BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A07 (981 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 43 3e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.001 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 38 0.009 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 38 0.012 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 37 0.029 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 36 0.038 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.038 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 35 0.088 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 35 0.088 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 35 0.12 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 35 0.12 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.12 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 34 0.15 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 34 0.20 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 34 0.20 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 34 0.20 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 34 0.20 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 34 0.20 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.20 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 34 0.20 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 34 0.20 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 34 0.20 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 34 0.20 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 34 0.20 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 34 0.20 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 33 0.27 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.27 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.35 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.35 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.35 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 33 0.35 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 33 0.35 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 33 0.35 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 33 0.35 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.47 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 33 0.47 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 32 0.82 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 32 0.82 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 32 0.82 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 31 1.4 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 31 1.4 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 31 1.4 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 31 1.4 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 31 1.4 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 1.4 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 1.4 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 1.9 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 30 2.5 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 30 2.5 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 30 2.5 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 2.5 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 30 2.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.5 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 30 2.5 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.5 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 30 2.5 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.5 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 30 2.5 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 30 2.5 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 30 3.3 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 3.3 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 30 3.3 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 30 3.3 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 30 3.3 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 4.4 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 29 4.4 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 4.4 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 4.4 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 4.4 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 29 4.4 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 4.4 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 29 5.8 SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) 29 5.8 SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) 29 7.6 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 29 7.6 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 29 7.6 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 29 7.6 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 29 7.6 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 7.6 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 7.6 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P A P PPPPP P Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP +P P PPPPP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + P P PPPPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPPS P P PPPPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPP 424 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPP 399 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPP 408 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPP 414 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 404 PPPPPPPPPPPPPPPAPPPPPP 425 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPP 401 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPP 416 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPP 417 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPP 418 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAP 420 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPP 426 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 411 PPPPPPPPAPPPPPPPPPPPPP 432 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPP + P P PPPPP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P P PPPPP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P P PPPPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP SPPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPP 393 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P P PPPPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPP 384 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPP P P PPPPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 37.1 bits (82), Expect = 0.022 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPP 386 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P S P P PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 36.3 bits (80), Expect = 0.038 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 + PPPP P PPP + PPP P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPP 383 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPP 386 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPP 387 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSP 389 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPP 390 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPP 391 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PPP P PPP PPP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQP 395 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPP 400 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPP 402 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP PPP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPP 405 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPP 407 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP PPP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPP 410 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP PPP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPP 411 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PPP P PPP PPP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPP 412 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPP 413 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPP 421 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPP 422 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPP 423 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPP 427 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPP 428 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPP 429 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 410 PPPPPPPPPAPPPPPPPPPPPP 431 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P PPPPP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P P PPP P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P P PPP P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPP 403 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PP PPP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPP 404 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP 728 PPP P PPP P AL PP Sbjct: 416 PPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP 485 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPP 486 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPP 487 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFP 489 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPP 493 Score = 39.1 bits (87), Expect = 0.005 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 473 PPPPPPPPPPPPPPPFPPPPPP 494 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P P PPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPPP P Sbjct: 464 PPPPPPPPPPPPPPP-----PPPPPPPPPFP 489 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPP 492 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTP 496 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + P S P PPPPP P Sbjct: 1157 PPPPPPPPPPPPSSP----SPPPPPPPPPPP 1183 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 1162 PPPPPPPSSPSPPPPPPPPPPP 1183 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/22 (63%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +3 Query: 918 LPPPPPXXPXPPPXT-SPPPXP 980 +PPPPP P PPP + SPPP P Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPP 1177 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP S P P PPPPP P Sbjct: 1159 PPPPPPPPPPSSPSPP---PPPPPPPPPPTP 1186 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPP--PXXPXPPPXTSPPPXP 980 P PPPP P P PPP PPP P Sbjct: 1163 PPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP P P P T+ Sbjct: 1173 PPPPPPPPPPPPTPTTT 1189 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P T PPP P Sbjct: 690 PPPPPPPPPPPPQPSTPPPPPP 711 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP S PP P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPP 709 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 684 PPPPPPPPPPPPPPPPPPQP 703 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP ++PPP P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPP 710 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P S P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.9 bits (79), Expect = 0.050 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +PPPPP P PPP PPP Sbjct: 682 VPPPPPPPPPPPPPPPPPP 700 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P PPPPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 35.1 bits (77), Expect = 0.088 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PPP PPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPP 701 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPP PPPP PPP Sbjct: 680 TMVPPPPPPPPPPPPPPPPP 699 Score = 32.7 bits (71), Expect = 0.47 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPP P P PPP ++PP Sbjct: 697 PPPPPQPSTPPPPPPSTPP 715 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP T PPPP PP Sbjct: 698 PPPPQPSTPPPPPPSTPP 715 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP P P PPP T Sbjct: 694 PPPPPPPPQPSTPPPPPPST 713 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPP P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P P PPPP P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 37.1 bits (82), Expect = 0.022 Identities = 29/114 (25%), Positives = 30/114 (26%), Gaps = 4/114 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP--PXPXXXXXXXXXXXXXXXXXXXXXXXXXXX 824 PPPP P PPP P P PPPP P P Sbjct: 95 PPPPYPPYPPPPPYP--PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 825 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPP--PPPXXPXPPPXTSPPPXP 980 P PP PPP P PPP +P P P Sbjct: 153 NPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 36.3 bits (80), Expect = 0.038 Identities = 28/112 (25%), Positives = 29/112 (25%), Gaps = 2/112 (1%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP-PPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 827 PPPP P PPP P P P PPPP P Sbjct: 125 PPPPNPPYPPPPNAPY--PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Query: 828 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSP-PPXP 980 P PP P P PPP +P PP P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPP P PPP PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPPP 111 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPP-PXXPXPPPXTSPPPXP 980 P PPPP P P PPP PP P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPP 115 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPP 737 P PP P P PP P A + P PPP P Sbjct: 210 PYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P + S P PPPPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPP-PSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P P PPPPP P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 36.7 bits (81), Expect = 0.029 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P PPP P Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPP 234 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PP PP P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PPP P + P PPPP P Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 35.1 bits (77), Expect = 0.088 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP SPP P Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPP 230 Score = 34.7 bits (76), Expect = 0.12 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP PPP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSP 224 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 204 PPPPP--PRPPPSPPPPPPP 221 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP-PPXP 980 P P PPP P PPP SP PP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRP 229 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP P PP PPP Sbjct: 202 TQPPPPPPRPPPSPPPPPPP 221 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSP 237 Score = 32.7 bits (71), Expect = 0.47 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP-XLALSXPXXPPPPPXP 743 P PP P PPP + P LA P PP P P Sbjct: 224 PSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXP---PPXTSPPPXP 980 P P PPP P P PP PPP P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 915 PLPPPP---PXXPXPPPXTSPP 971 P PPPP P P PPP SPP Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPP 238 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPP----PXTSPPPXP 980 P PPPPP P PP P PP P Sbjct: 215 PPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P P P Sbjct: 229 PPPPPPPSPPRPLAAKLPEPPP 250 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP T PPPP PPP Sbjct: 122 PPPPPTGTLPPPPVTPPP 139 Score = 36.3 bits (80), Expect = 0.038 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP PPP +PPP P Sbjct: 121 VPPPPPTGTLPPPPVTPPPGP 141 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P P PPPP P Sbjct: 123 PPPPTGTLPPPPVTPP---PGPETPPPPDTP 150 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPPP P P P T PPP Sbjct: 131 PPPPVTPPPGPETPPPP 147 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+ PPP PPP T PP P Sbjct: 134 PVTPPPGPETPPPPDTPAPPVP 155 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/24 (50%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPP--PXTSPPPXP 980 P PPPP P PP P +PP P Sbjct: 141 PETPPPPDTPAPPVPPTEAPPTAP 164 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 36.7 bits (81), Expect = 0.029 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GGGGG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGG 800 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGGGG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGG 791 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGD GGG G GGGGG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGG 794 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGG 798 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDG 804 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD GGG G GGGGG G Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDG 827 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGG 866 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGG 868 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGG 869 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGG 870 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGG 871 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGG 872 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 852 GGGGGGGGGGGGGGGGGGGGGG 873 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 853 GGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 854 GGGGGGGGGGGGGGGGGGGGGG 875 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 855 GGGGGGGGGGGGGGGGGGGGGG 876 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD G G G GGGGG G Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGG 819 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD GGG G GGGGG G Sbjct: 804 GGGYGDGDGGGGGGGGGGGGGG 825 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGGG--DVXGGGXGXXGGGGGXG 914 G GGG D GGG G GGGGG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGG 860 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GD GGG G GGGGG G Sbjct: 841 GYADGDGGGGGGGGGGGGGGGG 862 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGG 806 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYG 808 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGG 817 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYG 831 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDG 810 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 802 GDGGGYGDGDGGGGGGGGGGGG 823 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDG 833 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PPP PPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPP 883 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP +S P Sbjct: 872 PPPPPPPPPPPPPPASSTGSTP 893 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPP P P PPPPP P Sbjct: 860 PRPRPRRPPPPPPP----PPPPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 870 PPPPPPPPPPPPP--PPP 885 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP P PPP S Sbjct: 871 PPPPPPPPPPPPPPPAS 887 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P P P P PPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPP 879 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P PPPPP Sbjct: 867 PPPPPPPPPPP----------PPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P P P PPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 36.3 bits (80), Expect = 0.038 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L+ + P PPPPP P Sbjct: 694 PPPPPP--PPP---PLLSGTLPMPPPPPPPP 719 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP P PPP L + P PPPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + PPPPP P Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP +LS P PPPPP P Sbjct: 677 PPPP----PPLPVIEGSSLSVPPPPPPPPPP 703 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P+PPPPP P PPP SP P Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LP PPP P PP PP P Sbjct: 709 LPMPPPPPPPPPGCAGLPPPP 729 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PPP P Sbjct: 739 LPPPPPPPPPGCAGLPPPPPP 759 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PPP T Sbjct: 103 PPPPPPPPPPPPPPPPPPIT 122 Score = 35.5 bits (78), Expect = 0.066 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP PPP Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 35.1 bits (77), Expect = 0.088 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PPP PPP P Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 10/41 (24%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL----------SXPXXPPPPPXP 743 PPPP P PPP P + L P PPPPP P Sbjct: 105 PPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPP 145 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT 962 P PPPPP P PPP T Sbjct: 107 PPPPPPPPPPPPPPIT 122 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P PPPPP Sbjct: 102 PPPPPPPPPPP----------PPPPPPPP 120 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP PPP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPP 114 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PP Sbjct: 139 PPPPPPPPAPCMPP 152 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 933 PXXPXPPPXTSPPP 974 P P P P +PPP Sbjct: 168 PPGPPPAPMPAPPP 181 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.3 bits (80), Expect = 0.038 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPP 325 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P PPPPP P Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 33.5 bits (73), Expect = 0.27 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PP PPP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPP 323 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P +PPP P Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPP 335 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 7/29 (24%) Frame = +3 Query: 915 PLPPPPP-------XXPXPPPXTSPPPXP 980 P+PPPPP P PPP +PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPP 318 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P + P PPPPP P Sbjct: 294 PPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P PPPPP P Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P PPPP P Sbjct: 306 PPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P+ P PPPPP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPP 322 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 315 PPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP + P PP PPP Sbjct: 293 PPPPADGSAPAPPPPPPP 310 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPP 337 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.9 bits (79), Expect = 0.050 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP +S P P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.066 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP PPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALS 710 PPPP P PPPS+ P L+ Sbjct: 61 PPPPPPPPPPPSSSPSRPLT 80 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP 725 PPPP P PPP P S P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPP-PXXPXPPPXTSPPPXP 980 P PPPP P P PPP PPP P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPP 928 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P + P PP PP P Sbjct: 951 PPPPTSALPPPI--PATQVPPPPLPPLPPPP 979 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +2 Query: 914 TXPPPPPXXTXP-PPPXIPPP 973 T PPPP P PPP +PPP Sbjct: 905 TPAPPPPLPLAPEPPPPLPPP 925 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 8/37 (21%) Frame = +3 Query: 651 PPPPXPXXPPP--STRPXLAL------SXPXXPPPPP 737 PPPP P PPP +TRP + S PPPP Sbjct: 918 PPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPP 954 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P P LA P PPPP P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLPPPP PPP PPP P Sbjct: 972 PLPPPPGGSAPPPPPPPPPPPP 993 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PP P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLP 974 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 5/27 (18%) Frame = +3 Query: 915 PLPPPP-----PXXPXPPPXTSPPPXP 980 PLPPPP P P PP +PPP P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 32.3 bits (70), Expect = 0.62 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPS-----TRPXLALSXPXXPPPPPXP 743 PPPP PPP P S P PPPPP P Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP PPP P Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPP 992 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PP P + P PPPPP P Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P P P S P PPPP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP P PS P + P PPPP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP PPP P + P PP PP P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 945 PPPPGGNAPPPP--PPP 959 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGGGG G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMG 1818 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMG 1781 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG+GG GG GGG Sbjct: 1829 GGMGAGGEGGGAGGGGGG 1846 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + GGG G GGG G Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMG 1832 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG + GGG G GGG G G Sbjct: 1806 GGGGMGGGGGGMGGGGEGMG 1825 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PPPS P + S PPPPP Sbjct: 280 PPPPP--PPPSNTPGMFASSGFQPPPPP 305 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP +T A S PPPPP Sbjct: 280 PPPPPP--PPSNTPGMFASSGFQPPPPPP 306 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP PP P P PPPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L PPPPP P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSEL-----PPPPPPP 329 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP T PP PPP Sbjct: 312 PPPPPEPTSELPPPPPPP 329 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP P PPP P L L+ P PPP Sbjct: 195 PPPPPPPPPPPPPPPILELAAP--PPP 219 Score = 34.7 bits (76), Expect = 0.12 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPP P PPP PPP P Sbjct: 188 PPPPSGGPPPPPPPPPPPPP 207 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT-SPPPXP 980 P PPPPP P P SPPP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPP 130 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 4/24 (16%) Frame = +3 Query: 915 PLPPPPPXXPXPPP----XTSPPP 974 P PPPPP P PPP +PPP Sbjct: 195 PPPPPPPPPPPPPPPILELAAPPP 218 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 189 PPPSGGPPPPPPPPPPPPPP 208 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXXPP---PSTRPXLALSXPXXPPPPP 737 PPPP P P P P +A + PPPPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 29.9 bits (64), Expect = 3.3 Identities = 23/105 (21%), Positives = 23/105 (21%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 845 P PPP P P PPPP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 846 XXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP---PPPPP 209 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P P P +A + PPPPP Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P P +T P A+ PPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPP 191 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P PPPPP P Sbjct: 188 PPPPSGGPPPPP---------PPPPPPPPPP 209 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P + PP P Sbjct: 198 PPPPPPPPPPPPILELAAPPPP 219 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 34.7 bits (76), Expect = 0.12 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PP P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG V GGG G GGGGG G Sbjct: 340 GGGGVTGGGGGATGGGGGPG 359 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 242 GGGGATGGGGGATGGGGG 259 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 249 GGGGATGGGGGATGGGGG 266 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 256 GGGGATGGGGGATGGGGG 273 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 263 GGGGATGGGGGATGGGGG 280 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 270 GGGGATGGGGGATGGGGG 287 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 277 GGGGATGGGGGATGGGGG 294 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 284 GGGGATGGGGGATGGGGG 301 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 291 GGGGATGGGGGATGGGGG 308 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 319 GGGGATGGGVGATGGGGG 336 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 333 GGGGATGGGGGVTGGGGG 350 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 248 GGGGGATGGGGGATGGGGGATG 269 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 255 GGGGGATGGGGGATGGGGGATG 276 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 262 GGGGGATGGGGGATGGGGGATG 283 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 269 GGGGGATGGGGGATGGGGGATG 290 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 276 GGGGGATGGGGGATGGGGGATG 297 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 283 GGGGGATGGGGGATGGGGGATG 304 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 290 GGGGGATGGGGGATGGGGGATG 311 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGGD GGG G GGGGG G Sbjct: 89 GGGDGGGGGGGGDGGGGGGG 108 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGG 83 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GGGGG G Sbjct: 79 GGGGGDDGDGGGGDGGGGGGGG 100 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDG 86 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGG 99 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 86 GDGGGGDGGGGGGGGDGGGGGG 107 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 88 GGGGDGGGGGGGGDGGGGGGGG 109 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 90 GGDGGGGGGGGDGGGGGGGGGG 111 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 91 GDGGGGGGGGDGGGGGGGGGGG 112 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 93 GGGGGGGGDGGGGGGGGGGGVG 114 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG-GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDG 93 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGG 116 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGG 117 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 89 GGGGFGGGGGGGFGGGGGGG 108 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 88 GGGGGFGGGGGGGFGGGGGG 107 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 103 GGGGGGFGGGGGGGGGFGGGGG 124 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGG 107 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 94 GGGGGGGFGGGGGGGFGGGGGG 115 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 102 GGGGGGGFGGGGGGGGGFGGGG 123 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 105 GGGGFGGGGGGGGGFGGGGGGG 126 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 108 GFGGGGGGGGGFG-GGGGGGFG 128 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGG 103 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 104 GGGGGFGGGGGGGGGFGGGGGG 125 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP+ +P PPPPP P Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXX---PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXX---PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP+ P PPPPP P Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP+ P PPPPP P Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 921 PPPPPXX---PXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPP 388 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP T P PPPP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXX-PXPPPXTSPPPXP 980 P PPPP P PPP T+ PP P Sbjct: 355 PSPPPPTNNTPPPPPPTNKPPPP 377 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP---PPPPXP 743 PPPP PPP P P P PPPP P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP---PPPXP 743 PPP P PPS P + P PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 31.9 bits (69), Expect = 0.82 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP---PPPXP 743 PPPP P PP P P PP PPP P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 14/22 (63%), Gaps = 2/22 (9%) Frame = +3 Query: 915 PLPPPPPXX--PXPPPXTSPPP 974 P PPPPP P PPP T+ PP Sbjct: 394 PPPPPPPTNGPPPPPPPTNGPP 415 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PPP PPP T Sbjct: 394 PPPPPPPTNGPPP--PPPPT 411 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 4/24 (16%) Frame = +3 Query: 921 PPPPPX--XPXPPPXT--SPPPXP 980 PPPPP P PPP T +PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPP 369 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPX---TSPPPXP 980 P PPPP P PPP PPP P Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPX---TSPPPXP 980 P PPPP P PPP PPP P Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP + PP P Sbjct: 75 PAPPPPP----PPPSSGPPLPP 92 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PPP PPP Sbjct: 79 PFPPPPPIYMPPPPVYMPPP 98 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP PPP PPP P Sbjct: 89 PPPPVYMPPPPVYMPPPMP 107 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGG 153 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGG 154 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGG 155 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGG 156 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGG 157 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGG 158 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGG 159 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGG 160 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 140 GGGGGGGGGGGGGGGGGGGGGG 161 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 141 GGGGGGGGGGGGGGGGGGGGGG 162 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 142 GGGGGGGGGGGGGGGGGGGGGG 163 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 143 GGGGGGGGGGGGGGGGGGGGGG 164 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 144 GGGGGGGGGGGGGGGGGGGGGG 165 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 145 GGGGGGGGGGGGGGGGGGGGGG 166 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 147 GGGGGGGGGGGGGGGGGGGGDG 168 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P+PPPPP PPP T PPP Sbjct: 461 PIPPPPPM--SPPPPTPPPP 478 Score = 32.3 bits (70), Expect = 0.62 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 P PPP PPPP PPP T Sbjct: 461 PIPPPPPMSPPPPTPPPPAT 480 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPP 91 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP + P Sbjct: 79 PPPPPPPPPPPPPPPGAKKP 98 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PL PPP P PPP PPP P Sbjct: 75 PLCAPPPPPPPPPP---PPPPP 93 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPP 92 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGG 104 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGGD GGG GGGGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGG 93 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGG 101 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG V GGG G GGGGG Sbjct: 88 GGGGGGVGGGGGG--GGGGG 105 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G GGG GGG G GGGG Sbjct: 87 GGGGGGGVGGGGGGGGGGG 105 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD GGG G GGGGG G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGG 323 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GGGG G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGG 329 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 306 GDGGGGGDGGGGGGGGGGGG 325 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG GG GG GGG G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDG 328 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 315 GGGGGGGGGGGGDGGGDGDG 334 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GGGG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGG 110 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD GGG G GGGG G Sbjct: 83 GGGDGDGGGGGDGDGGGGGDGG 104 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 75 GDGGGCDGGGGDG-DGGGGGDG 95 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PP P P PPP PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP P PPP S Sbjct: 68 PPPPPPPPPPLPPPPPS 84 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PPP PPP P Sbjct: 59 PTVPIPPTLP-PPPPPPPPPLP 79 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGG 74 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGG 75 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGG 76 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 56 GGGGGGGGGGGGGGGGGGGGGG 77 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 58 GGGGGGGGGGGGGGGGGGGGDG 79 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPP 292 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP + P Sbjct: 280 PPPPPPPPPPPPPPPGAKKP 299 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PL PPP P PPP PPP P Sbjct: 276 PLCAPPPPPPPPPP---PPPPP 294 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPP 293 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PP P P PPP PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTS 965 P PPPPP P PPP S Sbjct: 292 PPPPPPPPPPLPPPPPS 308 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P PPP PPP P Sbjct: 283 PTVPIPPTLP-PPPPPPPPPLP 303 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GGG G GGGG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGG 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD GGG G GGGG G Sbjct: 98 GGGDGDGGGGGDGDGGGGGDGG 119 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 90 GDGGGCDGGGGDG-DGGGGGDG 110 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXX-PXPPPXTSPPPXP 980 P PPPP P PPP +PPP P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPP 245 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 P PP P P P P A + P PPPPP Sbjct: 223 PTPPPPAAPAPPPPP--AAAPPPPPPPPP 249 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 231 PAPPPPPAAAPPPP---PPPPP 249 Score = 32.3 bits (70), Expect = 0.62 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPPP PP Sbjct: 233 PPPPPAAAPPPPPPPPP 249 Score = 32.3 bits (70), Expect = 0.62 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 233 PPPPPAAAPPPPPPPPP 249 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PP P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 1308 PESPPPP--PPPPPPPPPPPLP 1327 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 930 PPXXPXPPPXTSPPPXP 980 PP P PPP PPP P Sbjct: 1307 PPESPPPPPPPPPPPPP 1323 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 + PP P PPP PPP P Sbjct: 1305 IQPPESPPPPPPPPPPPPPPP 1325 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRG 361 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 346 GGGGGGGGGGGGGGRGGGGG 365 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGG 359 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGG 363 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGG 364 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 344 GGGGGGGGGGGGGGGGRGGGGG 365 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGG 355 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGG 356 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGG 681 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGG 683 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGG 684 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGG 685 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGG 686 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGG 687 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGG 688 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGG 689 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGG 690 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGG 691 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGG 692 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGG 693 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGG 694 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGG 695 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGG 696 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGG 697 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 677 GGGGGGGGGGGGGGGGGGGGGG 698 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGG 699 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGG 700 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 682 GGGGGGGGGGGGGGGGGGGGAG 703 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GGD GGG G GGGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGG 677 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 683 GGGGGGGGGGGGGGGGGGGAGG 704 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 685 GGGGGGGGGGGGGGGGGAGGAG 706 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGG 678 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGG 680 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG G G Sbjct: 687 GGGGGGGGGGGGGGGAGGAGAG 708 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 689 GGGGGGGGGGGGGAGGAGAGAG 710 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PP P + P PPPPP P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLP 318 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P L PPPPP P Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P S+ P + P PPPPP P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPP P PPP P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP PPPP P P Sbjct: 28 TPPPPPPYEAPPPPPGPPGP 47 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP P P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGP 50 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP +P P PP PP Sbjct: 87 PPPPLPAPPPPPAQPA-----PQPPPAPP 110 Score = 32.7 bits (71), Expect = 0.47 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPPP P P P +PP Sbjct: 92 PAPPPPPAQPAPQPPPAPP 110 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P+ P A + P PPPP P Sbjct: 52 PPPPSPPAAAPAAPPPPAAA-PAAPPPPAAP 81 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P A P P PP P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 32.3 bits (70), Expect = 0.62 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP PPP P P P Sbjct: 86 PPPPPLPAPPPPPAQPAPQP 105 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPP--PPPXXPXPPPXTSPPPXP 980 P PP PP P PPP +PPP P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPP--PXTSPPPXP 980 P PPP P P PP P PPP P Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP--PPPXP 743 PP P PPP A P PP PPP P Sbjct: 57 PPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P P PPP Sbjct: 51 PPPPPSPPAAAPAAPPPP 68 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PP + P L P PP P P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP P + P PPP P Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP P PPP P A S P PPP Sbjct: 2 PPPPPPPGPPP---PPSAPSGPVKPPP 25 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP S P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKP 23 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P PPP S P P Sbjct: 1 MPPPPPP-PGPPPPPSAPSGP 20 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL--SXPXXPPPPP 737 PPPP PPP LA S PPPPP Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 170 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPS-TRPXLALSXPXXPPPPPXP 743 PPPP PPPS +P S PPP P Sbjct: 167 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 198 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTR-----PXLALSXPXXPPPPPXP 743 PPPP PP STR P P PPPP P Sbjct: 341 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPX--------PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP RP S PPPPP P Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRPP---SGKINPPPPPPP 393 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 915 PLPPPP---PXXPXPPPXTSPP 971 PLPPPP P PPP + PP Sbjct: 329 PLPPPPLRGQIAPPPPPISKPP 350 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 77 GGGGFSGGGGGSMGGGGLGG 96 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPX---TSPPPXP 980 PLPP P PPP T PPP P Sbjct: 299 PLPPSRDQAPAPPPPLNATPPPPPP 323 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PP T+PP P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPP 207 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPP 737 P PP P P PP+ LA P PP PP Sbjct: 272 PAPPNPSIPAPPNPSIPLAPPNPYIPPAPP 301 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXL--ALSXPXXPPPPPXP 743 P PP P P P P + A P PP PP P Sbjct: 204 PTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXL--ALSXPXXPPPPPXP 743 PP P PP + P + A P PP PP P Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSIPPAPPNP 277 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPPSTRPXL--ALSXPXXPPPPPXP 743 PP P PP P + A P PP PP P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXP--PPSTRPXLALSXPXXPPPPPXP 743 P PP P P PP+ A P PP PP P Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNP 348 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PPP P Sbjct: 164 PRTQPPPIFPIDPPRTQPPPIP 185 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PPP P Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIP 198 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PPP P Sbjct: 190 PRTQPPPIPPIDPPRTQPPPIP 211 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPP P PP T PPP Sbjct: 203 PRTQPPPIPPIDPPRTQPPP 222 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP + P + P PPP P Sbjct: 168 PPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP 198 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP + P + P PPP P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLA--LSXPXXPPPPPXP 743 PPP P PP T+P + P PPP P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLA--LSXPXXPPPPPXP 743 PPP P PP T+P + P PPP P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPP 731 PPP P PP T+P P P P Sbjct: 207 PPPIPPIDPPRTQPPPIFPQPTTPAP 232 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PP T Sbjct: 425 PPPPPPAPLPPPPPPPPQPT 444 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP P P T Sbjct: 426 PPPPPAPLPPPPPPPPQPTT 445 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 424 PPPPPPPA-PLPPP-PPPPPQP 443 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPP PPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP 728 PP P P PPP +P AL P P Sbjct: 429 PPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 PLPPPPP P P P T+ P Sbjct: 432 PLPPPPP--PPPQPTTALP 448 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP---XXPPPPPXP 743 PPPP P PP P + P PPPPP P Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXX-----PPPPPXP 743 PPPP PPP P + ++ P PPPPP P Sbjct: 338 PPPPSRGAPPP---PSMGMAPPPVGGAAPPPPPPPP 370 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP PPP PPP P Sbjct: 363 PPPPP----PPPVGGPPPPP 378 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PP PP P Sbjct: 374 PPPPPPPIEGRPPSSLGNPPPP 395 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/23 (52%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +3 Query: 921 PPPPPXX---PXPPPXTSPPPXP 980 PPPPP P PP +PPP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPP 309 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PPP PPP Sbjct: 363 PPPPPPPPVGGPPP--PPPP 380 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP PPP PP Sbjct: 364 PPPPPPPVGGPPPPPPP 380 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP +P S P PP PP P Sbjct: 1259 PPLPPLPPPDAQPP---SLPPQPPQPPQP 1284 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLPP PP PP PP P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQP 1281 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLPPP P PP PP P Sbjct: 1263 PLPPPDAQPPSLPPQPPQPPQP 1284 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 PLPPPP PPP SPP Sbjct: 722 PLPPPPEEVSLPPPDESPP 740 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP +A S P PPPP P Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPPPPP 707 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP A P PPPPP P Sbjct: 5 PPPPPP--PPPIAAEFTA---PPAPPPPPNP 30 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PP T P L PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PPP P Sbjct: 436 PTPPPTPPPTTLPPTTQPPPQP 457 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PPP P PP T+ PP Sbjct: 430 PPPTPPPTPPPTPPPTTLPP 449 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 32.3 bits (70), Expect = 0.62 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPP P PPP +PPP P Sbjct: 197 PPPSGAPPPPPIGAPPPPP 215 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 32.3 bits (70), Expect = 0.62 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 P PPP P PPP PPP Sbjct: 1062 PSPPPSEPAPPPRQPPPP 1079 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPP P + S P PP P P Sbjct: 1064 PPPSEPAPPPRQPPPPSTSQPVPPPRQPDP 1093 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP PPPS P P PP P P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAP 1071 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPP 1059 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PP + P P P Sbjct: 1069 PAPPPRQPPPPSTSQPVPPP 1088 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +P PPP P PPP PP Sbjct: 1054 VPIPPPRKPSPPPSEPAPP 1072 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 42 GGGGGGGGGGGGGGGGGGDG 61 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDG 63 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 41 GGGGGGGGGGGGGGGGGG 58 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPP 216 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 918 LPPPPPXXPXPP-PXTSPPPXP 980 +PPPPP P P P +PPP P Sbjct: 194 MPPPPPPPPPPGFPGGAPPPPP 215 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P P PPP Sbjct: 198 PPPPPPPGFPGGAPPPPPPP 217 Score = 29.1 bits (62), Expect = 5.8 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP---PPPP 737 PPPP P PPP P A P P PPPP Sbjct: 195 PPPPPP--PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPP 217 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 34 GYGGGPNGGGGGGGGGGGGG 53 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGG 49 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 603 GGXGXGG--KGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G GG GG GG GGG G + K G G Sbjct: 31 GGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 31.9 bits (69), Expect = 0.82 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 603 GGXGXGG-KGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG KGG GG GGG G G G G G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 31.9 bits (69), Expect = 0.82 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PPP P PPP + P P Sbjct: 944 PPPSPPPKEPTPPPSSKPSP 963 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PP PP P PPP PPP Sbjct: 33 PPLPPFAPLPPPVPPPPP 50 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 G G GG GG GG GGG G G C G G G Sbjct: 33 GVGGGGVGGG-GGNGGGAGNGVGAGGCGCGGGNDGGNGG 70 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GG+V GGG G GG GG G Sbjct: 96 GGNVGGGGSGGVGGNGGSG 114 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG+ G G G G GGG G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGG 80 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GGG G G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVG 54 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG GG GG G GGG GA G G Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVG 100 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG+ GGG G GGGGG G Sbjct: 63 GNDGGN-GGGGAGNGGGGGGAG 83 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PP P Sbjct: 1032 PTPPPTEPPTPPPTEPPTPP 1051 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PP T PP P Sbjct: 1040 PTPPPTEPPTPPPTDPPTQP 1059 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP+ P + P PPP P Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP P P P Sbjct: 1031 PPTPPPTEPPTPPPTEPPTPPP 1052 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLP PP P P T PP P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEP 1039 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PP +PP P Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTP 322 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPP P PP +PP Sbjct: 307 PQTPPPPQTPAPPQTPAPP 325 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PP PP P PPP PP P Sbjct: 1261 PMPPQPPFMP-PPPRMQPPGPP 1281 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P P P PP PP P Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP P + P PP PP P Sbjct: 1263 PPQPPFMPPP---PRMQPPGPPGPPGPPGP 1289 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P + PP PP P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P P PPPPP P Sbjct: 554 PPPPPPGVDIPPPLP--PSEDPKPPPPPPEP 582 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPP----PPXXPXPPPXTSPPPXP 980 PLPP PP P PP PPP P Sbjct: 566 PLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 148 GGGGATGGGGGATGGGGG 165 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GG GGG G GGGGG Sbjct: 55 GATGGGATGGGGGATGGGGG 74 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 91 GDGGGATGGGGGATGGGGGATG 112 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 147 GGGGGATGGGGGATGGGGGATG 168 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGAC 520 GG G GG G GG GGG G GAC Sbjct: 487 GGFGGGG-GASGGGGGGGGGGGFSGGAC 513 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GG G GGGGG Sbjct: 488 GFGGGGGASGGGGGGGGGGG 507 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 491 GGGGASGGGGGGGGGGGFSG 510 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP PP P PPP + P P Sbjct: 527 PSPPAPPPKPAPPPRSPPAAAP 548 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 P PP P PPP +PPP Sbjct: 524 PQPPSPPAPPPKPAPPP 540 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXP--PPPPXP 743 PPPP P PPP S P P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPP---XTSPPPXP 980 P PPPP P P P SPPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P + +P L P PP P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRP 166 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXP--XPPPXTSPPPXP 980 P PPPP P PPP T PP P Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGP 121 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPPPXP 980 P PPPP P PP P T PP P Sbjct: 107 PPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +3 Query: 924 PPPPXXPXPP--PXTSPPP 974 PPPP P PP P T PPP Sbjct: 95 PPPPATPPPPTMPPTPPPP 113 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP T P P P PP P Sbjct: 95 PPPPATPPPPTMP--PTPPPPQTPAPPGP 121 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGGG G Sbjct: 201 GYGGRGRGGGGRGGYGGGGGYG 222 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P P PPPPP P Sbjct: 179 PAPPPPGAPAAPPAPPFG-GPPSAPPPPPAP 208 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PP + P +A + P PPPP P Sbjct: 161 PPQPPAPPAA--PFMAPAAPPAPPPPGAP 187 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPP--PXXPXPPPXTSPPPXP 980 P PPPP P P PP PP P Sbjct: 179 PAPPPPGAPAAPPAPPFGGPPSAP 202 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 L PPPP P P SPPP P Sbjct: 1746 LLPPPPSHPPPSSLGSPPPSP 1766 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP P PP PPP Sbjct: 666 PPPPPGGGVPGPPKPPPP 683 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPP PPP Sbjct: 653 PPPPPGGGMFPPPPPPPP 670 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 651 PPPPXP--XXPPPSTRPXLALSXPXXPPPP 734 PPPP PPP P + P PPPP Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 107 GYGGGGGYGGGGRSYGGGGGGG 128 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 110 GGGGYGGGGRSYGGGGGGGG 129 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P T P L P PPPP P Sbjct: 343 PQPPTPTTP--KTHPQLGPPPPPPPPPPTPP 371 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 359 PPPPP----PPPPPTPPP 372 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 359 PPPPPPPPPPTPPP 372 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPP 971 L PPPP P PPP T PP Sbjct: 357 LGPPPP--PPPPPPTPPP 372 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPPPP T P P +PP Sbjct: 777 PPPPPPPTKPATPRVPP 793 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P P + P P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPPP 809 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P S PP P Sbjct: 807 PPPPPGKPTKPTKPSLPPVP 826 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNG 169 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWG 163 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 G G GG+GG GG GGG G Sbjct: 158 GEGGWGGRGGNGGGRGGGEGGG 179 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG+ GG G GGG G G Sbjct: 154 GRGGGEGGWGGRGGNGGGRGGG 175 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 660 PXPXXPPPSTRPXLALSXPXXPPPPP 737 P PPP P A + P PPPPP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPP 102 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P +PPP P Sbjct: 81 IPPPPPPPPPASNVPAPPPPP 101 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PP P Sbjct: 84 PPPPPPPASNVPAPPPPPPVMP 105 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PP P PPP T PPP Sbjct: 230 PKPPTAPPNTPPPPVTPPPP 249 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PP P T PPP PPP T Sbjct: 232 PPTAPPNTPPPPVTPPPPNT 251 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPP P PPP T PP Sbjct: 237 PNTPPPPVTP-PPPNTPGPP 255 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 970 GGDVXGGGXGXXGGGGGXG 914 GG GGG G GGGGG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYG 3716 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPP P PP T PPP Sbjct: 123 PTTVPPPVQPTEPPSTRPPP 142 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G +GG GG GGG G G G G G Sbjct: 101 GGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P + P PPPPP Sbjct: 679 PPPPLPGGAAPPPPPPIGGGAP--PPPPP 705 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + A P PPPPP P Sbjct: 660 PPPPPP--PPPGGQ---AGGAPP-PPPPPLP 684 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P + P PPPPP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL--SXPXXPPPPP 737 PPPP PPP LA S PPPPP Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPP 82 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPS-TRPXLALSXPXXPPPPPXP 743 PPPP PPPS +P S PPP P Sbjct: 79 PPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 110 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXPPPSTR-----PXLALSXPXXPPPPPXP 743 PPPP PP STR P P PPPP P Sbjct: 253 PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 8/36 (22%) Frame = +3 Query: 651 PPPPX--------PXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP RP P PPPP Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +3 Query: 915 PLPPPP---PXXPXPPPXTSPP 971 PLPPPP P PPP + PP Sbjct: 241 PLPPPPLRGQIAPPPPPISKPP 262 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPX---TSPPPXP 980 PLPP P PPP T PPP P Sbjct: 211 PLPPSRDQAPAPPPPLNATPPPPPP 235 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPP T+P + P PP P Sbjct: 40 PTPPSPNTPPPVTQPPVT-QPPVTQPPVTQP 69 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PPP T S P PPP P Sbjct: 25 PTPPKPDTPPPGTNIPTPPS-PNTPPPVTQP 54 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPPS P P P PP P Sbjct: 432 PPPLPQ-PPPSIIPPPTTPLPQTVPTPPRP 460 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 P PP PPP IPPP T Sbjct: 429 PSHPPPLPQPPPSIIPPPTT 448 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +P PP P PPP PPP Sbjct: 428 VPSHPPPLPQPPPSIIPPP 446 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG-GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHG 187 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG-GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 170 GYGGGGYGGGGYGGGGHGGGGYG 192 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXG-GGGGXG 914 G GGG GGG G G GGGG G Sbjct: 175 GYGGGGYGGGGHGGGGYGGGGYG 197 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGG 201 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 185 GHGGGGYGGGGYG--GGGGGYG 204 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G G G G Sbjct: 190 GYGGGGYGGGGGGYGGSGYGGG 211 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GG GG G Sbjct: 197 GGGGGGYGGSGYGGGGGYGGGG 218 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 164 PQPPPPPLPPPPPP 177 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP PP P Sbjct: 486 PFGPPPPFYRGPPPPRGMPPPP 507 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPP 973 PPPP PPP PPP Sbjct: 469 PPPPMGMYPPPRGFPPP 485 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPPP P PP PPP Sbjct: 483 PPPPFGPPPPFYRGPPP 499 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGG 89 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P P T+ PP P Sbjct: 217 PPPPPTTGAPPPTPVTNKPPPP 238 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 921 PPPPPXXPXPPPXT-SPPPXP 980 P PP P PPP T +PPP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTP 230 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 206 GYGGGRGGGGYGGGRGGGGGYG 227 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G +GG GG GGG G G Sbjct: 197 GGYGGSSRGGYGGGRGGGGYGGGRGG 222 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 1455 PPPPPPPAPPCPPP 1468 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPP P P PP +PPP P Sbjct: 870 LPPRPRTRPLPPKSDTPPPPP 890 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXXPPPST--RPXLALSXPXX--PPPPPXP 743 P PP P PPS RP P PPPPP P Sbjct: 858 PLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG G +GG GG GGG G G G Sbjct: 106 GGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 28.7 bits (61), Expect = 7.6 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRG 336 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG GGGGG Sbjct: 468 GYGGGSGYGGGSSSRGGGGG 487 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 211 PPPPPPPPPPPPPP 224 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP P P Sbjct: 794 PPPPPPPPPPPPEDLIIPLP 813 Score = 25.4 bits (53), Expect(2) = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 651 PPPPXPXXPPP 683 PPPP P PPP Sbjct: 794 PPPPPPPPPPP 804 Score = 22.6 bits (46), Expect(2) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 714 PXXPPPPPXP 743 P PPPPP P Sbjct: 796 PPPPPPPPPP 805 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.5 bits (63), Expect = 4.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPP P P PP + PP P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRP 1598 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP + L P P P P Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGP 1693 >SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) Length = 699 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 PLP PPP P + PPP P Sbjct: 383 PLPTPPPMSTHPEFTSKPPPPP 404 Score = 29.1 bits (62), Expect = 5.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP + PPP +P Sbjct: 400 PPPPPVASKPPPKPVP 415 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP 728 PPP P PPP P L P PP Sbjct: 179 PPPLNPYQPPPFPPPHLMYPQPTAPP 204 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 448 GDGGGGGDGGGDGIDGGDGGGDG 470 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGD-VXGGGXGXXGGGGGXG 914 G GGGD + GG G GGG G G Sbjct: 454 GDGGGDGIDGGDGGGDGGGDGGG 476 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +2 Query: 914 TXPPP---PPXXTXPPPPXIPP 970 T PPP PP PPPP +PP Sbjct: 153 TQPPPRHSPPQTPVPPPPPLPP 174 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P RP PPPPP P Sbjct: 756 PPPPPPAVPGEGARP---------PPPPPPP 777 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P PPP P Sbjct: 754 VPPPPPPPAVPGEGARPPPPP 774 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 29.5 bits (63), Expect = 4.4 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PPP P ++ S P PP P Sbjct: 170 PPPEILPPTAPPPQPAPAISPSAPAISPPAP 200 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 29.5 bits (63), Expect = 4.4 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXXPP--------PSTRPXLALSXPXXPPPPPXP 743 PPPP P P P T + P PPPPP P Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 >SB_37047| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 233 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP PPP R P PPP Sbjct: 124 PPPPGVFTPPPPYRTTAKPKGPTKKPPP 151 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGG G Sbjct: 18 GDSGGGSDGGGDGGDGGGGSDG 39 >SB_51714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPPPPXXPXPP-P--XTSPPP 974 P PPPPP P PP P +PPP Sbjct: 363 PTPPPPPHSPPPPLPVIQLNPPP 385 >SB_35620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 967 GDVXGGGXGXXGGGGGXG 914 G V GGG G GGGGG G Sbjct: 63 GCVHGGGGGGGGGGGGRG 80 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 654 PPPX---PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P L P PPPPP P Sbjct: 292 PPPFGGHPAAAPPP--PPLPAGVPAPPPPPPPP 322 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGG 780 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPX-TSPPPXP 980 PLPPPP P TSPPP P Sbjct: 145 PLPPPPAQQEAVPDIPTSPPPVP 167 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPP 974 PPP P PPP T+PPP Sbjct: 181 PPPTLP-PPPTTTPPP 195 >SB_653| Best HMM Match : Sas10_Utp3 (HMM E-Value=2.2) Length = 835 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P PPPP P PPP P Sbjct: 269 PTPPPPRASPEPPPDAEAP 287 >SB_56738| Best HMM Match : Extensin_2 (HMM E-Value=0.076) Length = 869 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 PPP P PPP PPP Sbjct: 71 PPPVFIPPPPPDDIPPP 87 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG V G G G GGGG G Sbjct: 230 GGGGVWGNGGGGGGGGGYSG 249 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD G G GG GG G Sbjct: 174 GSGGGDDGGDGGDDGGGSGGGG 195 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 +PPPPP P P PPP Sbjct: 424 IPPPPPGFPQFQPPPPPPP 442 >SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGGD GG G GG G G Sbjct: 95 GDGGGDDDSGGVGDDGGDDGGG 116 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPP 971 PPPP P PP SPP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPP 971 PPPP P PP SPP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G G G + GGG G GGGG Sbjct: 436 GIGDGAIGGGGDGAIGGGG 454 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GD G G G GGG G G Sbjct: 227 GDGDGDGDGNGDGDGGGGDGGG 248 >SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPP 974 P PP PPP T PPP Sbjct: 409 PAPPLGTLPPPGTRPPP 425 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P + P PPPPP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPP 56 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG D GGG G GGG G Sbjct: 68 GAGGDDDDGGGISGCGDGGGGG 89 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 515 GGGGGGGGGGGGGGGRGGRG 534 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 1005 GGGGGGGGGGGGGRRGGRGG 1024 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXP-PPSTRPXLALSXPXXPPPPPXP 743 PP P P PP T+P ++ PPP P P Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PP T PPPP IPPP Sbjct: 384 PPMIGPVTVPPPPLIPPP 401 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPX-XPXPPPXTSPPPXP 980 P PP PP P PPP PP P Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMP 781 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,670,289 Number of Sequences: 59808 Number of extensions: 248633 Number of successful extensions: 9383 Number of sequences better than 10.0: 137 Number of HSP's better than 10.0 without gapping: 1065 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5640 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -