPPPPP 85 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P SPP P Sbjct: 77 PPPPPPPPPPRNSPSPPKPP 96 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP-PPXP 980 P PPPPP PPP SP PP P Sbjct: 77 PPPPPPP----PPPRNSPSPPKP 95 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPX--LALSXPXXPPPPPXP 743 PPPP P P S+ P A S P PPPPP P Sbjct: 204 PPPPPPPPLPASSEPVDPSAASLPPLPPPPPPP 236 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P + L P PPPPP P Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPGP 260 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPS--TRPXLALSXPXXPPPPPXP 743 PPPP P P S P A P PPPPP P Sbjct: 205 PPPPPPPLPASSEPVDPSAASLPPLPPPPPPPP 237 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP +P P P PPP P Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPP 255 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/32 (53%), Positives = 18/32 (56%), Gaps = 3/32 (9%) Frame = +3 Query: 657 PPXPXXPP--PSTRPX-LALSXPXXPPPPPXP 743 PP P PP PS +P LA P PPPPP P Sbjct: 358 PPLPPRPPTMPSMQPDMLAPGVPRFPPPPPPP 389 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXL-ALSXPXXPPPPPXP 743 PP P P PPP A P PPPPP P Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPPPPP 258 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P + P L L P PPP P P Sbjct: 232 PPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 PLPPPPP P PPP P Sbjct: 249 PLPPPPPPPPGPPPREIVP 267 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P L PPPPP P Sbjct: 253 PPPPPPGPPPREIVPGQTL---LPPPPPPRP 280 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P + + P PPPP P Sbjct: 384 PPPPPPDTRPPFMAPGVN-ARPLPPPPPGLP 413 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPX-LALSXPXXPPPPPXP 743 PPPP PPP TRP +A P PPP P Sbjct: 383 PPPP----PPPDTRPPFMAPGVNARPLPPPPP 410 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 915 PLPPPPPXXPXP------PPXTSPPPXP 980 PLPPPPP P P P PPP P Sbjct: 228 PLPPPPPPPPKPANIAGAPGLPLPPPPP 255 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPP P + PPPP P Sbjct: 249 PLPPPPPPPPGPPPREIVPGQTLLPPPPPP 278 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPP I P T Sbjct: 251 PPPPPPPPGPPPREIVPGQT 270 >02_03_0120 + 15463163-15465250 Length = 695 Score = 37.5 bits (83), Expect = 0.016 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLPPPP P PPP + PPP Sbjct: 299 PLPPPPSPSPSPPPPSPPPP 318 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPPS P P PPPPP P Sbjct: 294 PPNNQPLPPPPSPSPS---PPPPSPPPPPHP 321 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPPXP 743 PPP P PP+ +P P PPPP P Sbjct: 284 PPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSP 315 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PPP T Sbjct: 127 PPPPPPHPLPPPPPTPPPPT 146 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPP P PPP T PPP Sbjct: 127 PPPPPPHPLP-PPPPTPPPP 145 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP 695 PPPP P PPP T P Sbjct: 129 PPPPHPLPPPPPTPP 143 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPP 737 PPPP P P PPST + P PPPPP Sbjct: 33 PPPPPPLEPAPPSTPQLRGEASPPPPPPPP 62 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LPPPPP P PPP P P Sbjct: 25 LPPPPPPHPPPPPPLEPAP 43 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP-----XXPPPPPXP 743 PPPP P PPP S P PPPPP P Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPP 61 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP PP Sbjct: 27 PPPPPHPPPPPPLEPAPP 44 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP + + S P PPPP P Sbjct: 35 PPPPLEPAPPSTPQLRGEASPPPPPPPPVGP 65 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PP +PP P Sbjct: 26 PPPPPPHPPPPPPLEPAPPSTP 47 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 37.1 bits (82), Expect = 0.021 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LPPPPP P PPP PPP Sbjct: 424 LPPPPPLPPPPPPPPPPPP 442 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P L + P PPPP P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPP---PXTSPPPXP 980 PLPPPPP P PP P PPP P Sbjct: 429 PLPPPPPPPPPPPPPLPPNMPPPLP 453 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L PP PP P Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 437 PPPPPPPLPPNMPPPLPPPPEP 458 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P P PPP P P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPP PPPP PPP Sbjct: 422 TELPPPPPLPPPPPPPPPPP 441 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP PPP P Sbjct: 425 PPPPPLPP-PPPPPPPPPPPLP 445 >08_01_0059 - 394001-394708 Length = 235 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P S P PPPPP P Sbjct: 11 PPPPATPPPPPRRAPPPP-SPPIRPPPPPTP 40 Score = 36.3 bits (80), Expect = 0.037 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP PPP +PPP P Sbjct: 1 MPPPPPPRRAPPPPATPPPPP 21 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP + P LA P PP P P Sbjct: 37 PPTPRPYAPPPPSHP-LAPPPPHISPPAPVP 66 Score = 33.5 bits (73), Expect = 0.26 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPPP P PPP +PPP Sbjct: 11 PPPPATPPPPPRRAPPP 27 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P ++ P PPP P P Sbjct: 46 PPPSHPLAPPP---PHISPPAPVPPPPSPPP 73 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPP P PPP T PPP Sbjct: 2 PPPPPPRRAP-PPPATPPPP 20 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P P PPPP P Sbjct: 3 PPPPPRRAPPPPATPP---PPPRRAPPPPSP 30 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP P PP PPP P Sbjct: 11 PPPPATPPPPPRRAPPPPSP 30 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP--PPXP 980 P PP PP P PPP P PP P Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP I PP Sbjct: 45 PPPPSHPLAPPPPHISPP 62 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXP--XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP T A P P PP P Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +3 Query: 921 PPPPPXXPXPP-PXTSPPPXP 980 PPPP P PP P PPP P Sbjct: 18 PPPPRRAPPPPSPPIRPPPPP 38 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPPPPXXPXP---PPXTSPPP 974 PL PPPP P PP SPPP Sbjct: 51 PLAPPPPHISPPAPVPPPPSPPP 73 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP--PPXP 980 P PPPP PPP + P PP P Sbjct: 14 PATPPPPPRRAPPPPSPPIRPPPP 37 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPP PP P I PP Sbjct: 16 TPPPPPRRAPPPPSPPIRPP 35 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPX--PXXP-PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P PP P P PPPP P Sbjct: 18 PPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHP 51 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP R P PPPPP P Sbjct: 47 PPPPQPTLPPPPPRTL----PPPPPPPPPQP 73 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P P PPP T PPP P Sbjct: 48 PPPQPTLPPPPPRTLPPPPP 67 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP T PPPP PPP Sbjct: 53 TLPPPPPR-TLPPPPPPPPP 71 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP PPP P Sbjct: 52 PTLPPPPPRTLPPPPPPPPPQP 73 >07_01_0080 + 587674-588510 Length = 278 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP S P P PPPPP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P + P P PPPPP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPP 114 Score = 35.5 bits (78), Expect = 0.065 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP PPP Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPX---XPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP----PPXXPXPPPXTSPPPXP 980 P PPP PP P PPP PPP P Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PP T Sbjct: 105 PPPPPPPPPPPPPPPPPLFT 124 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP SPPP P Sbjct: 91 PPPPP--PPPPSSGSPPPPP 108 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL--SXPXXPPPPPXP 743 PPPP P PPP LA S P P PPP P Sbjct: 46 PPPPSPPPPPPLDEETLAQFPSPPTNPSPPPPP 78 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 8/30 (26%) Frame = +3 Query: 915 PLPPPPPXX--------PXPPPXTSPPPXP 980 P PPPPP P PP SPPP P Sbjct: 49 PSPPPPPPLDEETLAQFPSPPTNPSPPPPP 78 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/23 (65%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +3 Query: 918 LPP--PPPXXPXPPPXTSPPPXP 980 LPP PPP P PPP +SPPP P Sbjct: 85 LPPSSPPPPSPPPPPPSSPPPVP 107 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/32 (53%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLAL--SXPXXPPPPPXP 743 PPP P PPS P AL S P P PPP P Sbjct: 70 PPPPPR--PPSFAPENALPPSSPPPPSPPPPP 99 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P P + P + P PPPPP Sbjct: 72 PPPRPPSFAPENALPPSSPPPPSPPPPPP 100 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP 725 PPPP P PPPS+ P + S P Sbjct: 90 PPPPSPPPPPPSSPPPVPPSPTAAP 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P + P PPPPP Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPSPPPPP 99 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PP SP P Sbjct: 93 PSPPPPPPSSPPPVPPSPTAAP 114 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 6/27 (22%) Frame = +3 Query: 918 LPPPPPXXPX--P----PPXTSPPPXP 980 LPPPPP P P PP + PPP P Sbjct: 69 LPPPPPRPPSFAPENALPPSSPPPPSP 95 >03_01_0515 - 3864796-3865425 Length = 209 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/25 (60%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPP---XXPXPPPXTSPPPXP 980 PLPPPPP P PPP + PPP P Sbjct: 87 PLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P P PPP P Sbjct: 61 PPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPP 93 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP P PPP SPPP P Sbjct: 84 PPPPLPPPPPPPAASPPPPP 103 Score = 35.9 bits (79), Expect = 0.049 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP + PP P Sbjct: 83 PPPPPLPPPPPPPAASPPPP 102 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P A S P PP PP P Sbjct: 83 PPPPPLPPPP---PPPAASPPPPPPSPPPP 109 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = +2 Query: 920 PPPPPXXTX-PPPPXIPPP 973 PPPPP T PPPP +PPP Sbjct: 73 PPPPPSVTSSPPPPPLPPP 91 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP P + P PPPP P Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXX---PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPP 95 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P P S PP P Sbjct: 100 PPPPPSPPPPSPVKSSPPPP 119 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P PPPPP Sbjct: 92 PPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 660 PXPXXPPPS--TRPXLALSXPXXPPPPPXP 743 P P PPPS + P + P PPPPP P Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPPPPP 77 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P +SPPP P Sbjct: 99 PPPPPPSPPPPSPVKSSPPPPP 120 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPP P Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXP-----XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPPPP P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSP 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP------PPPPXP 743 P PP PPP P S P P PPPP P Sbjct: 40 PSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPP 76 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXI--PPP 973 T PPPP PPPP PPP Sbjct: 80 TSSPPPPPLPPPPPPPAASPPP 101 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPP 348 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPP 357 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P S P PPPPP Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPP--PPPPP 370 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP + PPPPP P Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P A P PPPP P Sbjct: 336 PPPPPPKGPPP---PPPA-KGPPPPPPPKGP 362 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP + P P PPP P Sbjct: 338 PPPPKGPPPPPPAKGPPPPPPPKGPSPPPPP 368 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 353 PPPPPPPKGPSPPP--PPPP 370 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXP----PPSTRPXLALSXPXXP--PPPPXP 743 PPPP P P PP P A P P PPPP P Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 915 PLPPPPPXX------PXPPPXTSPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 313 PPPPPPPKPAAAAPPPPPPPKAAPPPPP 340 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPP---XTSPPPXP 980 P PPPP P PPP SPPP P Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPPP 368 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P P PPPPP Sbjct: 354 PPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 921 PPPPPXXPXPPPX---TSPPPXP 980 PPPPP P PPP PPP P Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPP 359 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P PPPP P Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P+ P PPPP P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPP 341 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P P +PPP P Sbjct: 311 PAPPPPPPPKPAAAAPPPPP 330 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +3 Query: 651 PPPPXPXXPPP----STRPXLALSXPXXPPPPP 737 PPPP PPP P P PPPPP Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PP PPP Sbjct: 315 PPPPPKPAAAAPPPPPPP 332 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P PPPPP Sbjct: 353 PPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 >12_02_1174 - 26696869-26698191 Length = 440 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPXPXXPP--PSTRPXLALSXPXXPPPPP 737 PPPP P PP P P + P PPPPP Sbjct: 221 PPPPPPTVPPRTPGDTPAVVEPKPQPPPPPP 251 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 PPP P PPS +P + P PP PPP P Sbjct: 190 PPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSP 221 Score = 35.5 bits (78), Expect = 0.065 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 PPPP P PPS +P + P PP PP P Sbjct: 158 PPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSP 190 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP RP P P P P Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 146 PQPPPSLPPPPPPPPPPPPP 165 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 8/37 (21%) Frame = +3 Query: 651 PPPPXPXXPP--------PSTRPXLALSXPXXPPPPP 737 PPPP P PP P +P +L P PPPPP Sbjct: 159 PPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPPS P P PPPPP P Sbjct: 141 PPPVKPQPPPSLPPP---PPPPPPPPPPRP 167 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 8/37 (21%) Frame = +3 Query: 651 PPPPXPXXPP--------PSTRPXLALSXPXXPPPPP 737 PPPP P PP P +P L P PPPPP Sbjct: 190 PPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPX------PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP +P S P PPPPP P Sbjct: 126 PPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPP 162 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPP--PPXXPXPPPXTSPPPXP 980 P PPP PP P PPP T PP P Sbjct: 210 PQPPPTLPPPSPPPPPPTVPPRTP 233 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PP--PPPXXPXPPPXTSPPPXP 980 PP PPP P PPP PPP P Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPP 158 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 146 PQPPPSLPPPPPPPPPPPPPRP 167 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PPP P P Sbjct: 152 LPPPPPPPPPPPPPRPPSVKP 172 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXL-----ALSXPXXPPPPPXP 743 PPP P PPP+ P A+ P PPPP P Sbjct: 217 PPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPP 251 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPPP P PP PP Sbjct: 155 PPPPPPPPPPPRPPSVKPP 173 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXXPPPS--------TRPXLALSXPXXPPPPPXP 743 PPPP P PPP T P P P PPP P Sbjct: 267 PPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPPPPP 305 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPP P PPP PP Sbjct: 150 PSLPPPPPPPPPPPPPRPP 168 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXP----PPXTSPPPXP 980 P PPPPP P P PP P P P Sbjct: 156 PPPPPPPPPPRPPSVKPPVVQPKPQP 181 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP P PP + PP Sbjct: 156 PPPPPPPPPPRPPSVKPP 173 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PPP P P P PP P Sbjct: 208 PKPQPPPTLPPPSPPPPPPTVP 229 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P + P PPP P P Sbjct: 244 PQPPPPPPRAPVKMPRVLEPKPSPPPPSPLP 274 Score = 28.7 bits (61), Expect = 7.5 Identities = 27/118 (22%), Positives = 27/118 (22%), Gaps = 8/118 (6%) Frame = +3 Query: 651 PPP---PXPXXPPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXX 821 PPP P PPP TRP P P P P Sbjct: 181 PPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTPGDTPAVV 240 Query: 822 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPP-----PXXPXPPPXTSPPPXP 980 PLPPPP P PP T P P P Sbjct: 241 EPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPP 298 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPP 285 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P LA P PPPP Sbjct: 296 PPPPVGGTQPPPPPPPLANGPPRSIPPPP 324 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P PPP +P P Sbjct: 272 VPPPPPQAPPPPPPNAPMGMP 292 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PPP P + P PPPP Sbjct: 273 PPPPPQAPPPPP-PNAPMGMPPRIPPPP 299 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP PPP + + P PPPP Sbjct: 273 PPPPPQAPPPPPPNAPMGM-PPRIPPPP 299 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PP IPPP Sbjct: 306 PPPPPPLANGPPRSIPPP 323 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP--PPXP 743 PPPP PPP P + P PP PP P Sbjct: 267 PPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PP IPPP Sbjct: 281 PPPPPNAPMGMPPRIPPP 298 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP T PPPP PPP Sbjct: 296 PPPPVGGTQPPPP--PPP 311 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PP PPP Sbjct: 305 PPPPPPPLANGPPRSIPPPP 324 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PP PPP T Sbjct: 307 PPPPPLANGPPRSIPPPPMT 326 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP------PPPPXP 743 PPP P PPP+ + P P PPPP P Sbjct: 275 PPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPP 311 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP PPP T +A P PP PP Sbjct: 316 PPRSIPPPPMTGGAMANFTPGAPPRPP 342 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 35.9 bits (79), Expect = 0.049 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP + P P P Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFP 339 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +3 Query: 651 PPPPXPXXPPPST----RPXLALSXPXXPPPPP 737 PPPP P PPP + P LA P P PPP Sbjct: 321 PPPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPP 353 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPP----PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PP P L P PPPPP P Sbjct: 293 PPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPP 327 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 657 PPXPXXPP-PSTRPXLALSXPXXPPPPPXP 743 PP P PP PS P S P PPPPP P Sbjct: 305 PPLPHFPPLPSFYP----SPPPPPPPPPPP 330 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP P P PPP PPP P Sbjct: 311 PPLPSFYPSPPPPPPPPPPP 330 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP--PPXP 980 P PPPPP P P P +P PP P Sbjct: 326 PPPPPPPSFPWPFPPLAPLFPPYP 349 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPS-----TRPXLALSXPXXPPPPPXP 743 P PP P PPP+ P + P PPPP P Sbjct: 263 PLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFP 298 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 6/28 (21%) Frame = +3 Query: 915 PLPP----PPPXXPXP--PPXTSPPPXP 980 PLPP PPP P P PP SPP P Sbjct: 263 PLPPWPWAPPPAFPFPHLPPIFSPPSPP 290 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PP P Sbjct: 287 PSPPPPPPPAFPFPFPQLPPLP 308 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLP P P PPP PPP Sbjct: 312 PLPSFYPSPPPPPPPPPPPP 331 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 35.9 bits (79), Expect = 0.049 Identities = 25/108 (23%), Positives = 27/108 (25%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 830 PPPP PPP+ P + P PPPP P Sbjct: 1145 PPPPEKSPPPPA--PVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1202 Query: 831 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPP 974 PPP P PPP SPPP Sbjct: 1203 PAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPP 1250 Score = 35.9 bits (79), Expect = 0.049 Identities = 27/111 (24%), Positives = 29/111 (26%), Gaps = 1/111 (0%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 830 PPPP PPP+ P + P PPPP P Sbjct: 1177 PPPPVKSPPPPA--PVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234 Query: 831 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTS-PPPXP 980 LPPP P PPP S PPP P Sbjct: 1235 PAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAP 1285 Score = 35.1 bits (77), Expect = 0.086 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLPPP P PPP SPPP Sbjct: 1135 PLPPPVPVSSPPPPEKSPPP 1154 Score = 32.7 bits (71), Expect = 0.46 Identities = 25/110 (22%), Positives = 28/110 (25%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 830 PPPP PPP+ P ++ P PPP P Sbjct: 1225 PPPPVKSPPPPA--PVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPP 1282 Query: 831 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPPXP 980 PLPPP P PPP P P P Sbjct: 1283 PAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPV-SLPPPAVKPLPPP 1331 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP PPP T+ L+ PPP Sbjct: 867 PPPPEKSPPPPETKSPPTLTPEISPPP 893 Score = 31.9 bits (69), Expect = 0.80 Identities = 26/114 (22%), Positives = 30/114 (26%), Gaps = 6/114 (5%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPX---LALSXPXXP---PPPPXPXXXXXXXXXXXXXXXXXXXXXXX 812 PPP PPP+ +P + +S P P PPPP P Sbjct: 1121 PPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPP 1180 Query: 813 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPP 974 PPP P PPP SPPP Sbjct: 1181 VKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPP 1234 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PP + PPP P Sbjct: 1168 PPPPAPVISPPPPVKSPPPPAP 1189 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PP + PPP P Sbjct: 1152 PPPPAPVILPPPPIKSPPPPAP 1173 Score = 29.5 bits (63), Expect = 4.3 Identities = 27/117 (23%), Positives = 27/117 (23%), Gaps = 7/117 (5%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPP-----PPPXPXXXXXXXXXXXXXXXXXXXXXX 809 PPPP P PPP P A PP PPP P Sbjct: 1232 PPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKSLPPPAPVSLPPP 1291 Query: 810 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPPXP 980 PLPPP P PPP P P Sbjct: 1292 VVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPPKQESLPPP 1348 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPPP PPP T PP Sbjct: 867 PPPPEKSPPPPETKSPP 883 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P P P P P +PPP P Sbjct: 475 PTPSPTPSSPESPAKMAPPPAP 496 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPP 971 PPPP P PP SPP Sbjct: 867 PPPPEKSPPPPETKSPP 883 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP PP Sbjct: 1232 PPPPAPVISPPPPEKSPP 1249 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXP--PPPPXP 743 PPP P PP S+RP + P P PPPP P Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPPP 40 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPP-------XXPXPPPXTSPPPXP 980 P P PPP P PPP + PPP P Sbjct: 11 PTPSPPPFSSRPRVVGPPPPPPSDPPPPP 39 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPPP PP Sbjct: 27 PPPPPPSDPPPPP--PP 41 >03_02_0350 - 7734494-7734952,7735765-7736133 Length = 275 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -1 Query: 603 GGXGXGGKGGXXGG-XGGGXXXGRXXGACK 517 GG G GG GG GG GGG G GACK Sbjct: 13 GGGGGGGSGGGGGGPSGGGGGGGGPCGACK 42 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 14 GGGGGGSGGGGGGPSGGGGGGG 35 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 13 GGGGGGGSGGGGGGPSGGGGGG 34 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G G GGG G Sbjct: 4 GGGASSALGGGGGGGGSGGGGG 25 >12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758, 4171814-4171891,4174482-4174569,4174659-4174850, 4174939-4175802 Length = 493 Score = 35.5 bits (78), Expect = 0.065 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP + PPPP PPP Sbjct: 149 PPPPPQESTPPPPPPPPP 166 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPP PPP Sbjct: 148 PPPPPPQESTPPPPPPPP 165 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP PPP P Sbjct: 148 PPPPPPQE-STPPPPPPPPPAP 168 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P ++ P PP P Sbjct: 148 PPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPSP 181 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P P PPPPP Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PP PPP Sbjct: 929 PPPPPPPGKPGGPPPPPPPP 948 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PPPP P PP PP P Sbjct: 918 LSPPPPRPPGAPPPPPPPGKP 938 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP P P Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGP 941 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P PPP P Sbjct: 926 PGAPPPPPPPGKPGGPPPPPPP 947 >07_03_0890 - 22332768-22333382 Length = 204 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP A P PPPP P Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPPPTAP 113 Score = 35.1 bits (77), Expect = 0.086 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 75 PPPPPAEATPPPPPPPPP 92 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP T PPPP PPP Sbjct: 76 PPPPAEATPPPPPPPPPP 93 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P A+ PPPP P Sbjct: 76 PPPPAEATPPPPPPPPPPERAVPEAADTPPPPPP 109 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P +PPP P Sbjct: 87 PPPPPPPERAVPEAADTPPPPP 108 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP PP PPP P Sbjct: 75 PPPPPAEATPPPPPPPPPP 93 >07_03_0560 + 19479597-19480667 Length = 356 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGGGG G Sbjct: 126 GGGGGGLGGGGGGGVGGGGGQG 147 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG GG GG GGG G G G G G Sbjct: 272 GGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHG 311 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GGG G GGGGG G Sbjct: 204 GGGGMGGGGGGGFGGGGGKG 223 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GGG G GGGGG G Sbjct: 238 GGGGLGGGGGGGMGGGGGGG 257 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGG G G Sbjct: 244 GGGGGGMGGGGGGGMGGGAGGG 265 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 118 GGEGGGLGGGGGGGLGGGGGGG 139 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 G G GG+GG GG GGG G G G Sbjct: 114 GGGGGGEGGGLGGGGGGGLGGGGGGGVGGG 143 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 74 GGGGGGGLGGGGGFGGGGGAGG 95 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 G G + GGG G GGGGG G Sbjct: 278 GSGGLGGGGGGGLGGGGGAG 297 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 86 GFGGGGGAGGGGGLGGGGGKGG 107 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 155 GVGGGSGTGGGLGGGGGGGFGG 176 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 237 GGGGGLGGGGGGGMGGGGGG 256 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GG G GGG G G Sbjct: 252 GGGGGGMGGGAGGGFGGGAGGG 273 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGG-GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 66 GFGGDGGFGGGGGGGLGGGGGFG 88 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 76 GGGGGLGGGGGFGGGGGAGGGG 97 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 98 GLGGGGGKGGGFGGGVGGGGGG 119 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 100 GGGGGKGGGFGGGVGGGGGGEG 121 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 80 GLGGGGGFGGGGGA-GGGGGLG 100 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG G G G GGGGG Sbjct: 168 GGGGGGFGGDGGGGLGGGGG 187 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 197 GVGGGAGGGGGMGGGGGGGFGG 218 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 203 GGGGGMGGGGGGGFGGGGGKGG 224 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 231 GMGGGAGGGGGLGGGGGGGMGG 252 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 72 GFGGGGGGGLGGGGGFGGGGGAG 94 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG GGG G G Sbjct: 75 GGGGGGLGGGGGFGGGGGAGGG 96 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 92 GAGGGGGLGGGGGKGGGFGGGVG 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 127 GGGGGLGGGGGGGVGGGGGQGG 148 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 139 GVGGGGGQGGGFGAGGGVGGGSG 161 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 215 GFGGGGGKGGGFGAGGGMGGGAG 237 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 268 GGAGGGAGQGGSGGLGGGGGGG 289 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 283 GGGGGGGLGGGGGAGGGLGGGAG 305 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 82 GGGGGFGGGGGAGGGGGLGGGG 103 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 88 GGGGGAGGGGGLGGGGGKGGGFG 110 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVXGGG--XGXXGGGGGXG 914 G GGG V GGG G G GGG G Sbjct: 134 GGGGGGVGGGGGQGGGFGAGGGVG 157 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 193 GAGGGVGGGAGGGGGMGGGGGGG 215 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 221 GKGGGFGAGGGMGGGAGGGG 240 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 227 GAGGGMGGGAGGGGGLGGGGGGG 249 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 119 GEGGGLGGGGGGGLGGGGGGGVG 141 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG-GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 161 GTGGGLGGGGGGGFGGDGGGGLG 183 >07_03_0177 - 14770777-14772045 Length = 422 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGGGG G Sbjct: 87 GGGGGGLGGGGGGGLGGGGGFG 108 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 56 GLGGGYGKGGGFGGGGGGGGGG 77 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 81 GGGGFGGGGGGGLGGGGGGG 100 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 356 GKGGGLGGGGGLGGGGGGGGGG 377 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 72 GGGGGGGFGGGGGFGGGGGG 91 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 73 GGGGGGFGGGGGFGGGGGGGLG 94 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 80 GGGGGFGGGGGGGLGGGGGG 99 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 66 GFGGGG-GGGGGGGFGGGGGFG 86 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 354 GFGKGGGLGGGGGLGGGGGGGG 375 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 979 GXGGG---DVXGGGXGXXGGGGGXG 914 G GGG V GGG G GGGGG G Sbjct: 391 GKGGGFGFGVGGGGFGGGGGGGGGG 415 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 399 GVGGGGFGGGGGGG-GGGGGIG 419 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 68 GGGGGGGGGGGFGGGGGFGGGG 89 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 71 GGGGGGGGFGGGGGFGGGGGGG 92 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 360 GLGGGGGLGGGGGGGGGGFGGG 381 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 366 GLGGGG--GGGGGGFGGGGGSG 385 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GGG G GG GG G Sbjct: 363 GGGGLGGGGGGGGGGFGGGG 382 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 600 GXGXG-GKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G G GKGG GG GGG G G G G G Sbjct: 56 GLGGGYGKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGG 95 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 62 GKGGGFGGGGGGGGGGGFGGGG 83 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 200 GLGGGGGLGGGIGKGGGLGGGFG 222 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 232 GLGGGGGLGGGIGKGGGLGGGIG 254 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 385 GIGGGFGKGGGFGFGVGGGGFG 406 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 216 GLGGGFGKGGGLGGGGGLGGGG 237 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 292 GIGGGFGKGGGLGGGGGLGGGG 313 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 350 GIGGGFGKGGGLGGGGGLGGGG 371 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 362 GGGGGLGGGGGGGGGGFGGGGG 383 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 112 GVGGGFGKGGGFGKGGGFGGGFG 134 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGG G G Sbjct: 372 GGGGGGFGGGGGSGIGGGFGKG 393 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG GGG G G Sbjct: 95 GGGGGGLGGGGGFGKGGGVGGG 116 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 222 GKGGGLGGGGGLGGGGGLGGGIG 244 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 298 GKGGGLGGGGGLGGGGGLGGGSG 320 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 314 GLGGGSGLGGGIGKGGGLGG 333 >07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089, 4287286-4287350,4288346-4288451,4288529-4288750, 4289619-4289852,4289948-4290037,4290605-4291507 Length = 650 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P+ P L + PP PP P Sbjct: 55 PPPPPPPPTPAVEPTLPIPPASTPPTPPQP 84 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 35.5 bits (78), Expect = 0.065 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPS P L S P PPPPP P Sbjct: 1116 PPLPDDRPPSP-PPLPSSPPPVPPPPPAP 1143 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP PPP PPP P Sbjct: 1124 PSPPPLPSSPPPVPPPPPAP 1143 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PP PP P PP PPP Sbjct: 1123 PPSPPPLPSSPPPVPPPP 1140 >02_05_1277 - 35408097-35409080 Length = 327 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 P P P PPP+ P LA P PPP P Sbjct: 57 PSTPAPPPPPPAQPPVLAAPAPAPPPPQP 85 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PPPP P PPP PPP P Sbjct: 36 LCPPPPPPPPPPPPPPPPPPP 56 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P Sbjct: 43 PPPPPPPPPPPPPPLEVVSPSP 64 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P PPPPP Sbjct: 38 PPPPPPPPPPP----------PPPPPPPP 56 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP 716 PPPP P PPP P L + P Sbjct: 41 PPPPPPPPPPPPPPPPLEVVSP 62 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP + P L L+ P PP Sbjct: 2 PPPPPPPPPPPPSPPRLPLTAHRLPLPP 29 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P PPP SPP P Sbjct: 1 MPPPPP--PPPPPPPSPPRLP 19 >01_01_0570 - 4231100-4232560 Length = 486 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G GG GG GG GGG G G G V G Sbjct: 104 GGGGMGGSGGFGGGGGGGVGGGVGAGFGSGGGVGAG 139 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG V GGG G GGGGG G Sbjct: 270 GGAGGGVGGGGGGGMGGGGGFG 291 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGD+ GG G GGGGG G Sbjct: 262 GGMGGDIGGGAGGGVGGGGGGG 283 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G GG GG GGG G G G V G G Sbjct: 246 GGMGGGASGGIGGGAGGG--MGGDIGGGAGGGVGGGGGGG 283 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 277 GGGGGGGMGGGGGFGGGGGVGG 298 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 86 GLGGGGGGGGGLGGSGGLGGGG 107 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG V GG G GGG G G Sbjct: 144 GGGGVGAGGGGGFGGGAGGG 163 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 369 GTGGGSGFGGGLGGGGGIGGGLG 391 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + G G GGGGG G Sbjct: 102 GLGGGGMGGSGGFGGGGGGGVG 123 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 271 GAGGGVGGGGGGGMGGGGGFGG 292 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 275 GVGGGGGGGMGGGGGFGGGGGVG 297 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 379 GLGGGGGIGGGLGVGGGTGGGSG 401 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 73 GGVGGGTGGGAAGGLGGGGGGG 94 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G GGGGG G Sbjct: 74 GVGGGTGGGAAGGLGGGGGGGG 95 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 137 GAGGGLRGGGGVGAGGGGGFGG 158 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 155 GFGGGAGGGGGIGAGGGFGGGAG 177 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+ G G GGG G G G G G Sbjct: 180 GGVGGGGRFGGGGMGGGGGFGGGAGGGVGGGGELGGGGMG 219 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 363 GAGGGFGTGGGSGFGGGLGGGG 384 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 445 GAGGGAGMGGGVGARAGGGG 464 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 145 GGGVGAGGGGGFGGGAGGGG 164 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGG G Sbjct: 116 GGGGGGVGGGVGAGFGSGGGVG 137 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG--GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 171 GFGGGAGAGGGVGGGGRFGGGGMG 194 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 192 GMGGGGGFGGGAGGGVGGGG 211 >06_03_0790 - 24636805-24637770 Length = 321 Score = 35.1 bits (77), Expect = 0.086 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG GG GGG G G G G G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDG 153 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGG 103 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGG 104 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGG 105 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGG 106 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 86 GGGGGGGGGGGGGGGGGGGGGG 107 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGG 108 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGG 109 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGG 110 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGG 111 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGG 112 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGG 113 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGG 114 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGG 115 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGG 116 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGG 117 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGG 118 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGG 119 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGG 120 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRG 122 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGG 128 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGG 129 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGG 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGG 135 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGG 136 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 120 GRGGGGGGGGGGGGGGGGGGGG 141 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 122 GGGGGGGGGGGGGGGGGGGGGG 143 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 123 GGGGGGGGGGGGGGGGGGGGGG 144 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGG 145 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 125 GGGGGGGGGGGGGGGGGGGGGG 146 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 126 GGGGGGGGGGGGGGGGGGGGGG 147 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 128 GGGGGGGGGGGGGGGGGGGGNG 149 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 116 GGGGGRGGGGGGGGGGGGGGGG 137 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 129 GGGGGGGGGGGGGGGGGGGNGG 150 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGG 123 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGG 124 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGG 125 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGG 126 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGG 127 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGG 130 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGG 132 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 112 GGGGGGGGGRGGGGGGGGGGGG 133 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 113 GGGGGGGGRGGGGGGGGGGGGG 134 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 117 GGGGRGGGGGGGGGGGGGGGGG 138 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 118 GGGRGGGGGGGGGGGGGGGGGG 139 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G G GDV G G G GGGG Sbjct: 248 GGGRGDVSGAGGGGGGGGG 266 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGNGGDDG 153 >10_01_0360 - 3970796-3971248,3972080-3972436 Length = 269 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXGACK 517 G G GG GG GG GG G GACK Sbjct: 11 GSGSGGGGGGGGGGAGGGGGGGPCGACK 38 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 11 GSGSGGGGGGGGGGAGGGGGGG 32 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 16 GGGGGGGGGAGGGGGGGPCG 35 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP P PPP PPP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPP 92 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP SP P Sbjct: 83 PPPPPPPPPPPPPLSPTP 100 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP PPP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPP 94 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PPP PPP P Sbjct: 74 PPPQTPPSPPPPPPPPPPPPPP 95 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP + P T Sbjct: 82 PPPPPPPPPPPPPPLSPTPT 101 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPPP P PPP + P Sbjct: 82 PPPPPPPPPPPPPPLSPTP 100 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 11/42 (26%) Frame = +3 Query: 651 PPPPXPXXPPP-----------STRPXLALSXPXXPPPPPXP 743 PPPP P PPP +T + P PPPPP P Sbjct: 84 PPPPPPPPPPPPLSPTPTTTSWTTNSSSISASPILPPPPPPP 125 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP P PPP PP P Sbjct: 79 PPSPPPPPPPPPPPPPPLSP 98 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P PPPPP P Sbjct: 74 PPPQTPPSPPPP---------PPPPPPPPPP 95 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP P P T Sbjct: 84 PPPPPP-PPPPPPLSPTPTT 102 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXX-------PPPPPXP 743 PPPP P P P+T S PPPPP P Sbjct: 90 PPPPPPLSPTPTTTSWTTNSSSISASPILPPPPPPPMP 127 >08_01_0202 - 1638978-1639571 Length = 197 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 154 GGGGGGYGGGGGGYRGGGGGGG 175 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGGGG G Sbjct: 112 GYGGGDRGYGGGGGYGGGGGGG 133 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 93 GGGGGGRYGGDRGYGGGGGGYG 114 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 153 GGGGGGGYGGGGGGYRGGGGGG 174 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 108 GGGGGYGGGDRGYGGGGGYG 127 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGG G Sbjct: 107 GGGGGGYGGGDRGYGGGGGYGG 128 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 161 GGGGGGYRGGGGG--GGGGG 178 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G G +GG GG GGG Sbjct: 161 GGGGGGYRGGGGGGGGGG 178 >07_03_1533 + 27523811-27524710 Length = 299 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGGD GGG G GGGGG G Sbjct: 85 GGGDDDGGGGGGGGGGGGGG 104 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGGGG G Sbjct: 102 GGGGGDDSGGDDGGGGGGGGDG 123 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG D GGG G GGGGG G Sbjct: 86 GGDDDGGGGGGGGGGGGGGG 105 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G D GGG G GGGGG G Sbjct: 85 GGGDDDGGGGGGGGGGGGGGGG 106 >07_03_0559 + 19475893-19476783 Length = 296 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 163 GGGGGGFGGGGGGGIGGGGGKG 184 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G GG GG GG GGG G G C+ G G G Sbjct: 75 GGGGGGLGGG-GGFGGGGGGGLGGGGCEGGGFGGGVGGG 112 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 69 GGGGFRGGGGGGLGGGGGFG 88 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 121 GGGGGGFGGGSGGGVGGGGGQG 142 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG GGGGG G Sbjct: 75 GGGGGGLGGGGGFGGGGGGGLG 96 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGGGG G Sbjct: 156 GTGGG-LGGGGGGGFGGGGGGG 176 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGGGG G Sbjct: 199 GGGGMGSGGGGGFGGGGGKG 218 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 108 GVGGGSGAGGGLGGGGGGGFGG 129 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 150 GVGGGSGTGGGLGGGGGGGFGG 171 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G V GGG G GG GG G Sbjct: 220 GFGAGGVMGGGAGGGGGLGGGG 241 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 62 GGGGGFGGGGGFRGGGGG 79 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 603 GGXGXGG--KGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG +GG GG GGG G G G G G Sbjct: 65 GGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFG 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 164 GGGGGFGGGGGGGIGGGGGKGG 185 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 198 GGGGGMGSGGGGGFGGGGGKGG 219 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 68 GGGGGFRGGGGGGLGGGGGFGG 89 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 134 GVGGGGGQGGGFGAGGGVGGGSG 156 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 63 GGGGFGGGGGFRGGGGGGLG 82 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 83 GGGGFGGGGGGGLGGGGCEG 102 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGG G G Sbjct: 114 GAGGG-LGGGGGGGFGGGSGGG 134 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGG G Sbjct: 89 GGGGGGLGGGGCEGGGFGGGVG 110 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVXGGG--XGXXGGGGGXG 914 G GGG + GGG G G GGG G Sbjct: 171 GGGGGGIGGGGGKGGGFGAGGGVG 194 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 182 GKGGGFGAGGGVGGAAGGGG 201 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 176 GIGGGGGKGGGFGAGGGVGG 195 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -1 Query: 603 GGXGXGGKGGXXG-GXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G GG G G GGG G G G G G Sbjct: 198 GGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLG 238 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PPP PPP P Sbjct: 96 LPPPPPELPPPPP---PPPLP 113 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP PPP SPPP P Sbjct: 175 PPPPLPSQRPPPSRSPPPLP 194 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PP Sbjct: 97 PPPPPELPPPPPPPPLPP 114 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 763 GGGGGGYGGGGYGGGGGGGGYG 784 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 756 GSGGGGYGGGGGGYGGGGYGGG 777 >06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 Length = 186 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 39 GGGGGGYGGGGGGGYGGGGGGG 60 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 40 GGGGGYGGGGGGGYGGGGGGGG 61 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXX--PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 1933 PPPPPPPVEGKPKPPPHAPPPPPP 1956 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PP +P P PPPPP Sbjct: 1931 PPPPPPPPPVEGKPK---PPPHAPPPPP 1955 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 P P P PPP P P PP PPP P Sbjct: 1923 PKQPPPHAPPPPPPPPPVEGKPKPPPHAPPPPP 1955 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 915 PLPPPPPXXPXP------PPXTSPPPXP 980 P PPPP P P PP +PPP P Sbjct: 1928 PHAPPPPPPPPPVEGKPKPPPHAPPPPP 1955 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G+V GGG G GGGGG G Sbjct: 167 GGGDGNVGGGGGGGGGGGGGGG 188 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 174 GGGGGGGGGGGGGGGGGGGGDG 195 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGD GGG G GGGGG G Sbjct: 159 GDVGGDGGGGGDGNVGGGGGGG 180 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGGGG G Sbjct: 165 GGGGGDGNVGGGGGGGGGGGGG 186 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGG 168 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDG 171 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 171 GNVGGGGGGGGGGGGGGGGGGG 192 >01_06_1377 + 36764461-36765339 Length = 292 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPPS+ P PPPPP Sbjct: 155 PPPPEPQYPPPSSSPYY-----FPPPPPP 178 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 924 PPPPXXPXPPPXTSP---PPXP 980 PPPP PPP +SP PP P Sbjct: 155 PPPPEPQYPPPSSSPYYFPPPP 176 Score = 28.7 bits (61), Expect = 7.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 Query: 920 PPPPPXXTXPPPP 958 PPPPP + PPPP Sbjct: 174 PPPPPAYSAPPPP 186 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 92 GGGGGGYGGGGGGGRGGGGGGG 113 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 84 GYGGGGRGGGGGGGYGGGGGGG 105 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 93 GGGGGYGGGGGGGRGGGGGGGG 114 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 72 GGGGGGYGGGGGGYGGGGRGGG 93 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 56 GGGGGGYGGGGVGGGYGGGGGG 77 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 65 GGVGGGYGGGGGGYGGGGGGYG 86 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGG 100 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 91 GGGGGGGYGGGGGGGRGGGGGG 112 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 100 GGGGGGRGGGGGGGGRGGGGRG 121 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYG 72 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 97 GYGGGG--GGGRGGGGGGGGRG 116 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 101 GGGGGRGGGGGGGGRGGGGRGG 122 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 45 GGGGGRGRGGGGGGGGGYGGGG 66 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGGD GG G GGGG G Sbjct: 237 GGGDYNSGGRGGGTGGGGRG 256 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GGG G GGG G G Sbjct: 61 GYGGGGV-GGGYGGGGGGYGGG 81 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 600 GXGXGGKG-GXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G GG+G G GG GGG G G G G G Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGG 83 >12_01_0841 - 7873458-7874225 Length = 255 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSG 53 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 59 GQGGG-ASGGGYGQGGGGGGGG 79 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 94 GQGGG-ASGGGYGKGGGGGGGG 114 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 172 GQGGG-ASGGGYGQGGGGGGGG 192 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 211 GQGGG-VHAGGYGQGGGGGGGG 231 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG+ GGG G GGG G G Sbjct: 33 GGGGGEGGGGGGGEGGGGGSGYG 55 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSG 53 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 174 GQGGG-VCGGSYGQGGGGGGGG 194 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG+ GGG G GGG G G Sbjct: 33 GGGGGEGGGGGGGEGGGGGSGYG 55 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 6 GGGGGRFGGGGGGRFGGGGGRG 27 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GG GGG G GGGGG Sbjct: 24 GGRGGRFGGGGRGGRGGGGG 43 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG--GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 13 GGGGGGRFGGGGGRGGRFGGGGRG 36 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPX--PPPXTSPPPXP 980 P PPPPP P PP T+PPP P Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPP 157 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPP 737 P P PPP + P L PPPPP Sbjct: 132 PAPPPPPPPSHPALLPPDATAPPPPP 157 >10_08_0116 + 14935582-14936089,14936850-14937188,14937914-14937960, 14938175-14938264 Length = 327 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 188 GSGGGGSGGGGGGGGGGGGGGG 209 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 191 GGGSGGGGGGGGGGGGGGGG 210 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 190 GGGGSGGGGGGGGGGGGGGGGG 211 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXG 538 G G GG GG GG GGG G Sbjct: 188 GSGGGGSGGGGGGGGGGGGGG 208 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 183 GSSGHGSGGGGSGGGGGGGGGG 204 >09_01_0037 - 604001-604957 Length = 318 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP+T L+LS P P P P Sbjct: 192 PPPPPP--PPPATSLSLSLSLPGLDHPHPDP 220 >08_01_0546 - 4746118-4746580,4747335-4747342 Length = 156 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 76 GGGGGGEGGGGGGGGGGGGGGG 97 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 75 GGGGGGGEGGGGGGGGGGGGGG 96 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG+GG GG GGG G Sbjct: 75 GGGGGGGEGGGGGGGGGGGGGG 96 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 74 GGGGGGGGEGGGGGGGGGGGGG 95 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP--PPXP 980 PLPPPPP PPP +P PP P Sbjct: 1155 PLPPPPPPPLPPPPPVAPFHPPGP 1178 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXP-XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP T+P PPPP P Sbjct: 59 PPPPQPAKEPPPPTKPKHPKPKQQQHPPPPPP 90 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LP PPP P P P PPP Sbjct: 52 LPHPPPPPPPPQPAKEPPP 70 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PP P Sbjct: 53 PHPPPPPPPPQPAKEPPPPTKP 74 >06_01_0486 - 3455030-3455770 Length = 246 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P S P PPP P Sbjct: 125 PPPTPPSPPPYVPPPTPPSPPPYVPPPSPP 154 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPP--PPPXXPXPPPXTSPPPXP 980 P PP PPP P PPP PP P Sbjct: 119 PTPPYVPPPTPPSPPPYVPPPTPP 142 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTSPPPXP 980 P PPP PP P PPP PP P Sbjct: 130 PSPPPYVPPPTPPSPPPYVPPPSPP 154 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP T P P PP P P Sbjct: 117 PPPTPPYVPPPTPPSPPPYVPPPTPPSPPP 146 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PPP+ P PP PP Sbjct: 117 PPPTPPYVPPPTPPSPPPYVPPPTPPSPP 145 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXP---PPSTRPXLALSXPXXPP---PPPXP 743 PPP P P PP T P + P PP PPP P Sbjct: 105 PPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTP 141 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP PP SPPP Sbjct: 127 PTPPSPPPYVPPPTPPSPPP 146 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 PP P PP T P + P PP PPP P Sbjct: 77 PPYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTP 109 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPP P PP P PPP Sbjct: 117 PPPTPPYVPPPTPPSPPP 134 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 918 LPPPPPXXPXP--PPXTSPPPXP 980 +PPP P P P PP T P P P Sbjct: 124 VPPPTPPSPPPYVPPPTPPSPPP 146 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +3 Query: 918 LPP--PPPXXPXPPPXTSPPPXP 980 +PP PPP P PP T P P P Sbjct: 112 VPPYIPPPTPPYVPPPTPPSPPP 134 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP---PPPXP 743 PP P PPS P + P PP PPP P Sbjct: 121 PPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSP 153 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPP +PP Sbjct: 86 PPPTPPYVPSPPPYVPP 102 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPP-PPPXXPXPPPXTSPPPXP 980 P PP PP P P P PPP P Sbjct: 107 PTPPYVPPYIPPPTPPYVPPPTP 129 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP P P P + PP P Sbjct: 118 PPTPPYVPPPTPPSPPPYVP 137 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP T+ P Sbjct: 115 PSPPPPPPPPPPPPTTTTKP 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 9/40 (22%) Frame = +3 Query: 651 PPPPXPXXPPPSTR------PXLALSXPXX---PPPPPXP 743 PPPP P PPP+T P A S P PPPPP P Sbjct: 118 PPPPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPPP 157 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 9/40 (22%) Frame = +3 Query: 651 PPPPXPXXPPPSTR-------PXLALSXP--XXPPPPPXP 743 PPPP P PPP T P A S P PPPPP P Sbjct: 117 PPPPPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPP 156 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P T P P Sbjct: 117 PPPPPPPPPPPPTTTTKPESLP 138 >05_01_0380 + 2978256-2979284 Length = 342 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P PPP PPP P Sbjct: 25 MPPPPPPPPPPPP--PPPPRP 43 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP 968 P PPPPP P PPP P Sbjct: 26 PPPPPPPPPPPPPPPPRP 43 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P + P P Sbjct: 30 PPPPPPPPPPPPRPFSRKPSEP 51 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P S P P Sbjct: 26 PPPPPPPPPPPPPPPPRPFSRKPSEPAAP 54 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP-PPPPXP 743 PPPP P P P P P P PPPP P Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAP 120 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP P ++ P PPPPP P Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPPPPAP 79 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPPP----STRPXLALSXPXXPPPPPXP 743 PPP P PPP S P L P P PPP P Sbjct: 92 PPPLLPTPPPPPASISPTPAPPLPPPPAPAPPPTP 126 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXX--PXPPPXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 97 PTPPPPPASISPTPAPPLPPPPAP 120 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPP--PXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 70 PTPPPPPPAPRPPRRHHRIPPPPP 93 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 921 PPPPPXXPXPPPX---TSPPPXP 980 PPPPP P PPP SP P P Sbjct: 90 PPPPPLLPTPPPPPASISPTPAP 112 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP + P P PP P Sbjct: 72 PPPPPPAPRPPRRHHRIPPPPPPLLPTPPPP 102 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP P + P PPP P P Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPPPPAPRP 81 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP+ P S PP P Sbjct: 115 PPPPAP-APPPTPTPKFPSSSANPSPPDAYP 144 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PPP+ RP PPPP P Sbjct: 70 PTPPPPPPAPRPPRRHHRIPPPPPPLLP 97 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P+ P L PPP P P Sbjct: 99 PPPPPASISPTPAPPLPPPPAPAPPPTPTP 128 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P T PP P Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPP 75 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P P P P PPP +PPP P Sbjct: 108 PTPAPPLP-PPPAPAPPPTP 126 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P P PPP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P SPPP P Sbjct: 49 PAPPPPPHRPSP----SPPPNP 66 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 535 APXXXPAPXPPXXXPLASXSPPP 603 AP P+P PP P+ S +PPP Sbjct: 31 APFRRPSPPPPPPSPVPSPAPPP 53 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PS P P P PPP P Sbjct: 38 PPPPPPSPVPSPAPPPPPHRP-SPSPPPNP 66 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P S P P PPPPP P Sbjct: 20 PPKPFKPLSSAAP---FRRPSPPPPPPSP 45 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 526 PXXAPXXXPAPXPPXXXPLASXSPPP 603 P +P PAP PP P S SPPP Sbjct: 41 PPPSPVPSPAPPPPPHRP--SPSPPP 64 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP S PP P Sbjct: 542 PPPPPPPRNMLPPPPKSMPPPP 563 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP P Sbjct: 592 PPPPPKSMPPPPPKFP 607 Score = 29.9 bits (64), Expect(2) = 0.61 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 PP P PPP + PPP P Sbjct: 587 PPKSMPPPPPKSMPPPPP 604 Score = 21.0 bits (42), Expect(2) = 0.61 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 918 LPPPPPXXP 944 +PPPPP P Sbjct: 559 MPPPPPKFP 567 >03_01_0023 + 198414-198968 Length = 184 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 77 GSGGGGSGGGGGGGSGGGGGGG 98 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSG 59 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 67 GSGGGGSGGGGSGGGGSGGGGG 88 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 72 GSGGGGSGGGGSGGGGGGGSGG 93 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGG 60 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGG 66 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 51 GRGGGGGSGGGSGGGGGSGGGG 72 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG G GG G G G G G Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSG 84 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXGXTXXXXPXXXXEXWXC 436 GG GG GG G GGG G G G G G P + C Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCPIDTLKLGVC 110 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGG 57 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G GG GG GG GG G G G G G Sbjct: 51 GRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGG 90 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 57 GSGGGSGGGGGSGGGGSGGG 76 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 41 GGGGGGGGGGGRGGGGGSGGGSG 63 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGG G Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSG 74 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGG G Sbjct: 63 GGGGGSGGGGSGGGGSGGGGSG 84 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 46 GGGGGGRGGGGGSGGGSGGGGG 67 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 47 GGGGGRGGGGGSGGGSGGGGGSG 69 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGG G G Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGG 76 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GG GG G Sbjct: 61 GSGGGGGSGGGGSGGGGSGGGG 82 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG G G G GGGGG G Sbjct: 69 GGGGSGGGGSGGGGSGGGGGGG 90 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGG G Sbjct: 76 GGSGGGGSGGGGGGGSGGGGGG 97 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 44 GGGGGGGGRGGGGGSGGGSGGG 65 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PP Sbjct: 74 PSPPPPPPPPPPPPPVPVPP 93 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 74 PSPPPPPPPPPP---PPPVP 90 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 P PP P PPP P P P Sbjct: 74 PSPPPPPPPPPPPPPVPVP 92 >01_05_0490 + 22672241-22674679 Length = 812 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/32 (50%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = +3 Query: 654 PPPXPXXPPPSTR----PXLALSXPXXPPPPP 737 PP P PPP+TR P S P PPPPP Sbjct: 638 PPQPPPPPPPTTRRSRKPPQPPSRPAPPPPPP 669 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLPPP P P PPP PPP P Sbjct: 688 PLPPPSPPLPPPPP---PPPPP 706 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T P PPP PPPP PPP Sbjct: 686 TYPLPPPSPPLPPPPPPPPP 705 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPP--STRPXLALSXPXXPPPPPXP 743 PPPP P PP R + + P PP PP P Sbjct: 665 PPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLP 697 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P A+ P PPP P Sbjct: 664 PPPPPPPQQQPPFYPRRAVVYYTYPLPPPSP 694 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Frame = +3 Query: 915 PLPPPPP------XXPXPPPXTSPPPXP 980 P PPPPP P PP +PPP P Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAPPPPP 668 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP P PPP P P Sbjct: 655 PPQPPSRPAPPPPPPPQQQP 674 >12_02_1114 - 26171876-26172493 Length = 205 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 61 GSGGGGGGGGGGGGGGGGGGGG 82 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGG 84 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGGG 85 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 57 GGGSGSGGGGGGGGGGGGGG 76 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGG 78 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 59 GSGSGGGGGGGGGGGGGGGGGG 80 >12_02_0848 + 23636478-23638058 Length = 526 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPX--PPPXTSPPPXP 980 PPPPP PPP TSPPP P Sbjct: 64 PPPPPIIDASPPPPSTSPPPPP 85 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPP PPPP PP Sbjct: 63 TPPPPPIIDASPPPPSTSPP 82 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGG 47 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 27 GGGGGGGGGGGGGGGGGGGGGG 48 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 28 GGGGGGGGGGGGGGGGGGGGGG 49 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 29 GGGGGGGGGGGGGGGGGGGGGG 50 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 30 GGGGGGGGGGGGGGGGGGGGGG 51 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP R A + PPPP P Sbjct: 267 PPPPPPPPPPMPPRTDNASTQAAPAPPPPLP 297 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 257 PPPQSVRPPPPPPPPPPPPP 276 Score = 30.7 bits (66), Expect = 1.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPP 970 PPPP PPPP +PP Sbjct: 264 PPPPPPPPPPPPPMPP 279 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSP 968 PPPPP P PPP P Sbjct: 264 PPPPPPPPPPPPPMPP 279 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPP--PXTSPPPXP 980 P PPPPP P P P ++PP P Sbjct: 55 PPPPPPPPAPFFPFLPDSAPPQLP 78 >06_03_0212 + 17986660-17986986 Length = 108 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GG GG G Sbjct: 73 GRGGGDGGGGGDGGGGGDGGGG 94 >06_02_0175 - 12624608-12625297 Length = 229 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGG 121 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGGG 122 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 102 GGGGGGGGGGGGGGGGGGGGGG 123 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGG 124 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGG 125 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 105 GGGGGGGGGGGGGGGGGGGGGG 126 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 95 GGGSSGGGGGGGGGGGGGGG 114 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 94 GGGGSSGGGGGGGGGGGGGG 113 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGG 115 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 97 GSSGGGGGGGGGGGGGGGGGGG 118 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 95 GGGSSGGGGGGGGGGGGGGGGG 116 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 96 GGSSGGGGGGGGGGGGGGGGGG 117 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG GGGGG G Sbjct: 86 GWGWGTDSGGGGSSGGGGGGGG 107 >04_04_1413 - 33386049-33386339 Length = 96 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 63 GGGGGGGGGGGCGGGGGGGGGG 84 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 62 GGGGGGGGGGGGCGGGGGGG 81 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 73 GCGGGGGGGGGGGCGGGGGSGG 94 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 68 GGGGGGCGGGGGGGGGGGCGGG 89 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 62 GGGGGG-GGGGGGCGGGGGGGG 82 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 64 GGGGGGGGGGCGGGGGGGGGGG 85 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 67 GGGGGGGCGGGGGGGGGGGCGG 88 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 69 GGGGGCGGGGGGGGGGGCGGGG 90 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PP +PPP P Sbjct: 47 PSPPRPPPPPPPPTQPAPPPPP 68 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P PPP Sbjct: 50 PRPPPPPPPPTQPAPPPPPP 69 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P RP P P PPP P Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP P PP PPP Sbjct: 38 PPPPARHRAPSPPRPPPP 55 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 33.9 bits (74), Expect = 0.20 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPP +PPP Sbjct: 144 PPPPPPMAVAPPPFLPPP 161 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PP P Sbjct: 143 PPPPPPPMAVAPPPFLPPPLRP 164 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 11 GRGGGGGGGGGGGGGGGGGGVG 32 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 20 GGGGGGGGGGGVGGDRGGGGSG 41 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 14 GGGGGGGGGGGGGGGGGVGG 33 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 14 GGGGGGGGGGGGGGGGGVGG 33 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V G G GGGG G Sbjct: 25 GGGGGGVGGDRGGGGSGGGGPG 46 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGG 53 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGG 55 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGG 56 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGG 57 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGG 58 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGG 59 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGG 60 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGG 61 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGG 62 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGG 63 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRG 65 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGG 71 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGG 72 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGG 74 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+GG GG GGG G G Sbjct: 57 GGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 57 GGGGGGGRGGGGGGGGGGGGGG 78 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 58 GGGGGGRGGGGGGGGGGGGGGG 79 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 63 GRGGGGGGGGGGGGGGGGGGGG 84 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 67 GGGGGGGGGGGGGGGGGGGGGG 88 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGGG 89 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 69 GGGGGGGGGGGGGGGGGGGGGG 90 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGG 91 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGG 92 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 59 GGGGGRGGGGGGGGGGGGGGGG 80 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGG 66 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGG 67 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGG 68 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGG 69 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGG 70 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGG 73 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 54 GGGGGGGGGGRGGGGGGGGGGG 75 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 55 GGGGGGGGGRGGGGGGGGGGGG 76 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGG 77 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 60 GGGGRGGGGGGGGGGGGGGGGG 81 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 61 GGGRGGGGGGGGGGGGGGGGGG 82 >02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198, 3366324-3366449,3367056-3367262,3367399-3367492, 3367575-3367621,3367705-3368157,3368261-3368560, 3368656-3369114,3369189-3369410,3369659-3369890, 3370051-3370422,3371210-3371322,3371682-3371903, 3371977-3372180,3372308-3372572,3373123-3373311, 3373441-3373768,3373843-3374248,3374339-3374648, 3375677-3375837,3376825-3376998,3377265-3377609, 3377713-3377754,3378585-3378734,3378847-3379002, 3379088-3379540,3379651-3379966,3380402-3380839, 3381475-3381697,3383538-3383852,3384033-3384095, 3384699-3384903,3385362-3385425,3386014-3386204 Length = 3048 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 20 GVGGGGGGGGGGGDGGGGGGAG 41 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 22 GGGGGGGGGGGDGGGGGGAGAG 43 >01_06_1293 - 36050847-36051304,36052343-36052826 Length = 313 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 654 PPPXPXXPPPSTRPX-LALSXPXXPPPPPXP 743 PPP P P RP LA++ PPPPP P Sbjct: 119 PPPLPVLHRPLARPFPLAMAPTAMPPPPPPP 149 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP TR + P P PPP P Sbjct: 967 PPPPPNVAPPPFTRQDI---PPPPPSPPPLP 994 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP+ P + PPPPP P Sbjct: 964 PPPPP--PPPNVAPP-PFTRQDIPPPPPSP 990 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P P T PP P Sbjct: 984 PPPPPSPPPLPITQPPSVP 1002 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 654 PPPXPXXPP-PSTRPXLALSXPXXPPP 731 PPP P PP P T+P P PPP Sbjct: 984 PPPPPSPPPLPITQPPSVPPPPNSPPP 1010 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 P PPP PPPP PPP T Sbjct: 40 PVPPPPGVPPPPP--PPPQT 57 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 9/31 (29%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---------SPPPXP 980 P PPPPP PPP T SPPP P Sbjct: 964 PPPPPPPPNVAPPPFTRQDIPPPPPSPPPLP 994 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 227 GRGGGLTGGGGEGNTGGGGGGG 248 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G + GGG G GGGGG G Sbjct: 270 GAGTGAITGGGGGGKGGGGGGG 291 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G GD GGG G GGGGG Sbjct: 76 GVGFGDGTGGGGGNTGGGGG 95 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG+ GGG GGGGG Sbjct: 84 GGGGGNTGGGGGEVTGGGGG 103 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 287 GGGGGGNTGGGIGGSTGGGGRG 308 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 6/28 (21%) Frame = -3 Query: 979 GXGGGDVXGGGXG------XXGGGGGXG 914 G GGG+V GGG G GGGGG G Sbjct: 91 GGGGGEVTGGGGGGVAEGTGIGGGGGGG 118 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G + GGG G GGGG G Sbjct: 310 GAGVGGITGGGDGGFPGGGGGG 331 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 318 GGGDGGFPGGGGGGFSGGGGGG 339 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 85 GGGGNTGGGGGEVTGGGGGG 104 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGGD G G G GGGGG Sbjct: 205 GGGDGVGLGLGLDGGGGG 222 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 278 GGGGGGKGGGGGGGGNTGGGIG 299 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG G G Sbjct: 334 GGGGGGFPGGGCGGITGGDGGG 355 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGG G Sbjct: 100 GGGGGVAEGTGIGGGGGGGDGG 121 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGG G Sbjct: 218 GGGGGGFTGGRGGGLTGGGGEG 239 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXGXTXXXXPXXXXEXW 442 GG G GG GG GG G G C G + G G + W Sbjct: 318 GGGDGGFPGGGGGGFSGGGGGGFPGGGC--GGITGGDGGGVVGVDGGGVVGDDW 369 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPP PPPP PPP T Sbjct: 82 PPPPTPKKAPPPPVTPPPVT 101 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXP-XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPP P Sbjct: 82 PPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPP 113 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPP--PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PPP T P +S P PPP P Sbjct: 92 PPPVTPPPVTPPPVTPP--PVSPPPATPPPALP 122 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP T PP P Sbjct: 83 PPPTPKKAPPPPVTPPPVTP 102 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPP--PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PPP+T P AL P PPP P Sbjct: 102 PPPVTPPPVSPPPATPPP-ALP-PSTPPPVAAP 132 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPP--PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PPP + P A P PP P P Sbjct: 97 PPPVTPPPVTPPPVSPPP-ATPPPALPPSTPPP 128 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 915 PLPPPPPXX-PXPPPXTSPPP 974 P+ PPPP PPP +PPP Sbjct: 79 PVTPPPPTPKKAPPPPVTPPP 99 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = +3 Query: 915 PLPP--PPPXXPXP--PPXTSPPP 974 P PP PPP P P PP SPPP Sbjct: 91 PPPPVTPPPVTPPPVTPPPVSPPP 114 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPX--PPPXTSPPPXP 980 P+ PPP P PPP T PP P Sbjct: 99 PVTPPPVTPPPVSPPPATPPPALP 122 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 615 PPPPRPPGAPPPPPPPGKPGGP--PPPPPRP 643 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PP PP P Sbjct: 613 LPPPPPRPPGAPPPPPPPGKP 633 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 624 PPPPPPPGKPGGPP--PPPPRP 643 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP P P Sbjct: 615 PPPPRPPGAPPPPPPPGKPGGP 636 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP + P P PPPPP Sbjct: 614 PPPPPR--PPGAPPPPPPPGKPGGPPPPP 640 >11_06_0578 + 25176304-25176388,25176503-25177032,25177267-25177997, 25178122-25178172,25178562-25178813,25178894-25179004, 25179102-25179183,25179460-25179489 Length = 623 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P L S P P PPP P Sbjct: 368 PSPPEPPSPRHPASPPLLRSLPHQPTPPPSP 398 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GDV GGG G GGGG G Sbjct: 83 GGGVGDVEGGGGGGGAGGGGGG 104 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PS P +A + PPPPP P Sbjct: 76 PSPHSPSPSNAPWVAPAADIPPPPPPPP 103 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP-----PPPXP 743 PPPP P PPP P S P PP PPP P Sbjct: 36 PPPPAPDMPPPPPTP-APQSSPAPPPAPDMTPPPGP 70 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP P P Sbjct: 35 PPPPPAPDMPPPPPTPAP 52 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP +P P Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSP 56 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P P P +SP P P Sbjct: 39 PAPDMPPPPPTPAPQSSPAPPP 60 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P +PPP P Sbjct: 41 PDMPPPPPTPAPQSSPAPPPAP 62 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P +T P PPPPP P Sbjct: 13 PAPPRPTPAPQATPPPAI--PESGPPPPPAP 41 >08_02_0602 + 19183549-19184919 Length = 456 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACK 517 GG GG GG GG GGG + ACK Sbjct: 64 GGGSGGGGGGGGGGGGGGGGTNQACAACK 92 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 64 GGGSGGGGGGGGGGGGGGGG 83 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 61 GASGGGSGGGGGGGGGGGGGGG 82 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGAC 520 G G G GG GG GGG G AC Sbjct: 61 GASGGGSGGGGGGGGGGGGGGGGTNQAC 88 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 64 GGGSGGGGGGGGGGGGGGGG 83 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP T P PP PPP Sbjct: 600 PPPPPKSTGPGPPRPPPP 617 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P P PPPP P Sbjct: 591 PPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPP P P P P +PPP P Sbjct: 583 PVPPPEP-SPPPAPKAAPPPPP 603 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PP P PPP SPPP P Sbjct: 577 PPLKASPVPPPEPSPPPAP 595 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P P LS P PPP P Sbjct: 65 PPPLPPLQPTPPPLPPTTLSCSSHPTPPPPP 95 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP PPP L+ S PPPPP P Sbjct: 67 PLPPLQPTPPPLPPTTLSCSSHPTPPPPPSP 97 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P +S PP P Sbjct: 89 PTPPPPPSPTTSPSASSLPPVP 110 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPST+ P PPPPP P Sbjct: 103 PAPPPPSCCPPSTQQCYH-CCPEPPPPPPKP 132 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP + PPPPP Sbjct: 355 PPPPPPPPPPPPVYYSSYVMLDRPPPPPP 383 Score = 28.7 bits (61), Expect = 7.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 918 LPPPPPXXPXPPP 956 +PPPPP P PPP Sbjct: 354 VPPPPPPPPPPPP 366 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P + PPPPP Sbjct: 30 PPPPMGPPPPPPMPPVPVMYLRGVPPPPP 58 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P+ PPPP P PPP P P Sbjct: 27 PVAPPPPMGPPPPPPMPPVP 46 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP T PPP PPP Sbjct: 412 PPPPPTHTHGPPPPPPPP 429 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPP--PXXPXPPPXTSPPPXP 980 P PPPP P P PPP PP P Sbjct: 357 PPPPPPFAPTLPPPPPPRRKPPSP 380 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP PPP PPP P Sbjct: 413 PPPPTHTHGPPPPPPPPPPP 432 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PP SPP P Sbjct: 365 PTLPPPPPPRRKPPSPSPPSSP 386 >01_06_0840 + 32343700-32344138,32345329-32345419,32345584-32345866, 32346023-32346097,32346470-32346514,32346889-32346979, 32347060-32347118,32347621-32347704,32348109-32348168, 32348585-32348637,32348724-32348757,32349334-32350335, 32350477-32351035,32351873-32352372,32352793-32353200 Length = 1260 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 102 GRGGGAGRGGGRGGSGGGGGGG 123 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -1 Query: 603 GGXGXG-GKGGXXGGXGGGXXXG 538 GG G G G+GG GG GGG G Sbjct: 101 GGRGGGAGRGGGRGGSGGGGGGG 123 >10_08_1008 - 22222051-22222377,22222479-22222640,22223179-22223310, 22224556-22224608,22224713-22225256 Length = 405 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP+ P P PPPPP P Sbjct: 13 PPAPAAAAPPPAAAP---APPPSQPPPPPLP 40 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPP P PPP PPP Sbjct: 21 PPPAAAPAPPPSQPPPP 37 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 526 PXXAPXXXPAPXPPXXXPLASXSPPP 603 P AP P+ PP P A +PPP Sbjct: 23 PAAAPAPPPSQPPPPPLPFAQQAPPP 48 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPPS P + L P P PP Sbjct: 237 PPPPPP--PPPSLLPPVPLLPPLIPGVPP 263 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPPST--RPXLALSXPXXPPPPPXP 743 PP PPPS+ P L L PPPPP P Sbjct: 214 PPLTPQPPPSSLIPPVLPLPLLNPPPPPPPP 244 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PP P +PP Sbjct: 240 PPPPPPSLLPPVPLLPP 256 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PP P L+ P PPPPP Sbjct: 220 PPPSSLIPP--VLPLPLLNPPPPPPPPP 245 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP PPP SPPP P Sbjct: 59 PPPPAPLTPPPPKSPPPPP 77 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS----PPPXP 980 PL PPPP P PPP PPP P Sbjct: 64 PLTPPPPKSPPPPPHIQTTDLPPPKP 89 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP T PPP PPP Sbjct: 59 PPPPAPLTPPPPKSPPPP 76 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXP--XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP S P + PPP P P Sbjct: 59 PPPPAPLTPPPPKSPPPPPHIQTTDLPPPKPLP 91 >07_03_0558 + 19461369-19462448 Length = 359 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 53 GGGGGFGGGGGGGLGGGGGGLG 74 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 133 GGGGFGGGGGGGLGGGGGHG 152 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GG G GGGGG G Sbjct: 67 GGGGGGLGGGHGGGFGGGGGLG 88 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGGGG G Sbjct: 83 GGGGLGGGASGGVGGGGGFG 102 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 59 GGGGGGGLGGGGGGLGGGHGGG 80 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG V GGG GGGGG G Sbjct: 163 GGAGGGVGGGGGFGGGGGGGLG 184 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG V GGG GGGGG G Sbjct: 303 GGAGGGVGGGGGFGGGGGGGLG 324 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 156 GAGGG-VGGGAGGGVGGGGGFG 176 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG GGGGG G Sbjct: 231 GGAGGGIGGGGGFGGGGGGGLG 252 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G+ GGG G GGGGG Sbjct: 45 GFGEGEGFGGGGGFGGGGGG 64 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 51 GFGGGGGFGGGGGGGLGGGGGG 72 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GG G GGG G G Sbjct: 103 GGGGGGLGGGQGGGFGGGAGAG 124 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 132 GGGGGFGGGGGGGLGGGGGHGG 153 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GG G GGG G G Sbjct: 177 GGGGGGLGGGHGGGFGGGAGVG 198 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG V GG G GGGGG G Sbjct: 193 GGAGVGGGAGGGVGGGGGFG 212 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GG G GGG G G Sbjct: 245 GGGGGGLGGGHGGGFGGGAGVG 266 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG V GG G GGGGG G Sbjct: 297 GGAGVGGGAGGGVGGGGGFG 316 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 97 GGGGFGGGGGGGLGGGQGGG 116 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 124 GGGAGGGLGGGGGFGGGGGG 143 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG GGGGG G Sbjct: 125 GGAGGGLGGGGGFGGGGGGGLG 146 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 144 GLGGGGGHGGGFGAGGGVGGGAG 166 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 162 GGGAGGGVGGGGGFGGGGGG 181 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 171 GGGGFGGGGGGGLGGGHGGG 190 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 230 GGGAGGGIGGGGGFGGGGGG 249 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 239 GGGGFGGGGGGGLGGGHGGG 258 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 266 GSGAGGGVGGGGGFGGGGGG 285 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 275 GGGGFGGGGGGGLGGGHGSG 294 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 302 GGGAGGGVGGGGGFGGGGGG 321 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 311 GGGGFGGGGGGGLGGGHGGG 330 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 338 GGGAGGGVGGGGGFGGGGGG 357 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 116 GFGGGAGAGGGAGGGLGGGGGFG 138 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 268 GAGGGVGGGGGFGG-GGGGGLG 288 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 336 GVGGGAGGGVGGGGGFGGGGGGG 358 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 96 GGGGGFGGGGGGGLGGGQGGGFG 118 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 170 GGGGGFGGGGGGGLGGGHGGGFG 192 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 206 GGGGGFGGGGGSGLGGGQGGGFG 228 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 222 GQGGGFGAGGGAGGGIGGGGGFG 244 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 238 GGGGGFGGGGGGGLGGGHGGGFG 260 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 310 GGGGGFGGGGGGGLGGGHGGGFG 332 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G V GGG GGGGG G Sbjct: 89 GGASGGVGGGGGFGGGGGGGLG 110 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG V GGG GGG G G Sbjct: 199 GGAGGGVGGGGGFGGGGGSGLG 220 >06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 Length = 216 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP PPP T+P L P P P Sbjct: 51 PPPPYCVYPPPPTKPALPAPLPPTPASP 78 >05_04_0303 - 20010761-20011756 Length = 331 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V G G G GGGGG G Sbjct: 51 GVGGGVVGGDGVGGGGGGGGGG 72 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG V GGG G GGGGG G Sbjct: 58 GGDGVGGGGGGGGGGGGGVG 77 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGD GGG G GGGGG Sbjct: 55 GVVGGDGVGGGGGGGGGGGG 74 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = -3 Query: 979 GXGGGDVXG---GGXGXXGGGGGXG 914 G GGG V G GG G GGGGG G Sbjct: 46 GGGGGGVGGGVVGGDGVGGGGGGGG 70 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GGGG G Sbjct: 21 GGGGGDGRGGGYGGAGGGGVGG 42 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGR 535 GG G G+GG GG GGG GR Sbjct: 21 GGGGGDGRGGGYGGAGGGGVGGR 43 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG V G GG G GGGGG G Sbjct: 34 GAGGGGVGGRGGRGPPGGGGGRG 56 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 64 GYGGGG-GGGGRGYGGGGGGGG 84 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 52 GGGRGYEPGGGRGYGGGGGGGG 73 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+G GG GGG G G Sbjct: 67 GGGGGGGRGYGGGGGGGGYESGGGRG 92 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 15 GRGGGRGGGGGDGRGGGYGGAG 36 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGG G Sbjct: 80 GGGGGYESGGGRGYGGGGRG 99 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 33.1 bits (72), Expect = 0.35 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP 968 P+PPPPP P PPP P Sbjct: 24 PVPPPPPPPPPPPPANVP 41 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PP P PPP PPP P Sbjct: 17 LGPPAPAPVPPPPPPPPPPPP 37 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Frame = +3 Query: 651 PPPPX----PXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP+ P A + PPPPP Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PP +PPP P Sbjct: 273 PAAPPPPAGPPPP---APPPLP 291 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPP----PXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPP 374 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P + RP PPPPP Sbjct: 349 PPPPPPPAAPAAPRPP---GPGPGPPPPP 374 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P A PPPP P Sbjct: 363 PPGPGPGPPPP---PGAAGRGGGGPPPPALP 390 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P P P P Sbjct: 321 PPPPPAHPAAPAPPPPAPSP 340 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 396 PAPPPPPQPPPPPP---PPP 412 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PP P P Sbjct: 399 PPPPQPPPPPPPPPHQRETPSPSPPPQPQFP 429 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P SPPP P Sbjct: 405 PPPPPPPPHQRETPSPSPPPQP 426 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPP P P PPP P Sbjct: 396 PAPPPPPQPPPPPPPPPHQRETPSPSPPPQP 426 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP P P Sbjct: 399 PPPPQPPPPPPPPPHQRETPSP 420 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPX--PPPXTSPPPXP 980 PPPPP P PP T+PPP P Sbjct: 137 PPPPPSHPALLPPDATAPPPPP 158 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPP 737 P P PPPS P L PPPPP Sbjct: 134 PAPPPPPPS-HPALLPPDATAPPPPP 158 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 32.7 bits (71), Expect = 0.46 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP PPP PP P Sbjct: 115 IPPPPPLAETPPPMNERPPTP 135 >10_08_0214 - 15915156-15915713 Length = 185 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 62 GGGSGGAAGGGYGRGGGGGGGG 83 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 139 GSGAGGAHGGGYGSGGGGGGGG 160 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 28 GYGPGGGGGGGGGGEGGGGGYG 49 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG+ GGG G G G G G Sbjct: 37 GGGGGEGGGGGYGGSGYGSGSG 58 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 33 GGGGGGGGGEGGGGGYGGSG 52 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 114 GGGGGGGQGGGAGGYGQGSGYG 135 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P P A+ P PPPPP P Sbjct: 54 PPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLP 86 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PP T P A+ P P PP P Sbjct: 40 PPAPTVVAPPLPTTPPPAVVAPSPPLPPLTP 70 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXP-XXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP+ P A++ P PP P Sbjct: 81 PPPPLPAIVVPPALPPTPAIAVPPALPPIP 110 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP PPP SP P P Sbjct: 404 PPPPPLYYPPPPDISPSPPP 423 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPP P PPP +P P Sbjct: 412 PPPPDISPSPPPSVTPLP 429 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPPS P + P P P P Sbjct: 413 PPPDISPSPPPSVTPLPPVVYPSPPEVTPSP 443 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 221 PPPPPPPPSPHRHPAAHPPPPP 242 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P P + P PP P P Sbjct: 220 PPPPPPPPPSPHRHP---AAHPPPPPHHPAP 247 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P PPP P Sbjct: 140 PPPPHVPKAAPPPPPPPPP 158 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PP PPP Sbjct: 151 PPPPPPPPHAPP--GPPP 166 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP T P Sbjct: 152 PPPPPPPHAPPGPPPTKGVATP 173 >08_02_1256 + 25645085-25645396 Length = 103 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PPP SPPP P Sbjct: 61 PPPP--PPPPPLPSPPPPP 77 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 62 PPPPPPPPLPSPPP--PPPP 79 >06_03_1326 - 29355467-29355817 Length = 116 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GGKGG G GGG G G Sbjct: 16 GGGGGGGKGGGGGSGGGGRSGGGGGG 41 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+ G GG GGG G G+ K G G G Sbjct: 27 GGSGGGGRSGGGGGGGGGKGGGE-GGSGKYGGGYSGGHAG 65 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 12 GKGGGGGGGGGKGGGGGSGGGG 33 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 7 GGGGGGKGGGGGGGGGKGGGGG 28 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKG 24 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 6 GGGGGGGKGGGGGGGGGKGGGG 27 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 9 GGGGKGGGGGGGGGKGGGGGSG 30 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 22 GKGGGGGSGGGGRSGGGGGGGG 43 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 25 GGGGSGGGGRSGGGGGGGGG 44 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 2 GGKGGGGGGGGKGGGGGGG 20 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 28 GSGGGGRSGGGGGGGGGKGGGEG 50 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGG--GGXG 914 G GGG GGG G GGG GG G Sbjct: 16 GGGGGGGKGGGGGSGGGGRSGGGG 39 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 10 GGGKGGGGGGGGGKGGGGGSGG 31 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPPS A PPPPP Sbjct: 77 PPPPPPPPPPPSPP---ATHDVGQPPPPP 102 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT----SPPPXP 980 P PPPPP P PP T PPP P Sbjct: 77 PPPPPPPPPPPSPPATHDVGQPPPPP 102 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPP 970 T PPPPP PPPP PP Sbjct: 76 TPPPPPP----PPPPPSPP 90 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 10/41 (24%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL----------SXPXXPPPPPXP 743 PPPP P PPP R A + P PPPPP P Sbjct: 308 PPPPPPPPPPPMPRSRSASPSPSTSSSGSAGPPAPPPPPPP 348 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPPPP P PP S P Sbjct: 306 PIPPPPPPPPPPPMPRSRSASP 327 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 921 PPPPPXXPXPPP 956 PPPPP P PPP Sbjct: 239 PPPPPPPPLPPP 250 >04_04_1542 - 34264994-34265331,34266195-34267029 Length = 390 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPX-XPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 215 PTPPPPPLALPLPPPPPPSPPKP 237 >04_03_1022 - 21778315-21779007 Length = 230 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP + L P PPPPP Sbjct: 18 PPPPATRARPPCSSAHLLPPPPPPPPPPP 46 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP-PXP 980 P PPPPP P PP PP P P Sbjct: 37 PPPPPPPPPPYVPPHLLPPSPAP 59 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 666 PXXPPPST--RPXLALSXPXXPPPPPXP 743 P PPP+T RP + + PPPPP P Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPP 43 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 3/24 (12%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSP---PPXP 980 LPPPPP P PPP P PP P Sbjct: 35 LPPPPPP-PPPPPYVPPHLLPPSP 57 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPPP +PP Sbjct: 36 PPPPPP--PPPPPYVPP 50 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP S+ L P PPPP P Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPPYVP 49 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP P PPP P L P P P Sbjct: 36 PPPPPPPPPPPYVPPHL---LPPSPAP 59 >03_06_0642 + 35239658-35240083,35240167-35240238,35240305-35240919, 35241253-35241435,35241604-35241663,35241733-35241936, 35242497-35242745,35243609-35243707,35243760-35243858, 35244463-35244480,35244668-35244862,35244981-35245073, 35245265-35245531,35245884-35246102 Length = 932 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLPPP PP T+PPP P Sbjct: 65 PLPPPEQQKQQQPPPTTPPPAP 86 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 101 GGGGGWGAGGGGGGGGGGGGGG 122 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 100 GGGGGGWGAGGGGGGGGGGGGG 121 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGG G Sbjct: 93 GGAGGPLGGGGGGWGAGGGGGG 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G G GGG G Sbjct: 92 GGGAGGPLGGGGGGWGAGGGGG 113 >02_04_0021 + 18975992-18976408 Length = 138 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P P PPPP Sbjct: 97 PPPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPPP 974 P PPPP P PP P SPPP Sbjct: 104 PTPPPPAPTPKPPAPSPSPPP 124 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXP-PPXTSPPPXP 980 P P PPP P P PP SP P P Sbjct: 102 PKPTPPPPAPTPKPPAPSPSPPP 124 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPP P T PPP P P Sbjct: 96 TPPPPKPKPTPPPPAPTPKP 115 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP+ P P P PP P Sbjct: 99 PPKPKPTPPPPAPTP----KPPAPSPSPPPP 125 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PP T PP P Sbjct: 97 PPPPKPKPTPPPPAPTPKPPAP 118 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LPPPPP P PP S PP Sbjct: 36 LPPPPPPPPPPPSQPSAPP 54 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P P PPPPP Sbjct: 119 PPPPPPPHPPEDPPPH-PPHPPDHPPPPP 146 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP PP P Sbjct: 133 PHPPHPPDHPPPPPPCRVPPPP 154 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP P P P PPP P Sbjct: 116 PPRPPPPPPPHPPEDPPPHP 135 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PP P P Sbjct: 119 PPPPPPPHPPEDPPPHPPHP 138 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 PP P PPP P P PP PPP P Sbjct: 116 PPRPPPPPPPHPPEDPPPHPPHPPDHPPPPP 146 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 9/40 (22%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-----LS----XPXXPPPPPXP 743 PPPP P PP +T LS P PPPPP P Sbjct: 86 PPPPVPPCPPNATHVVPCHEDDELSGERHCPPRPPPPPPP 125 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXP----PPXTSPPPXP 980 P PP PP P P PP PPP P Sbjct: 122 PPPPHPPEDPPPHPPHPPDHPPPPPP 147 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP P Sbjct: 142 PPPPPPCRVPPPPGYRQP 159 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P P T P A P PPPPP P Sbjct: 108 PKPQPRSPEPETPPAPA---PLPPPPPPPP 134 >01_01_0929 - 7344911-7345978 Length = 355 Score = 32.7 bits (71), Expect = 0.46 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PP T PP P Sbjct: 15 PAPPTPPLPPSPPSKTRRPPPP 36 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P + P + L P PPPP Sbjct: 33 PPPPPPPFCPHLSVPCVGLPLPPPCPPPP 61 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TR P PPPP P Sbjct: 18 PTPPLPPSPPSKTR------RPPPPPPPFCP 42 >12_01_0252 + 1868670-1869200,1870167-1871120 Length = 494 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 77 GGGGGGSGGGGRGGAGGGGG 96 >11_01_0252 + 1934505-1935032,1936001-1936957 Length = 494 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 76 GGGGGGSGGGGRGGAGGGGG 95 >10_08_0514 + 18465474-18465760,18465888-18465978,18466670-18466767, 18466852-18466949,18468192-18468321,18468410-18468597, 18470291-18470323,18470627-18471000,18471116-18471294, 18471421-18471532,18471655-18471771,18471875-18472189, 18472405-18472743 Length = 786 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 8 GRGGRPLLGGGGGKRGGGGGGG 29 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 17 GGGGKRGGGGGGGGGGGG 34 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G GGG GGG G GGGG Sbjct: 16 GGGGGKRGGGGGGGGGGGG 34 >09_02_0601 + 11112201-11112386,11112471-11114080,11114345-11114579, 11115233-11115358 Length = 718 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/35 (48%), Positives = 18/35 (51%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP PS+ P L S P P PPP P Sbjct: 411 PAPPSPPEPPSPRHPSSPPPLR-SPPRQPTPPPSP 444 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P +SPPP Sbjct: 411 PAPPSPPEPPSPRHPSSPPP 430 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP SPPP P Sbjct: 53 PTAPPPKPSPTPPP-ASPPPAP 73 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P A + P PP P P Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSPPP 85 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPP++ P PP PP Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSPP 84 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPP--PPXXPXPPPXTSPPPXP 980 P PPP PP P PP P P P Sbjct: 62 PTPPPASPPPAPTPPQTRPPSPPP 85 >05_07_0219 - 28474661-28475146,28475979-28476644 Length = 383 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP+ A P PPPPP Sbjct: 178 PPPPATMIPPPTV---TATITPLWPPPPP 203 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P T A + P P P P P Sbjct: 88 PPPPSPATSSSRTATATATATPTSPTPTPPP 118 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P ++ PPPPP P Sbjct: 57 PPPPPPLPQPQHHHDAVSTDESRTPPPPPPP 87 >03_05_0576 + 25765137-25766420 Length = 427 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPP P P PPP + PP Sbjct: 77 PSPPPQPSSPPPPPPSPPP 95 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P P P PP +SPPP P Sbjct: 69 PSPSPSPSPSPPPQPSSPPPPP 90 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPP 973 PPP + PPPP PPP Sbjct: 79 PPPQPSSPPPPPPSPPP 95 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPPS P A+S P P P Sbjct: 81 PQPSSPPPPPPSPPPAAAVSVSPPTQPRPRP 111 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PS P S P PPP P P Sbjct: 68 PPSPS-PSPSPSPPPQPSSPPPPPPSPPP 95 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 P PPP + PPPP PP Sbjct: 77 PSPPPQPSSPPPPPPSPP 94 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPP P A + PP P P Sbjct: 79 PPPQPSSPPPPPPSPPPAAAVSVSPPTQPRP 109 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PS P PPPPP P Sbjct: 65 PEAPPSPSPSPSPSPPPQPSSPPPPPPSP 93 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P P P PPP S PP P Sbjct: 68 PPSPSPSPSPSPPPQPSSPPPP 89 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P P P PS P + P P PPP Sbjct: 68 PPSPSPS-PSPSPPPQPSSPPPPPPSPPP 95 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LPPPPP PPP T+PPP Sbjct: 192 LPPPPPP---PPPDTAPPP 207 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPPXT 979 T PPPPP PPP PPP T Sbjct: 191 TLPPPPPP---PPPDTAPPPQT 209 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP PPP T+ Sbjct: 194 PPPPPPPPDTAPPPQTA 210 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 99 PPPSLPPPPPPLRPPPPP 116 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPP P PPP PPP Sbjct: 99 PPPSLPPPPPPLRPPPP 115 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 921 PPPPPXXPXPPP 956 PPPPP P PPP Sbjct: 105 PPPPPLRPPPPP 116 >01_02_0031 + 10364487-10365407 Length = 306 Score = 32.3 bits (70), Expect = 0.61 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP 968 P PPPPP P PPP +P Sbjct: 170 PPPPPPPALPAPPPPPAP 187 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P L L+ P P P Sbjct: 173 PPPPALPAPPPPPAPMLPLAPPPTHVTPAMP 203 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PPPP P P PPP P Sbjct: 167 LVPPPPPPPPALPAPPPPPAP 187 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP P P+ P A P PPP Sbjct: 169 PPPPPPPPALPAPPPPPAPMLPLAPPP 195 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 651 PPPPXPXXP--PPSTRPXLALSXPXXPPP 731 PPPP P P PP T A+ PPP Sbjct: 182 PPPPAPMLPLAPPPTHVTPAMPLSSMPPP 210 >01_01_0762 + 5889925-5890136,5891110-5891273,5891755-5891878, 5891941-5892073,5892629-5892732,5892867-5895780, 5895876-5895965,5896251-5896355,5896633-5896740, 5896826-5896876 Length = 1334 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G D+ GGG G GGGGG G Sbjct: 13 GLGDPDLYGGGGGGGGGGGGGG 34 >12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561, 9769918-9769980,9770547-9771325 Length = 665 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPP RP A S PPPPP P Sbjct: 17 PPPIRPRPPP-VRPY-ASSAASPPPPPPPP 44 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP P PP A S P PPPP Sbjct: 17 PPPIRPRPPPVRPYASSAASPPPPPPPP 44 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 59 GGGGGGGGGGGGGGGGGGRG 78 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 60 GGGGGGGGGGGGGGGGGRGGRG 81 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 P P P PPP +PPP P Sbjct: 3 PLPPLPSPPPPPTPPPSP 20 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 63 GGGGGGGGGGGGGGRGGRGG 82 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP 716 PPPP P PPP P LA + P Sbjct: 87 PPPPPPPPPPPRPAPSLASALP 108 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 930 PPXXPXPPPXTSPPPXP 980 PP P PPP PPP P Sbjct: 83 PPPSPPPPPPPPPPPRP 99 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP 968 P PPPP P PPP +P Sbjct: 84 PPSPPPPPPPPPPPRPAP 101 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PP PP P PPP P P Sbjct: 84 PPSPPPPPPPPPPPRPAP 101 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPP P PPP P P P Sbjct: 83 PPPSPPPPPPPPPPPRPAP 101 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 L PPPP P PPP T PPP Sbjct: 41 LSPPPPPPPKPPP-TVPPP 58 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 654 PPPXPXXPPPSTRPX---LALSXPXXPPPPPXP 743 PPP P P P LS P PPP P P Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPPPKPPP 53 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPPS S PPP P P Sbjct: 215 PPPPSIATPPPSPASPPPPSTATPPPPSPTP 245 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP + PP P Sbjct: 212 PASPPPPSIATPPPSPASPPPP 233 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P P PPP T+ PP P Sbjct: 223 PPPSPASP-PPPSTATPPPP 241 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP PPPS P + P PP P Sbjct: 231 PPPSTATPPPPSPTPTTTRASPTPPPIP 258 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PP +PPP P Sbjct: 206 PPRPLPPASPPPPSIATPPPSP 227 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 1/21 (4%) Frame = +2 Query: 920 PPPPPXXTXPPPPXI-PPPXT 979 PPPP T PP P PPP T Sbjct: 215 PPPPSIATPPPSPASPPPPST 235 >10_08_0738 - 20212220-20212282,20212387-20212593,20212690-20212819, 20212919-20213089,20213311-20213433,20213517-20213618, 20214123-20214880 Length = 517 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 3/26 (11%) Frame = +3 Query: 675 PPPSTRPXLALSXP---XXPPPPPXP 743 PPP +RP +A S P PPPPP P Sbjct: 7 PPPPSRPVVAKSPPRRQPHPPPPPPP 32 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P + P P PPPPP P Sbjct: 7 PPPPSRPVVAKSPPRRQPHPPPPPPPPLP 35 >09_04_0580 + 18681019-18681475,18682637-18682920,18683088-18683315, 18683415-18683864 Length = 472 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGG 121 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 102 GGGGGGGGGGGGGGGGGGGG 121 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 103 GGGGGGGGGGGGGGGGGGGG 122 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 103 GGGGGGGGGGGGGGGGGGGG 122 >09_04_0365 - 16962608-16963174,16963301-16963486,16963824-16963896, 16964307-16964497,16964982-16965198,16965394-16965797, 16966593-16966658,16966668-16966721,16966945-16967079, 16967194-16967391,16967734-16967918,16968990-16969527 Length = 937 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP T P PP P P Sbjct: 25 TAPPPPPPPTPPRPPQKPEP 44 >09_03_0145 - 12749288-12751510 Length = 740 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P + P PPPP P Sbjct: 33 PPPPPGIQPPPPALPGM----PHGRPPPPFP 59 Score = 31.1 bits (67), Expect = 1.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP +P Sbjct: 32 PPPPPPGIQPPPPALP 47 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 + PPPP P P PPP P Sbjct: 39 IQPPPPALPGMPHGRPPPPFP 59 >08_02_1330 + 26191062-26191314,26191894-26191961,26192125-26192355, 26192736-26192837,26192893-26192955,26193910-26193984 Length = 263 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 18 GSGGGGGGGGGGGGGGGGGG 37 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PP PP PPPP PPP Sbjct: 94 PPSPPLLALPPPPPPPPP 111 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSP 968 LPPPPP P PPP P Sbjct: 102 LPPPPPPPPPPPPPPQP 118 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 678 PPSTRPXLALSXPXXPPPPPXP 743 PPS P LAL P PPPPP P Sbjct: 94 PPSP-PLLALPPPPPPPPPPPP 114 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 103 PPPPPPPPPPPPPP 116 >08_02_0036 - 11455762-11455802,11455996-11456104,11456207-11456854, 11457422-11457491,11458563-11458624,11458729-11458803, 11459423-11459514,11460233-11461466 Length = 776 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG+GG GG GGG Sbjct: 52 GGRGRGGRGGRRGGGGGG 69 >07_03_0527 - 19085828-19086319 Length = 163 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 21 GGGTGLGGGSGLGGGGGGLG 40 >07_03_0154 + 14509979-14512033 Length = 684 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLP P P PPP PPP P Sbjct: 45 PLPLPAAAPPPPPPPPPPPPPP 66 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P A + P PPPPP P Sbjct: 34 PKSEPASPERGPLPLPAAAPPPPPPPPPPP 63 Score = 28.7 bits (61), Expect = 7.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXI 964 PPPPP PPPP + Sbjct: 54 PPPPPPPPPPPPPQV 68 >07_01_0714 - 5451246-5451408,5453401-5453534,5453608-5453796, 5454313-5454825,5455815-5456856,5457283-5457380, 5458224-5458451 Length = 788 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 25 GGGGGGGGGGGGGGGGGGDG 44 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 967 GDVXGGGXGXXGGGGGXG 914 G V GGG G GGGGG G Sbjct: 22 GAVGGGGGGGGGGGGGGG 39 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 26 GGGGGGGGGGGGGGGGGDGG 45 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 26 GGGGGGGGGGGGGGGGGDGG 45 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GG GGG G GGGGG Sbjct: 22 GAVGGGGGGGGGGGGGGGGG 41 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.9 bits (69), Expect = 0.80 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P PPP++RP P PPPPP Sbjct: 11 PPRLLPPQPPPTSRPL----PPPPPPPPP 35 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLPPPPP P P SPPP Sbjct: 25 PLPPPPP-PPPPAHGPSPPP 43 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPP P PPP PPP Sbjct: 16 PPQPPPTSRPLPPPPPPPPP 35 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPP PP P P PPP P Sbjct: 15 LPPQPPPTSRPLPPPPPPPPP 35 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 140 GYGGGSGYGGGGGYGGGSGGGG 161 >06_01_0178 + 1386981-1387505 Length = 174 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 31 GRGGASGGGGGGGGGGGGGGGG 52 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 34 GASGGGGGGGGGGGGGGGGGAG 55 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKG 58 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 68 GAGGGGGGGGGKGRKGGAGGHG 89 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -1 Query: 603 GGXGXGGK------GGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G GGK GG GG GGG GR GA G G G Sbjct: 53 GAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGG 98 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+GG GG GGG G G Sbjct: 25 GRGGRGGRGGASGGGGGGGGGGGGGG 50 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 30 GGRGGASGGGGGGGGGGGGGGG 51 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 40 GGGGGGGGGGGGGGAGGKGGKG 61 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 43 GGGGGGGGGGGAGGKGGKGGAG 64 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 90 GAGGGGGGGGGKGRKGGRGGDG 111 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GG GG G Sbjct: 46 GGGGGGGGAGGKGGKGGAGGHG 67 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 59 GKGGAGGHGGAGGGGGGGGGKG 80 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G KGG G G G GR G G G Sbjct: 97 GGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGG 136 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+GG G GGG G G Sbjct: 22 GRGGRGGRGGRGGASGGGGGGGGGGG 47 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 25 GRGGRGGRGGASGGGGGGGGGG 46 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 28 GRGGRGGASGGGGGGGGGGGGG 49 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G GG GG GGG G K G G G Sbjct: 30 GGRG-GASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGG 68 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GG G Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGG 59 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 55 GGKGGKGGAGGHGGAGGGGGGG 76 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GG GG G Sbjct: 74 GGGGGKGRKGGAGGHGGAGGGG 95 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GG GG G Sbjct: 96 GGGGGKGRKGGRGGDGGSGGAG 117 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGD GG G GG GG G Sbjct: 105 GGRGGDGGSGGAGGRGGDGGSG 126 >05_04_0235 + 19291204-19291769,19291860-19292250 Length = 318 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 48 GCGGGGGGGGGGGGGGGGGG 67 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 51 GGGGGGGGGGGGGGGGGG 68 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G GGG GGG G GGGG Sbjct: 50 GGGGGGGGGGGGGGGGGGG 68 >04_04_1582 - 34590698-34591199,34593849-34594690 Length = 447 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 236 GSAGGGKKGGGGGGGGGGGGHG 257 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 G G G KGG GG GGG G A Sbjct: 236 GSAGGGKKGGGGGGGGGGGGHGEKGSA 262 >04_04_1414 - 33394518-33394847 Length = 109 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 89 GGGGGGGGGGGGCGGGGGGG 108 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 84 GGPACGGGGGGGGGGGGCG 102 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G GGG GGG G GGGG Sbjct: 90 GGGGGGGGGGGCGGGGGGG 108 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGAC 520 GG GG GG GG GGG G G C Sbjct: 84 GGPACGGGGG--GGGGGGGCGGGGGGGC 109 >04_04_0360 - 24684159-24684565,24684654-24685089 Length = 280 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 57 GGGGGGGGGGGGGGGGGGSG 76 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 56 GGGGGGGGGGGGGGGGGG 73 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 48 GCRSGPCYGGGGGGGGGGGGGG 69 >04_04_0057 + 22410167-22411330 Length = 387 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P S P + PPPPP P Sbjct: 184 PPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P + P S P PPP P Sbjct: 182 PPPPPPPPAAAAASPSPERSPRCQPSPPPPP 212 >04_01_0354 - 4646826-4647314 Length = 162 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 675 PPPSTRPXLALSXPXXPPPPPXP 743 P P P L LS P PPPPP P Sbjct: 81 PRPHPLPNLNLSPPPPPPPPPPP 103 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 921 PPPPPXXPXPPP 956 PPPPP P PPP Sbjct: 93 PPPPPPPPPPPP 104 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP P PPP T+ Sbjct: 28 PPPPPPPPPPPPPPDTN 44 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PPP T Sbjct: 27 PPPPPP---PPPPPPPPPDT 43 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 27 PPPPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXL 701 PPPP P PPP T L Sbjct: 31 PPPPPPPPPPPDTNAIL 47 >03_02_1033 + 13550955-13551700,13552837-13553290,13553451-13553648, 13553726-13553807,13554496-13554590 Length = 524 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXP-PPXTSPPPXP 980 PLP PPP P P PP +P P P Sbjct: 17 PLPVPPPIAPIPAPPPRAPAPAP 39 >03_02_1031 + 13541327-13542072,13543209-13543662,13543823-13544020, 13544098-13544179,13544868-13544962 Length = 524 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXP-PPXTSPPPXP 980 PLP PPP P P PP +P P P Sbjct: 17 PLPVPPPIAPIPAPPPRAPAPAP 39 >03_02_0738 - 10824121-10825572 Length = 483 Score = 31.9 bits (69), Expect = 0.80 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP + PPP P Sbjct: 79 PPPSPPSSSPPPLSFPPPPP 98 Score = 31.9 bits (69), Expect = 0.80 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP + PPPP +P Sbjct: 94 PPPPPPPSSPPPPALP 109 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P S+ P L+ P PP P P Sbjct: 78 PPPPSP---PSSSPPPLSFPPPPPPPSSPPP 105 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P PPP +SPPP Sbjct: 88 PPPLSFPPPPPPPSSPPP 105 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPP P PPP S PP P Sbjct: 88 PPPLSFPPPPPPPSSPPPP 106 >03_02_0719 + 10654842-10654977,10655039-10655124,10655226-10657001, 10657782-10657926,10658017-10658735 Length = 953 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG + GGG G GGGGG G Sbjct: 6 GGAKIGGGGGGGGGGGGGGG 25 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 7/38 (18%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP-------XLALSXPXXPPPPPXP 743 PPPP P P S RP P PPPPP P Sbjct: 34 PPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFP 71 >02_04_0271 + 21445113-21445865,21446727-21446788,21446927-21447027, 21447165-21447248,21448054-21448058,21448193-21448267, 21448339-21448416,21448896-21448952,21449351-21449421, 21449529-21449628,21449758-21449862,21450004-21450066, 21450144-21450266,21450371-21450514,21450598-21450672 Length = 631 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 192 GGGGGGGGGGGGGAGGGGGG 211 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 192 GGGGGGGGGGGGGAGGGGGG 211 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 193 GGGGGGGGGGGGAGGGGGGEEG 214 >02_02_0682 - 12923103-12923747,12924607-12924870,12924953-12925219, 12925301-12925529,12925614-12926295,12926409-12926682, 12926822-12927347,12927460-12927698,12927799-12927896, 12928017-12928020,12928657-12928832,12929593-12929647, 12930787-12931047 Length = 1239 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 4 GGGGGGDGGGGAGAGGGGGG 23 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 3 GGGGGGGDGGGGAGAGGGGGGG 24 >01_06_1602 - 38559661-38559936,38560008-38560137,38562550-38562778, 38563627-38563659,38563746-38563896 Length = 272 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 3 GGGGGGGGGGGGGGGGGGGG 22 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 3 GGGGGGGGGGGGGGGGGGGG 22 >01_06_0561 + 30251547-30252173,30252248-30252405,30253250-30254192, 30254271-30254438,30254546-30254857,30255498-30255557, 30255905-30255937,30256083-30256271 Length = 829 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 25 GGGGGGGGGGGGTGGGGGGG 44 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 26 GGGGGGGGGGGTGGGGGGGG 45 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 26 GGGGGGGGGGGTGGGGGGGG 45 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG GGGGG Sbjct: 25 GGGGGGGGGGGGTGGGGGGG 44 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 915 PLPPPPPXXP-XPPPXTSPPP 974 P PPPPP P P P SPPP Sbjct: 143 PSPPPPPTVPAAPTPRPSPPP 163 >01_01_0046 - 331758-332627 Length = 289 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPXPPPXTS--PPPXP 980 PPPPP P PPP +S PP P Sbjct: 21 PPPPPPPPPPPPSSSRYRPPSP 42 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPPS+ S P P P Sbjct: 22 PPPPPPPPPPPSSSRYRPPSPPSSRHPHP 50 >12_02_1070 - 25814741-25815850 Length = 369 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PP R + P PPPPP P Sbjct: 217 PPSPSTQQLPPKIRLSPTQAPPPPPPPPPPP 247 Score = 28.3 bits (60), Expect = 9.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 921 PPPPPXXPXPPP 956 PPPPP P PPP Sbjct: 237 PPPPPPPPPPPP 248 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPQHPPSPPPLRSPPRQP 595 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPQHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPQHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >12_02_0687 + 22123216-22123760,22125021-22125330 Length = 284 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGGD GGG G GGGG G Sbjct: 40 GGGDGEGGGGGDGEGGGGGG 59 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 32 GGGGGGYDGGGDGE-GGGGGDG 52 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G+ GGG G GGGGG Sbjct: 40 GGGDGEGGGGGDGEGGGGGG 59 >11_06_0202 - 21184217-21184503,21184622-21184982 Length = 215 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPP 737 P P P PS+ P P PPPPP Sbjct: 159 PSLPQAPKPSSPPPFTSPSPLPPPPPP 185 >11_01_0281 + 2086674-2087652,2089200-2089483 Length = 420 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP PPP PPP Sbjct: 12 PAPPSPPSPALPPPFQPPPP 31 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PP PP PPP PPP T Sbjct: 14 PPSPPSPALPPPFQPPPPDT 33 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPP 737 PP P P PPP + P S PPPPP Sbjct: 422 PPAPSQQPQPPPPPSHPTPITSVAPAPPPPP 452 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P +P P P Sbjct: 429 PQPPPPPSHPTPITSVAPAPPP 450 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 15 GGGGGGGGGGGGGRGNGGGGFG 36 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 21 GGGGGGGRGNGGGGFGGGGGGG 42 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 22 GGGGGGRGNGGGGFGGGGGGGG 43 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG+G GG GGG G Sbjct: 21 GGGGGGGRGNGGGGFGGGGGGG 42 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 17 GGGGGGGGGGGRGNGGGGFGGG 38 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 23 GGGGGRGNGGGGFGGGGGGGGG 44 >10_06_0179 - 11508235-11508245,11508555-11508942 Length = 132 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLPPPP P PPP + P Sbjct: 35 PLPPPPKMAPLPPPPAAKAP 54 >10_02_0009 + 4128909-4130123 Length = 404 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P PPP P P Sbjct: 79 PSPPSPPPPPPPPPPQQPAP 98 >09_02_0369 - 8012470-8013120 Length = 216 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P PPPP P Sbjct: 39 PPPPPPHDDPPLKPPPQQQFITAQPPPPDEP 69 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPPS P + P PPPP P Sbjct: 63 PPPPDEPPLKPPPSFYPAV---LPPEPPPPRRP 92 >08_02_1084 - 24232968-24234779 Length = 603 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +3 Query: 651 PPPPXPXXPPPSTR----PXLALSXPXXPPPPP 737 PPPP P PPP + P +A P PP P Sbjct: 95 PPPPLPQAPPPQQQKVHIPGVAAPAPNHPPSQP 127 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPPS P L P PP P Sbjct: 53 PPPSQQLPPPSLPPPLPQKQPPSQQLPPPP 82 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPP PP + PPP P Sbjct: 78 LPPPPQQQQPPPQHSLPPPPP 98 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -1 Query: 603 GGXGXGGKGGXXGG--XGGGXXXGRXXGACKXG 511 GG GG+GG GG GGG GR G G Sbjct: 302 GGNYGGGRGGGPGGGAGGGGGNWGRGGGGMGRG 334 >08_02_1019 - 23657175-23658047 Length = 290 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGGDVX--GGGXGXXGGGGGXG 914 G GGG V GGG G GGGGG G Sbjct: 33 GGGGGGVPKPGGGVGGGGGGGGGG 56 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGG 920 GG V GGG G GGGGG Sbjct: 43 GGGVGGGGGGGGGGGGG 59 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 43 GGGVGGGGGGGGGGGGGG 60 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PP SP P Sbjct: 18 PPPPPPPPPPPLPPRGSPAP 37 Score = 25.4 bits (53), Expect(2) = 4.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 651 PPPPXPXXPPP 683 PPPP P PPP Sbjct: 18 PPPPPPPPPPP 28 Score = 22.6 bits (46), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 714 PXXPPPPPXP 743 P PPPPP P Sbjct: 21 PPPPPPPPLP 30 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 64 GGGGPPYYGGGGGGGGGGGGQG 85 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GG G GGGGG Sbjct: 63 GGGGGPPYYGGGGGGGGGGG 82 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -1 Query: 585 GKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G+GG GG GGG G G G G G Sbjct: 135 GRGGGGGGGGGGGYRGDDEGRSSYGRARGGGGGG 168 >06_03_1153 - 28047125-28047751 Length = 208 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP PPP + PPP P Sbjct: 9 PPPPAIFCPPPLSPPPPPP 27 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P PPP Sbjct: 89 PTPPPPPPPPLPQHRLEPPP 108 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 559 GGGGGGYSGGGGGYSGGGRGGG 580 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 542 GSGGGYSGGGGGGGYSGGGGGG 563 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 576 GRGGGYSRGGRGGYSGGGGGGG 597 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG GG+GG GG GGG Sbjct: 579 GGYSRGGRGGYSGGGGGG 596 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 551 GGGGGYSGGGGGGGYSGGGG 570 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 550 GGGGGGYSGGGGGGGYSGGGGG 571 >06_01_1113 - 9164953-9165044,9166453-9166586,9166624-9166734, 9166815-9167066,9167152-9168186,9168313-9169187, 9169476-9169673 Length = 898 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 463 PSPPEPPSPRDPASPPSLRSPPRQPTPPPSP 493 >05_06_0078 - 25412770-25413852 Length = 360 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 293 GEGGGAAGGGRDGITGGGGGGG 314 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 603 GGXGXGGKGG--XXGGXGGGXXXGRXXGACKXG 511 GG G GG G GG GGG G G C G Sbjct: 216 GGDGVGGSTGITGVGGGGGGISGGDGDGGCITG 248 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGG G Sbjct: 284 GGGGGDAAGGEGGGAAGGGRDG 305 >05_05_0101 - 22398814-22399164 Length = 116 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 14 GGGAGLGGGGGLGGGGGGLG 33 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP + P S P PPPPP Sbjct: 9 PPPPPP--PPSESTPT---SDPKPPPPPP 32 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 10 PPPPPPPSESTPTSDPKPPPPP 31 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP +P P Sbjct: 549 PPPPPPPPPPPPAPAPALAP 568 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P P +P P Sbjct: 551 PPPPPPPPPPAPAPALAPAP 570 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA 704 PPPP P PPP+ P LA Sbjct: 550 PPPPPPPPPPPAPAPALA 567 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P + P P Sbjct: 549 PPPPPPPPPPPPAPAPALAPAP 570 >04_04_0146 + 23106325-23108154 Length = 609 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPPS RP A PPPPP Sbjct: 14 PPPVPAQAPPPSPRPWYA-----APPPPP 37 >04_01_0034 - 401208-402923 Length = 571 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPP P + P PPPPP P Sbjct: 300 PLQPRPAPPPPP--PQQQRAKPSRPPPPPPP 328 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP PPP + PP Sbjct: 322 PPPPPPPLDPPPRAAAPP 339 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP P Sbjct: 308 PPPPPQQQRAKPSRPPPPPP 327 >03_05_0843 + 28126480-28127007,28127092-28127457,28129388-28129487, 28130266-28130546,28130643-28130705,28131276-28131431, 28131913-28132080,28132158-28132298,28132714-28132840, 28132888-28132994,28134142-28134372,28134446-28134559, 28135091-28135261 Length = 850 Score = 31.5 bits (68), Expect = 1.1 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +PPPPP P PPP ++ P Sbjct: 37 MPPPPPPLPPPPPRSNSAP 55 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PP S PP Sbjct: 39 PPPPPLPPPPPRSNSAPP 56 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 90 GGGGGGYGGGGGGYGGGRGGGG 111 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG GG+GG G GGG GR G G G G Sbjct: 100 GGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGG-GXGXXGGGGGXG 914 G GGG GG G G GGGGG G Sbjct: 97 GGGGGGYGGGRGGGGYGGGGGGG 119 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 126 GYGGGGGYGGGRG--GGGGGYG 145 >03_03_0193 - 15312568-15312753,15312811-15312933,15313112-15313134, 15313196-15313349,15314443-15314754 Length = 265 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 46 GGGGGHFFGGGGGRGRGGGGGG 67 >03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 Length = 138 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PP P PPP PPP P Sbjct: 82 PDDPPKKPDPPPPCPPPPPP 101 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP P P Sbjct: 428 PPPPPPPPPPPPQALPLP 445 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPP P PPP + P Sbjct: 425 PYAPPPPPPPPPPPPQALP 443 Score = 25.4 bits (53), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 651 PPPPXPXXPPP 683 PPPP P PPP Sbjct: 428 PPPPPPPPPPP 438 Score = 22.6 bits (46), Expect(2) = 3.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 714 PXXPPPPPXP 743 P PPPPP P Sbjct: 430 PPPPPPPPPP 439 >03_02_0765 + 11000724-11002496 Length = 590 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 41 GFGGGGGFGGGGGLGGGGGAGG 62 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 321 GLGGGAGAGGGGGLGGGAGGGG 342 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 361 GLGGGAGAGGGGGLGGGAGGGG 382 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 401 GLGGGAGTGGGGGLGGGAGGGG 422 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 441 GFGGGAGAGGGGGLGGGAGGGG 462 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 557 GFGGGAGAGGGGGLGAGGGGGG 578 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 566 GGGGLGAGGGGGGGFGGGGGVG 587 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 271 GLGGGAGAGGGGGLGGGTGGGG 292 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 47 GFGGGGGLGGGGGAGGGFGGGLG 69 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXG-GGXGXXGGGGGXG 914 G GGG G GG G GGGGG G Sbjct: 77 GFGGGKGGGLGGGGGLGGGGGAG 99 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 85 GLGGGGGLGGGGGAGGGFGGGLG 107 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 197 GAGGGGGLGGGAGGGGGLGGGAG 219 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 225 GAGGGGGAGGGLGGGAGGGG 244 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 277 GAGGGGGLGGGTGGGGGLGGGTG 299 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGX-XGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 283 GLGGGTGGGGGLGGGTGGGGGLG 305 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 287 GTGGGGGLGGGTGGGGGLGGGAG 309 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 327 GAGGGGGLGGGAGGGGGLGGGAG 349 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 367 GAGGGGGLGGGAGGGGGLGGGAG 389 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 407 GTGGGGGLGGGAGGGGGLGGGAG 429 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 485 GTGGGGGLGGGAGGGGGLGGGAG 507 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 37 GGGGGFGGGGGFGGGGGLGGGG 58 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 602 GGGEXEARGXXXGGXGAGXXXGAXXGHVXXXGXXXGXXK 486 GGG G GG GAG G GH G G K Sbjct: 44 GGGGFGGGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGK 82 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 129 GLGGGAGGGGGLGSGGGLGGGAG 151 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 160 GGGGLGGGAGGGLGGGAGGG 179 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 210 GGGGLGGGAGGGLGGGAGGG 229 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 242 GGGGLGGGAGGGLGGGAGGG 261 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 260 GGGGLSGGAGGGLGGGAGAG 279 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 300 GGGGLGGGAGGGLGGGAGAG 319 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GG G Sbjct: 311 GLGGGAGAGGGLGGGAGAGGGG 332 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 340 GGGGLGGGAGGGLGGGAGAG 359 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GG G Sbjct: 351 GLGGGAGAGGGLGGGAGAGGGG 372 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 380 GGGGLGGGAGGGLGGGAGAG 399 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 420 GGGGLGGGAGGGLGGGAGAG 439 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GG G Sbjct: 431 GLGGGAGAGGGFGGGAGAGGGG 452 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GG GG G Sbjct: 479 GGGAGAGTGGGGGLGGGAGGGG 500 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGG G G Sbjct: 498 GGGGLGGGAGGGLGGGAGAG 517 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 79 GGGKGGGLGGGGGLGGGGGAGG 100 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GG GG G Sbjct: 117 GGGKGGGLGGGGGLGGGAGGGG 138 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GG G G GGG G Sbjct: 216 GGAGGGLGGGAGGGGGAGGGLG 237 >03_01_0343 - 2699518-2700114 Length = 198 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 927 PPPXXPXPPPXTSPP 971 PPP P PPP TSPP Sbjct: 90 PPPPTPAPPPVTSPP 104 >02_05_0407 + 28715332-28715385,28715528-28715680,28715810-28715872, 28715988-28716021,28716157-28716279,28716400-28716462, 28716655-28716748,28717049-28717094,28717180-28717247, 28717360-28717408,28717593-28717658,28718876-28719074, 28719344-28719386,28719719-28719923 Length = 419 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 20 GGGGGARRGGGGGGGGGGGG 39 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GG G GGGGG G Sbjct: 21 GGGGARRGGGGGGGGGGGGG 40 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GG GGG G GGGGG Sbjct: 21 GGGGARRGGGGGGGGGGGGG 40 >02_02_0338 + 9105725-9106581,9106950-9107091 Length = 332 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P P T+ P P Sbjct: 5 PPPPPTKPKPKPATAAQPAP 24 >02_01_0158 - 1103461-1104186 Length = 241 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 81 GAGGGGGGGGGFGSRGGGGSGG 102 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G V GG G GGGGG G Sbjct: 72 GPDGSFVKGGAGGGGGGGGGFG 93 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PKPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPKPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPKPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 405 PEPPSPRHPPSPPPLRSPPRQP 426 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 399 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 432 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 399 PAPPSPPEPPSPRHPPSPPP 418 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 413 PPSPPPLRSPPRQPTPPPSP 432 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 414 PSPPPLRSPPRQPTPPPSPSQQPPLP 439 >12_01_0838 - 7830944-7831444 Length = 166 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 62 GKGGGQ-SGGGQGSGGGGGGGG 82 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 136 GYGKGGGGGGGGGGDGGGGGGG 157 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 138 GKGGGG-GGGGGGDGGGGGGGG 158 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G G G G GGGGG G Sbjct: 99 GQGNGGAQGQGSGGGGGGGGGG 120 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG G G G GGGGG G Sbjct: 101 GNGGAQGQGSGGGGGGGGGGGG 122 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 31 GGESGGGGGGGGGGGGGGNG 50 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 35 GGGGGGGGGGGGGGNGSGSGSG 56 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGG G G Sbjct: 107 GQGSGGGGGGGGGGGGGGSGQG 128 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 109 GSGGGGGGGGGGGGGGSGQGSG 130 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 111 GGGGGGGGGGGGGGSGQGSGSG 132 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G G G G GGGGG G Sbjct: 126 GQGSGSGYGYGYGKGGGGGGGG 147 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -1 Query: 600 GXGXG-GKGGXXGGXGGGXXXGRXXG 526 G G G GKGG GG GGG G G Sbjct: 132 GYGYGYGKGGGGGGGGGGDGGGGGGG 157 >12_01_0415 + 3292576-3293727 Length = 383 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 967 GDVXGGGXGXXGGGGGXG 914 G+V GGG G GGGGG G Sbjct: 26 GEVEGGGGGGGGGGGGGG 43 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >10_07_0154 + 13487971-13488168,13488259-13488483,13488592-13490492, 13490578-13490829,13491110-13491191,13491466-13491657 Length = 949 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 538 PEPPSPRHPPSPPPLRSPPRQP 559 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 532 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 565 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 532 PAPPSPPEPPSPRHPPSPPP 551 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 546 PPSPPPLRSPPRQPTPPPSP 565 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 547 PSPPPLRSPPRQPTPPPSPSQQPPLP 572 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHLPSPPPLRSPPRQP 595 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHLPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHLPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P + + PPPPP Sbjct: 248 PPPPGQGPVPPRDAPPMHHAQGNVPPPPP 276 >09_04_0487 - 18014469-18014660,18014935-18015016,18015297-18015548, 18015634-18017789 Length = 893 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 482 PEPPSPRHPPSPPPLRSPPRQP 503 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 479 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 509 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 476 PAPPSPPEPPSPRHPPSPPP 495 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 490 PPSPPPLRSPPRQPTPPPSP 509 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 491 PSPPPLRSPPRQPTPPPSPSQQPPLP 516 >09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962, 7633517-7633622,7633897-7633978,7634068-7634178, 7634259-7634510,7634596-7635688,7636157-7636829, 7636920-7637117 Length = 936 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 418 PEPPSPRHPPSPPPLRSPPRQP 439 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 412 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 445 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 412 PAPPSPPEPPSPRHPPSPPP 431 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 426 PPSPPPLRSPPRQPTPPPSP 445 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 427 PSPPPLRSPPRQPTPPPSPSQQPPLP 452 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 487 PEPPSPRHPPSPPPLRSPPRQP 508 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 484 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 514 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 481 PAPPSPPEPPSPRHPPSPPP 500 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 495 PPSPPPLRSPPRQPTPPPSP 514 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 496 PSPPPLRSPPRQPTPPPSPSQQPPLP 521 >08_02_0450 - 17266977-17267165,17268017-17268053,17268139-17269514, 17285369-17286055,17286146-17286343 Length = 828 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 528 PEPPSPRHPPSPPPLRSPPRQP 549 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 525 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 555 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 522 PAPPSPPEPPSPRHPPSPPP 541 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 536 PPSPPPLRSPPRQPTPPPSP 555 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 537 PSPPPLRSPPRQPTPPPSPSQQPPLP 562 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 552 PEPPSPRHPPSPPPLRSPPRQP 573 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 549 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 579 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 546 PAPPSPPEPPSPRHPPSPPP 565 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 560 PPSPPPLRSPPRQPTPPPSP 579 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 561 PSPPPLRSPPRQPTPPPSPSQQPPLP 586 >08_01_1038 + 10540185-10540709 Length = 174 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 21 GGGVGLGGGSGLGGGGGGLG 40 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 552 PEPPSPRHPPSPPPLRSPPRQP 573 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 549 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 579 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 546 PAPPSPPEPPSPRHPPSPPP 565 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 560 PPSPPPLRSPPRQPTPPPSP 579 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 561 PSPPPLRSPPRQPTPPPSPSQQPPLP 586 >08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287, 1648392-1648573,1648649-1648780,1648900-1649856, 1649949-1650734 Length = 798 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPX--LALSXPXXPPPPPXP 743 PPP P P + P A + P PPPPP P Sbjct: 487 PPPRPSVSVPHSGPSNGSAANPPKPPPPPPPP 518 >07_03_1751 - 29215074-29216270 Length = 398 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGGGG G Sbjct: 211 GGGGLGGGAGGGAGGGGGLG 230 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G GGGGG G Sbjct: 225 GGGGLGGGAGGGHGGGGGLG 244 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 256 GAGGGAGAGGGLGAGGGAGGGG 277 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG V GG G GGGGG G Sbjct: 331 GGKGGGVGGGAGGGFGGGGGAG 352 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 118 GKGGGLGGGGGLGGGGGGGAGG 139 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -1 Query: 603 GGXGXGGKGGX---XGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG GGKGG GG GGG G G K G G G Sbjct: 290 GGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFGGG 332 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG V GG G GGGGG G Sbjct: 197 GGAGVGGGAGGGAGGGGGLG 216 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 288 GAGGGFGGGKGGGFGGGGGGGG 309 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GGG G GGG G G Sbjct: 125 GGGGLGGGGGGGAGGGLGGG 144 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 208 GAGGGGGLGGGAGGGAGGGG 227 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GG G G GGG G Sbjct: 275 GGGGIGGGAGGGAGAGGGFG 294 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 300 GFGGGGGGGGGAGAGGGFGGGKG 322 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG GGKGG GG GG G GA G G G Sbjct: 326 GGGFGGGKGGGVGGGAGGGFGG-GGGAGAGGGFGGGKGGG 364 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 152 GVGGGAGAGGGAGGGGGLGGGAG 174 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 194 GAGGGAGVGGGAGGGAGGGG 213 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 374 GAGGGGAGGGGGFGGGAGGGIG 395 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -1 Query: 603 GGXGXG---GKGGXXG-GXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G GKGG G G GGG G G G + G G Sbjct: 47 GGVGIGFGGGKGGGVGVGGGGGFGGGAGGGLGHGGGIGGGFGGG 90 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 56 GKGGGVGVGGGGGFGGGAGG 75 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 94 GLGGGVGVGGGIGHGGGVGGGFG 116 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G GGG G GGGGG Sbjct: 116 GGGKGGGLGGGGGLGGGGGG 135 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 131 GGGGGGAGGGLGGGAGGGAGAG 152 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GG GG G Sbjct: 146 GGGAGAGVGGGAGAGGGAGGGG 167 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 158 GAGGGAGGGGGLGGGAGGGAGG 179 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GG GG G Sbjct: 168 GLGGGAGGGAGGGLGGGSGGGG 189 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GG G GGGGG G Sbjct: 171 GGAGGGAGGGLGGGSGGGGGLG 192 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 204 GAGGGAGGGGGLGGGAGGGAGG 225 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 340 GAGGGFGGGGGAGAGGGFGGGKG 362 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 124 GGGGGLGGGGGGGAGGGLGGGAG 146 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG GG GG GGG G G G G G Sbjct: 179 GGLG-GGSGG-GGGLGGGAGGGAGVGGGAGGGAGGGGGLG 216 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 262 GAGGGLGAGGGAGGGGGIGGGAG 284 >07_03_0906 + 22481456-22481802,22482105-22482186,22482299-22482400, 22483005-22483315,22483948-22484044,22484522-22484696, 22485074-22485150,22485632-22486027,22486254-22486303, 22487315-22487382,22488142-22488701 Length = 754 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP +P A+ PPPP P Sbjct: 31 PPPLQPKPPPHPQQPPQAVVSVGVGPPPPTP 61 >06_03_1506 + 30641428-30642168 Length = 246 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 167 GSGGGVNGGGGSGGGGGGGG 186 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G G G+ GGG G GGGGG Sbjct: 94 GYGSGNGGGGGGGYGGGGGG 113 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 202 GYGGGP--GGGGGGAGGGGGGG 221 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GG G GGGGG G Sbjct: 165 GYGSGGGVNGGGGSGGGGGGGG 186 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G V GGG G GG G G Sbjct: 61 GFGNGGVGGGGYGGGGGYGSGG 82 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G G GG G GGG G G G G G Sbjct: 110 GGGGSYGSGGMGSGYGGGYGSGYDYGGQGGGGGHGGGGGG 149 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG G GG G G G G G G G Sbjct: 144 GGGGGGGSGYGNGGYGSGFGEGYGSGGGVNGGGGSGGGGG 183 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP T + PP PP P Sbjct: 19 PPPPPP--PPPGTSLYASYRHHAYPPHPPPP 47 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPP PPPP PPP T Sbjct: 10 PPPHSSYAAPPPPPPPPPGT 29 >06_03_0429 - 20701107-20701534,20701628-20701847 Length = 215 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P P P SP P Sbjct: 162 PPPPPPPPSPSPSPSPAP 179 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP 968 P PPPPP P P P +P Sbjct: 162 PPPPPPPPSPSPSPSPAP 179 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P +P A++ PPPPP P Sbjct: 139 PSPAPAPAASPIAKPPAAVTAATPPPPPPPP 169 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 118 GYGGGGYEGYGRGYGGGGGGGG 139 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 95 GYGGG--YGGGYGGGGGGGGYG 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 99 GYGGGYGGGGGGGGYGGYGGYG 120 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG GGGGG Sbjct: 139 GYGGGGYPGGGYYGGGGGGG 158 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = -3 Query: 979 GXGGGDVXGG---GXGXXGGGGGXG 914 G GGG GG G G GGGGG G Sbjct: 134 GGGGGGYGGGGYPGGGYYGGGGGGG 158 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 568 PAPPSPPEPPSPRHPPSPPP 587 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXL-ALSXPXXPPPP 734 P P PPPS P L AL P PPPP Sbjct: 254 PQPQHQAPPPSHPPALPALPAPNAPPPP 281 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP-XLALS-XPXXPPPPPXP 743 PPPP P PPS P L S PP PP P Sbjct: 278 PPPPAPQSQPPSQFPGHLPHSQVQSVPPAPPTP 310 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 574 PEPPSPRHPPSPPPLRSPPRQP 595 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 582 PPSPPPLRSPPRQPTPPPSP 601 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 583 PSPPPLRSPPRQPTPPPSPSQQPPLP 608 >04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463, 8711553-8711634,8711909-8712100 Length = 935 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 487 PEPPSPRHQPSPPPLRSPPRQP 508 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P S P P PPP P Sbjct: 484 PSPPEPPSPRHQPSPPPLRSPPRQPTPPPSP 514 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 481 PAPPSPPEPPSPRHQPSPPP 500 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 496 PSPPPLRSPPRQPTPPPSPSQQPPLP 521 >04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527, 4797608-4797859,4797945-4800115 Length = 935 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P P PPP SPP P Sbjct: 487 PEPPSPRHPPSPPPLRSPPRQP 508 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPP----PSTRPXLALSXPXXPPPPPXP 743 P PP P PP P + P L S P P PPP P Sbjct: 481 PAPPSPPEPPSPRHPPSPPPLR-SPPRQPTPPPSP 514 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP PP P P SPPP Sbjct: 481 PAPPSPPEPPSPRHPPSPPP 500 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PP PP PP +PPP P Sbjct: 495 PPSPPPLRSPPRQPTPPPSP 514 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTS-PPPXP 980 P PPP PP P PPP S PP P Sbjct: 496 PSPPPLRSPPRQPTPPPSPSQQPPLP 521 >03_06_0467 + 34145126-34145187,34145403-34145759,34146161-34146248, 34146361-34146506,34146892-34146936,34147030-34147133, 34147225-34147361,34147651-34147761,34148455-34148664 Length = 419 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPP 971 LPPPPP P P P PP Sbjct: 76 LPPPPPAAPSPAPAWQPP 93 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 661 GGGGGGYGGGGGGYGGGGYGGG 682 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 668 GGGGGGYGGGGYGGGGGYGGGYG 690 >03_05_0252 - 22403504-22404676 Length = 390 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G V GGG G GGGGG G Sbjct: 7 GGGGRAGRVGGGGGGGAGGGGGGG 30 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+ G GG GGG G G Sbjct: 5 GGGGGGRAGRVGGGGGGGAGGGGGG 29 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 16 GGGG--GGGAGGGGGGGGGG 33 >03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539, 1178179-1178378,1178505-1178605,1178747-1179369, 1179451-1179546,1179637-1179798,1179889-1180068, 1180173-1180323,1180408-1180641,1180753-1180913, 1181041-1181163,1181261-1181421,1181655-1181877, 1181952-1182346,1182461-1182671,1183536-1184522 Length = 1883 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P P PP Sbjct: 75 PAPPPPPPPPLPEPVPVAPP 94 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PPP P PPP + PPP Sbjct: 283 PTPHPPPSSP-PPPMSPPPP 301 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 P P P + PPPP PPP Sbjct: 283 PTPHPPPSSPPPPMSPPP 300 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,063,659 Number of Sequences: 37544 Number of extensions: 449293 Number of successful extensions: 31048 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19694 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2858396560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -