BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP02_F_A07 (981 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT014927-1|AAT47778.1| 429|Drosophila melanogaster AT15894p pro... 69 1e-11 AL121806-2|CAB58111.1| 429|Drosophila melanogaster EG:BACR42I17... 69 1e-11 AE014298-153|AAF45584.2| 429|Drosophila melanogaster CG32859-PA... 69 1e-11 BT021432-1|AAX33580.1| 229|Drosophila melanogaster GH23527p pro... 63 6e-10 AE014296-1139|AAF50651.1| 229|Drosophila melanogaster CG10124-P... 63 6e-10 U63033-2|AAC47480.1| 259|Drosophila melanogaster eukaryotic ini... 62 1e-09 U63033-1|AAC47479.1| 248|Drosophila melanogaster eukaryotic ini... 62 1e-09 U54469-2|AAC03525.1| 259|Drosophila melanogaster eukaryotic ini... 62 1e-09 U54469-1|AAC03524.1| 248|Drosophila melanogaster eukaryotic ini... 62 1e-09 U16139-1|AAC46603.1| 259|Drosophila melanogaster translation in... 62 1e-09 BT012467-1|AAS93738.1| 248|Drosophila melanogaster RE36735p pro... 62 1e-09 AM294139-1|CAL26043.1| 232|Drosophila melanogaster CG8277 protein. 62 1e-09 AE014296-1641|AAN11966.1| 259|Drosophila melanogaster CG4035-PG... 62 1e-09 AE014296-1640|AAN11965.1| 259|Drosophila melanogaster CG4035-PF... 62 1e-09 AE014296-1639|AAN11964.1| 259|Drosophila melanogaster CG4035-PE... 62 1e-09 AE014296-1638|AAN11963.1| 259|Drosophila melanogaster CG4035-PD... 62 1e-09 AE014296-1637|AAF50282.1| 259|Drosophila melanogaster CG4035-PB... 62 1e-09 AE014296-1636|AAF50283.1| 259|Drosophila melanogaster CG4035-PA... 62 1e-09 AE014296-1635|AAF50281.1| 248|Drosophila melanogaster CG4035-PC... 62 1e-09 AY113228-1|AAM29233.1| 232|Drosophila melanogaster AT10032p pro... 61 2e-09 AM294141-1|CAL26045.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294140-1|CAL26044.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294138-1|CAL26042.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294137-1|CAL26041.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294136-1|CAL26040.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294135-1|CAL26039.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294134-1|CAL26038.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AM294133-1|CAL26037.1| 232|Drosophila melanogaster CG8277 protein. 61 2e-09 AE014296-1336|AAF50509.2| 232|Drosophila melanogaster CG8277-PA... 61 2e-09 AY122090-1|AAM52602.1| 244|Drosophila melanogaster GH04024p pro... 52 2e-06 AE014296-1405|AAF50460.2| 244|Drosophila melanogaster CG8023-PA... 52 2e-06 AY094939-1|AAM11292.1| 173|Drosophila melanogaster RH55324p pro... 50 5e-06 AE014297-4300|AAF56840.1| 173|Drosophila melanogaster CG1442-PA... 50 5e-06 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 42 0.001 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 40 0.005 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 40 0.005 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 40 0.005 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 38 0.021 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 38 0.021 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 38 0.021 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 38 0.021 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 38 0.021 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 38 0.021 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 38 0.021 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 38 0.021 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 38 0.021 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 38 0.028 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 38 0.028 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 37 0.037 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 37 0.037 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 37 0.037 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 37 0.037 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 37 0.049 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 36 0.064 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 36 0.064 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 36 0.085 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 36 0.085 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 36 0.11 BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p pro... 35 0.15 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 35 0.15 AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-P... 35 0.15 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 35 0.15 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 35 0.15 BT022089-1|AAY33505.1| 248|Drosophila melanogaster RE12368p pro... 35 0.20 AY094966-1|AAM11319.1| 223|Drosophila melanogaster SD07020p pro... 35 0.20 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 35 0.20 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 35 0.20 AE014297-3455|AAF56233.2| 223|Drosophila melanogaster CG33100-P... 35 0.20 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 35 0.20 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 34 0.26 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 34 0.26 AE014297-952|AAF54387.1| 632|Drosophila melanogaster CG9373-PA ... 34 0.26 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 34 0.26 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 34 0.26 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 34 0.34 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 34 0.34 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 34 0.34 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 34 0.34 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 34 0.34 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 34 0.34 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 34 0.34 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 34 0.34 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 34 0.34 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 34 0.34 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 34 0.34 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 34 0.34 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 34 0.34 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 34 0.34 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 34 0.34 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 34 0.34 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 34 0.34 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 34 0.34 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 34 0.34 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 34 0.34 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 34 0.34 AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-P... 34 0.34 AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein... 34 0.34 AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein... 34 0.34 AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein... 34 0.34 AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein... 34 0.34 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 33 0.45 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 33 0.45 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 33 0.45 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 33 0.45 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 33 0.45 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 33 0.45 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 33 0.45 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 33 0.45 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 33 0.45 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 33 0.45 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 33 0.45 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 33 0.45 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 33 0.45 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 33 0.45 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 33 0.45 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 33 0.45 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 33 0.45 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 33 0.45 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 33 0.45 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 33 0.45 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 33 0.45 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 33 0.60 BT021210-1|AAX33358.1| 1557|Drosophila melanogaster SD09985p pro... 33 0.60 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 33 0.60 AF100152-1|AAC80557.1| 1557|Drosophila melanogaster connector en... 33 0.60 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 33 0.60 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 33 0.60 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 33 0.60 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 33 0.60 AE014297-1933|AAF55130.1| 537|Drosophila melanogaster CG3984-PA... 33 0.60 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 33 0.60 AE013599-2454|AAF57874.1| 1557|Drosophila melanogaster CG6556-PA... 33 0.60 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 33 0.79 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 33 0.79 AY061579-1|AAL29127.1| 613|Drosophila melanogaster SD02991p pro... 33 0.79 AF247763-1|AAF74194.1| 613|Drosophila melanogaster SCAR protein. 33 0.79 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 33 0.79 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 33 0.79 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 33 0.79 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 33 0.79 AE014134-2001|AAF53042.1| 613|Drosophila melanogaster CG4636-PA... 33 0.79 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 33 0.79 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 32 1.0 AY122075-1|AAM52587.1| 503|Drosophila melanogaster AT17506p pro... 32 1.0 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 32 1.0 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 32 1.0 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 32 1.0 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 32 1.0 AJ252082-1|CAB64385.1| 979|Drosophila melanogaster BAB-I protei... 32 1.0 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 32 1.0 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 32 1.0 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 32 1.0 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 32 1.0 AE014296-173|AAS64927.1| 526|Drosophila melanogaster CG9097-PA,... 32 1.0 AE014296-172|AAF47439.2| 977|Drosophila melanogaster CG9097-PB,... 32 1.0 AE013599-1228|AAF58703.1| 120|Drosophila melanogaster CG13227-P... 32 1.0 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 32 1.4 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 32 1.4 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 32 1.4 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 32 1.4 BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p pro... 32 1.4 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 32 1.4 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 32 1.4 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 32 1.4 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 32 1.4 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 32 1.4 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 32 1.4 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 32 1.4 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 32 1.4 AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-P... 32 1.4 AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-P... 32 1.4 AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA... 32 1.4 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 32 1.4 AE014298-1194|AAF46386.3| 1195|Drosophila melanogaster CG11219-P... 32 1.4 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 32 1.4 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 32 1.4 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 32 1.4 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 32 1.4 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 32 1.4 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 32 1.4 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 31 1.8 BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p pro... 31 1.8 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 31 1.8 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 31 1.8 AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p pro... 31 1.8 AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p pro... 31 1.8 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 31 1.8 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 31 1.8 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 31 1.8 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 31 1.8 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 31 1.8 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 31 1.8 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 31 1.8 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 31 1.8 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 31 1.8 AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC... 31 1.8 AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA... 31 1.8 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 31 1.8 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 31 2.4 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 31 2.4 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 31 2.4 BT003608-1|AAO39611.1| 377|Drosophila melanogaster GH19274p pro... 31 2.4 BT003318-1|AAO25078.1| 517|Drosophila melanogaster AT26991p pro... 31 2.4 BT001317-1|AAN71072.1| 517|Drosophila melanogaster AT15066p pro... 31 2.4 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 31 2.4 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 31 2.4 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 31 2.4 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 31 2.4 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 31 2.4 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 31 2.4 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 31 2.4 AE014298-846|AAF46127.2| 2893|Drosophila melanogaster CG15899-PB... 31 2.4 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 31 2.4 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 31 2.4 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 31 2.4 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 31 2.4 AE014296-204|AAN11465.1| 517|Drosophila melanogaster CG9130-PB,... 31 2.4 AE014296-203|AAN11464.1| 517|Drosophila melanogaster CG9130-PA,... 31 2.4 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 31 3.2 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 31 3.2 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 31 3.2 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 31 3.2 BT023949-1|ABB36453.1| 1312|Drosophila melanogaster IP03879p pro... 31 3.2 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 31 3.2 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 31 3.2 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 31 3.2 BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p pro... 31 3.2 AY795937-1|AAY27534.1| 911|Drosophila melanogaster notch protein. 31 3.2 AY795936-1|AAY27530.1| 911|Drosophila melanogaster notch protein. 31 3.2 AY795935-1|AAY27526.1| 911|Drosophila melanogaster notch protein. 31 3.2 AY795934-1|AAY27522.1| 913|Drosophila melanogaster notch protein. 31 3.2 AY795933-1|AAY27518.1| 910|Drosophila melanogaster notch protein. 31 3.2 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 31 3.2 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 31 3.2 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 31 3.2 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 31 3.2 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 31 3.2 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 31 3.2 AE014298-2334|AAF48566.2| 1311|Drosophila melanogaster CG32577-P... 31 3.2 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 31 3.2 AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-P... 31 3.2 AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-P... 31 3.2 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 31 3.2 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 31 3.2 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 31 3.2 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 31 3.2 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 31 3.2 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 31 3.2 AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-P... 31 3.2 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 31 3.2 AE013599-878|AAM71069.2| 2172|Drosophila melanogaster CG1884-PA,... 31 3.2 AE013599-877|AAF58926.2| 2170|Drosophila melanogaster CG1884-PB,... 31 3.2 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 31 3.2 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 30 4.2 U41808-1|AAC47016.1| 452|Drosophila melanogaster Cyclin D protein. 30 4.2 U31961-18|AAA84417.1| 642|Drosophila melanogaster protein ( Dro... 30 4.2 M16599-1|AAA28912.1| 590|Drosophila melanogaster protein ( D.me... 30 4.2 J03177-1|AAA28535.1| 510|Drosophila melanogaster protein ( D.me... 30 4.2 DQ423241-1|ABD96028.1| 1573|Drosophila melanogaster Gef26 dizzy ... 30 4.2 DQ017435-1|AAY82217.1| 53|Drosophila melanogaster CG10002 prot... 30 4.2 DQ017434-1|AAY82216.1| 53|Drosophila melanogaster CG10002 prot... 30 4.2 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 30 4.2 BT023936-1|ABB36440.1| 510|Drosophila melanogaster RE06859p pro... 30 4.2 BT021373-1|AAX33521.1| 286|Drosophila melanogaster LP02810p pro... 30 4.2 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 30 4.2 BT011183-1|AAR88544.1| 603|Drosophila melanogaster RE17878p pro... 30 4.2 BT010029-1|AAQ22498.1| 426|Drosophila melanogaster RE03865p pro... 30 4.2 BT003747-1|AAO41408.1| 256|Drosophila melanogaster RH72336p pro... 30 4.2 AY128441-1|AAM75034.1| 786|Drosophila melanogaster LD16208p pro... 30 4.2 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 30 4.2 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 30 4.2 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 30 4.2 AY094715-1|AAM11068.1| 243|Drosophila melanogaster GH16325p pro... 30 4.2 AY069509-1|AAL39654.1| 481|Drosophila melanogaster LD22957p pro... 30 4.2 AY069457-1|AAL39602.1| 603|Drosophila melanogaster LD18251p pro... 30 4.2 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 30 4.2 AF434686-1|AAL28130.1| 1573|Drosophila melanogaster guanine nucl... 30 4.2 AF260583-1|AAG13285.1| 481|Drosophila melanogaster cyclin D pro... 30 4.2 AF044337-1|AAB99858.1| 588|Drosophila melanogaster TEC29 protein. 30 4.2 AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-P... 30 4.2 AE014298-2283|AAF48537.1| 481|Drosophila melanogaster CG9096-PC... 30 4.2 AE014298-2282|AAN09375.1| 481|Drosophila melanogaster CG9096-PB... 30 4.2 AE014298-2281|AAN09374.1| 481|Drosophila melanogaster CG9096-PA... 30 4.2 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 30 4.2 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 30 4.2 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 30 4.2 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 30 4.2 AE014297-4241|AAF56798.1| 510|Drosophila melanogaster CG10002-P... 30 4.2 AE014297-3911|AAF56559.1| 256|Drosophila melanogaster CG14542-P... 30 4.2 AE014297-2248|AAF55347.1| 630|Drosophila melanogaster CG10328-P... 30 4.2 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 30 4.2 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 30 4.2 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 30 4.2 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 30 4.2 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 30 4.2 AE014134-1451|AAN11162.1| 603|Drosophila melanogaster CG8049-PC... 30 4.2 AE014134-1450|AAF52631.3| 603|Drosophila melanogaster CG8049-PA... 30 4.2 AE014134-1449|AAN11161.1| 786|Drosophila melanogaster CG8049-PD... 30 4.2 AE014134-1448|AAF52632.2| 786|Drosophila melanogaster CG8049-PB... 30 4.2 AE014134-1072|AAF52365.2| 1573|Drosophila melanogaster CG9491-PA... 30 4.2 AE014134-271|AAF51357.1| 1316|Drosophila melanogaster CG14351-PA... 30 4.2 AE014134-231|AAF51393.1| 80|Drosophila melanogaster CG5011-PA ... 30 4.2 AE013599-2504|AAF57837.2| 2171|Drosophila melanogaster CG4903-PA... 30 4.2 AE013599-630|AAF59105.1| 286|Drosophila melanogaster CG11635-PA... 30 4.2 AB009841-1|BAA24064.1| 786|Drosophila melanogaster Dsrc29A type... 30 4.2 AB009840-1|BAA24063.1| 603|Drosophila melanogaster Dsrc29A type... 30 4.2 X76210-1|CAA53803.1| 389|Drosophila melanogaster homeotic ultra... 30 5.6 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 30 5.6 X05723-1|CAA29194.1| 389|Drosophila melanogaster Ultrabithorax ... 30 5.6 U31961-13|AAA84410.1| 346|Drosophila melanogaster UBXIVA protein. 30 5.6 U31961-12|AAA84409.1| 363|Drosophila melanogaster UBXIIA protein. 30 5.6 U31961-11|AAA84408.1| 380|Drosophila melanogaster UBXIA protein. 30 5.6 U31961-10|AAA84411.1| 372|Drosophila melanogaster UBXIIB protein. 30 5.6 U31961-9|AAA84412.1| 389|Drosophila melanogaster UBXIB protein. 30 5.6 U21717-1|AAA92045.1| 743|Drosophila melanogaster nervy protein. 30 5.6 M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle... 30 5.6 M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenle... 30 5.6 M57889-1|AAA28920.1| 1322|Drosophila melanogaster su(s) protein ... 30 5.6 L35153-1|AAA64457.1| 857|Drosophila melanogaster polycomblike n... 30 5.6 L07586-1|AAB00371.1| 499|Drosophila melanogaster phosphoprotein... 30 5.6 L07581-1|AAA99870.1| 499|Drosophila melanogaster phosphoprotein... 30 5.6 BT023944-1|ABB36448.1| 834|Drosophila melanogaster LD32364p pro... 30 5.6 BT015294-1|AAT94523.1| 1596|Drosophila melanogaster GH01796p pro... 30 5.6 BT010241-1|AAQ23559.1| 380|Drosophila melanogaster RE43738p pro... 30 5.6 BT004898-1|AAO47876.1| 743|Drosophila melanogaster LD17501p pro... 30 5.6 BT003578-1|AAO39582.1| 739|Drosophila melanogaster LD24631p pro... 30 5.6 BT003529-1|AAO39533.1| 987|Drosophila melanogaster RE18590p pro... 30 5.6 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 30 5.6 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 30 5.6 AY119224-1|AAM51084.1| 469|Drosophila melanogaster SD16903p pro... 30 5.6 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 30 5.6 AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p pro... 30 5.6 AY094731-1|AAM11084.1| 708|Drosophila melanogaster GH25793p pro... 30 5.6 AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p pro... 30 5.6 AY071563-1|AAL49185.1| 1220|Drosophila melanogaster RE63043p pro... 30 5.6 AY061152-1|AAL28700.1| 499|Drosophila melanogaster LD12394p pro... 30 5.6 AY058722-1|AAL13951.1| 376|Drosophila melanogaster LD46483p pro... 30 5.6 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 30 5.6 AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 prot... 30 5.6 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 30 5.6 AL031581-8|CAA20886.1| 1325|Drosophila melanogaster EG:115C2.3,F... 30 5.6 AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein ... 30 5.6 AF192484-1|AAF27346.1| 440|Drosophila melanogaster discs overgr... 30 5.6 AF132558-1|AAD27857.1| 440|Drosophila melanogaster double-time ... 30 5.6 AF067153-1|AAC18395.1| 1171|Drosophila melanogaster PIP82 protei... 30 5.6 AF055583-1|AAC39134.1| 440|Drosophila melanogaster casein kinas... 30 5.6 AE014298-2513|AAF48690.2| 834|Drosophila melanogaster CG8949-PA... 30 5.6 AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-P... 30 5.6 AE014298-1416|AAF46559.1| 1161|Drosophila melanogaster CG15311-P... 30 5.6 AE014298-1050|AAF46265.4| 1268|Drosophila melanogaster CG12690-P... 30 5.6 AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA ... 30 5.6 AE014298-82|AAF45534.1| 1325|Drosophila melanogaster CG6222-PA p... 30 5.6 AE014297-4701|AAF57109.1| 440|Drosophila melanogaster CG2048-PC... 30 5.6 AE014297-4700|AAF57108.1| 440|Drosophila melanogaster CG2048-PB... 30 5.6 AE014297-4699|AAF57110.1| 440|Drosophila melanogaster CG2048-PA... 30 5.6 AE014297-2261|AAF55355.2| 389|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-2260|AAN13719.1| 372|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-2259|AAS65158.1| 355|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-2258|AAN13718.1| 380|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-2257|AAN13717.1| 363|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-2256|AAF55356.1| 346|Drosophila melanogaster CG10388-P... 30 5.6 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 30 5.6 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 30 5.6 AE014297-1099|AAN13455.1| 499|Drosophila melanogaster CG6235-PF... 30 5.6 AE014297-1098|AAF54498.1| 499|Drosophila melanogaster CG6235-PA... 30 5.6 AE014297-472|AAN13360.2| 1091|Drosophila melanogaster CG15186-PB... 30 5.6 AE014297-471|AAS65115.1| 923|Drosophila melanogaster CG15186-PC... 30 5.6 AE014297-470|AAF54118.2| 1072|Drosophila melanogaster CG15186-PA... 30 5.6 AE014134-3117|AAN11047.1| 1676|Drosophila melanogaster CG10186-P... 30 5.6 AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA... 30 5.6 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 30 5.6 AE013599-3848|AAF47191.2| 743|Drosophila melanogaster CG3385-PA... 30 5.6 AE013599-3650|AAF47037.3| 906|Drosophila melanogaster CG5403-PA... 30 5.6 AE013599-3649|AAO41347.1| 911|Drosophila melanogaster CG5403-PB... 30 5.6 AE013599-3336|AAM68207.1| 751|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3335|AAM68206.1| 751|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3334|AAM68205.1| 751|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3333|AAF46800.2| 751|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3332|AAM68204.1| 708|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3331|AAM68208.2| 761|Drosophila melanogaster CG13503-P... 30 5.6 AE013599-3307|AAF46785.2| 204|Drosophila melanogaster CG13499-P... 30 5.6 AE013599-3141|AAF46682.1| 376|Drosophila melanogaster CG9418-PA... 30 5.6 AE013599-2734|AAF57660.2| 1271|Drosophila melanogaster CG30122-P... 30 5.6 AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA... 30 5.6 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 25 6.7 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 25 6.7 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 25 6.7 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 25 6.7 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 29 7.4 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 29 7.4 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 29 7.4 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 29 7.4 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 29 7.4 L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. 29 7.4 BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro... 29 7.4 BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro... 29 7.4 BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro... 29 7.4 BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p pro... 29 7.4 BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro... 29 7.4 BT023873-1|AAZ86794.1| 512|Drosophila melanogaster AT21758p pro... 29 7.4 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 29 7.4 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 29 7.4 BT011461-1|AAR99119.1| 638|Drosophila melanogaster RE27685p pro... 29 7.4 BT011351-1|AAR96143.1| 638|Drosophila melanogaster RE74788p pro... 29 7.4 BT009983-1|AAQ22452.1| 622|Drosophila melanogaster RE53941p pro... 29 7.4 BT003186-1|AAO24941.1| 756|Drosophila melanogaster RE65015p pro... 29 7.4 AY128472-1|AAM75065.1| 836|Drosophila melanogaster RE28238p pro... 29 7.4 AY118671-1|AAM50531.1| 1240|Drosophila melanogaster AT03020p pro... 29 7.4 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 29 7.4 AY113488-1|AAM29493.1| 435|Drosophila melanogaster RE47056p pro... 29 7.4 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 29 7.4 AY094834-1|AAM11187.1| 342|Drosophila melanogaster LD42296p pro... 29 7.4 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 29 7.4 AY069245-1|AAL39390.1| 197|Drosophila melanogaster GM01964p pro... 29 7.4 AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p pro... 29 7.4 AY061619-1|AAL29167.1| 428|Drosophila melanogaster SD08423p pro... 29 7.4 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 29 7.4 AY058388-1|AAL13617.1| 1569|Drosophila melanogaster GH15583p pro... 29 7.4 AY051919-1|AAK93343.1| 255|Drosophila melanogaster LD40489p pro... 29 7.4 AY051517-1|AAK92941.1| 731|Drosophila melanogaster GH16956p pro... 29 7.4 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 29 7.4 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 29 7.4 AF440569-1|AAL30171.1| 1569|Drosophila melanogaster antisocial i... 29 7.4 AF440568-1|AAL30170.1| 1670|Drosophila melanogaster antisocial i... 29 7.4 AF411458-1|AAL32443.1| 1569|Drosophila melanogaster rolling pebb... 29 7.4 AF411457-1|AAL32442.1| 1900|Drosophila melanogaster rolling pebb... 29 7.4 AF386648-1|AAL50558.1| 1670|Drosophila melanogaster rolling pebb... 29 7.4 AF386647-1|AAL50557.1| 1900|Drosophila melanogaster rolling pebb... 29 7.4 AF234157-1|AAF60294.1| 255|Drosophila melanogaster SR family sp... 29 7.4 AF232773-1|AAF43413.1| 255|Drosophila melanogaster SR family sp... 29 7.4 AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791... 29 7.4 AE014298-1932|AAF48294.1| 428|Drosophila melanogaster CG12175-P... 29 7.4 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 29 7.4 AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD... 29 7.4 AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC... 29 7.4 AE014297-2379|AAF55444.1| 137|Drosophila melanogaster CG14326-P... 29 7.4 AE014297-2188|AAF55300.1| 255|Drosophila melanogaster CG6987-PA... 29 7.4 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 29 7.4 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 29 7.4 AE014297-461|AAN13377.1| 646|Drosophila melanogaster CG1021-PB,... 29 7.4 AE014297-460|AAF54123.2| 646|Drosophila melanogaster CG1021-PA,... 29 7.4 AE014296-2086|AAN12251.1| 1670|Drosophila melanogaster CG32096-P... 29 7.4 AE014296-2085|AAF49970.2| 1670|Drosophila melanogaster CG32096-P... 29 7.4 AE014296-2084|AAN12250.1| 1569|Drosophila melanogaster CG32096-P... 29 7.4 AE014296-2083|AAF49968.2| 1569|Drosophila melanogaster CG32096-P... 29 7.4 AE014296-2082|AAF49967.2| 1900|Drosophila melanogaster CG32096-P... 29 7.4 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 29 7.4 AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-P... 29 7.4 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 29 7.4 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 29 7.4 AE014134-2686|AAF53511.1| 622|Drosophila melanogaster CG4132-PA... 29 7.4 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 29 7.4 AE014134-2320|AAN10833.1| 836|Drosophila melanogaster CG6043-PC... 29 7.4 AE014134-2318|AAN10831.1| 759|Drosophila melanogaster CG6043-PB... 29 7.4 AE014134-2317|AAF53274.2| 759|Drosophila melanogaster CG6043-PA... 29 7.4 AE014134-2316|AAN10830.1| 918|Drosophila melanogaster CG6043-PD... 29 7.4 AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-P... 29 7.4 AE014134-1275|AAF52515.1| 421|Drosophila melanogaster CG5261-PA... 29 7.4 AE014134-1274|AAF52514.1| 512|Drosophila melanogaster CG5261-PB... 29 7.4 AE014134-1066|AAF52356.2| 808|Drosophila melanogaster CG31640-P... 29 7.4 AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA ... 29 7.4 AE013599-3979|AAF47289.2| 342|Drosophila melanogaster CG9083-PA... 29 7.4 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 29 7.4 AE013599-2721|AAF57674.2| 731|Drosophila melanogaster CG30115-P... 29 7.4 AE013599-2720|AAF57673.2| 1593|Drosophila melanogaster CG30115-P... 29 7.4 >BT014927-1|AAT47778.1| 429|Drosophila melanogaster AT15894p protein. Length = 429 Score = 68.5 bits (160), Expect = 1e-11 Identities = 35/90 (38%), Positives = 42/90 (46%) Frame = +1 Query: 157 NAEVPPAIFDXAPVTKXVESWFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXL 336 NAE+ P+ W+ N RN W E L ++ +F VE FW L HIK S L Sbjct: 240 NAELLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSEL 299 Query: 337 CXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 G +F G RPMWE A GG W I Sbjct: 300 MLGSDYSLFKKGIRPMWEDEANVNGGRWVI 329 >AL121806-2|CAB58111.1| 429|Drosophila melanogaster EG:BACR42I17.1 protein. Length = 429 Score = 68.5 bits (160), Expect = 1e-11 Identities = 35/90 (38%), Positives = 42/90 (46%) Frame = +1 Query: 157 NAEVPPAIFDXAPVTKXVESWFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXL 336 NAE+ P+ W+ N RN W E L ++ +F VE FW L HIK S L Sbjct: 240 NAELLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSEL 299 Query: 337 CXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 G +F G RPMWE A GG W I Sbjct: 300 MLGSDYSLFKKGIRPMWEDEANVNGGRWVI 329 >AE014298-153|AAF45584.2| 429|Drosophila melanogaster CG32859-PA protein. Length = 429 Score = 68.5 bits (160), Expect = 1e-11 Identities = 35/90 (38%), Positives = 42/90 (46%) Frame = +1 Query: 157 NAEVPPAIFDXAPVTKXVESWFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXL 336 NAE+ P+ W+ N RN W E L ++ +F VE FW L HIK S L Sbjct: 240 NAELLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSEL 299 Query: 337 CXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 G +F G RPMWE A GG W I Sbjct: 300 MLGSDYSLFKKGIRPMWEDEANVNGGRWVI 329 >BT021432-1|AAX33580.1| 229|Drosophila melanogaster GH23527p protein. Length = 229 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/70 (38%), Positives = 36/70 (51%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F G +PMWE Sbjct: 61 WYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDD 120 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 121 ANKFGGRWVI 130 >AE014296-1139|AAF50651.1| 229|Drosophila melanogaster CG10124-PA protein. Length = 229 Score = 62.9 bits (146), Expect = 6e-10 Identities = 27/70 (38%), Positives = 36/70 (51%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F G +PMWE Sbjct: 61 WYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDD 120 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 121 ANKFGGRWVI 130 >U63033-2|AAC47480.1| 259|Drosophila melanogaster eukaryotic initiation factor eIF-4E1 protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >U63033-1|AAC47479.1| 248|Drosophila melanogaster eukaryotic initiation factor eIF-4E2 protein. Length = 248 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 79 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 138 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 139 ANKQGGRWVI 148 >U54469-2|AAC03525.1| 259|Drosophila melanogaster eukaryotic initiation factor 4E-I protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >U54469-1|AAC03524.1| 248|Drosophila melanogaster eukaryotic initiation factor 4E-II protein. Length = 248 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 79 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 138 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 139 ANKQGGRWVI 148 >U16139-1|AAC46603.1| 259|Drosophila melanogaster translation initiation factor protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >BT012467-1|AAS93738.1| 248|Drosophila melanogaster RE36735p protein. Length = 248 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 79 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 138 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 139 ANKQGGRWVI 148 >AM294139-1|CAL26043.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.7 bits (143), Expect = 1e-09 Identities = 28/70 (40%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 124 ANIKGGRWLI 133 >AE014296-1641|AAN11966.1| 259|Drosophila melanogaster CG4035-PG, isoform G protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1640|AAN11965.1| 259|Drosophila melanogaster CG4035-PF, isoform F protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1639|AAN11964.1| 259|Drosophila melanogaster CG4035-PE, isoform E protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1638|AAN11963.1| 259|Drosophila melanogaster CG4035-PD, isoform D protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1637|AAF50282.1| 259|Drosophila melanogaster CG4035-PB, isoform B protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1636|AAF50283.1| 259|Drosophila melanogaster CG4035-PA, isoform A protein. Length = 259 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 90 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 149 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 150 ANKQGGRWVI 159 >AE014296-1635|AAF50281.1| 248|Drosophila melanogaster CG4035-PC, isoform C protein. Length = 248 Score = 61.7 bits (143), Expect = 1e-09 Identities = 27/70 (38%), Positives = 35/70 (50%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R+ W + E+ +F VE FW L +HIK S + G +F RPMWE Sbjct: 79 WYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDA 138 Query: 397 AXXMGGXWXI 426 A GG W I Sbjct: 139 ANKQGGRWVI 148 >AY113228-1|AAM29233.1| 232|Drosophila melanogaster AT10032p protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294141-1|CAL26045.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294140-1|CAL26044.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294138-1|CAL26042.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294137-1|CAL26041.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294136-1|CAL26040.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294135-1|CAL26039.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294134-1|CAL26038.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AM294133-1|CAL26037.1| 232|Drosophila melanogaster CG8277 protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWRDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AE014296-1336|AAF50509.2| 232|Drosophila melanogaster CG8277-PA protein. Length = 232 Score = 61.3 bits (142), Expect = 2e-09 Identities = 27/70 (38%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W+ N R W + L E+ VE FW L H IK + L G VF G +PMWE Sbjct: 64 WYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSVFKKGIKPMWEDE 123 Query: 397 AXXMGGXWXI 426 A GG W + Sbjct: 124 ANIKGGRWLV 133 >AY122090-1|AAM52602.1| 244|Drosophila melanogaster GH04024p protein. Length = 244 Score = 51.6 bits (118), Expect = 2e-06 Identities = 23/70 (32%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W N R W E L+++ +F VE F+ + + +K S L +VF RPMWE Sbjct: 76 WHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDD 135 Query: 397 AXXMGGXWXI 426 GG W + Sbjct: 136 TNKNGGRWIL 145 >AE014296-1405|AAF50460.2| 244|Drosophila melanogaster CG8023-PA protein. Length = 244 Score = 51.6 bits (118), Expect = 2e-06 Identities = 23/70 (32%), Positives = 33/70 (47%) Frame = +1 Query: 217 WFXXNXRNXXWXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXX 396 W N R W E L+++ +F VE F+ + + +K S L +VF RPMWE Sbjct: 76 WHLENDRTKRWAEMLVDVTSFNTVEDFFSVYYFVKPPSDLKIFNDYMVFKKNIRPMWEDD 135 Query: 397 AXXMGGXWXI 426 GG W + Sbjct: 136 TNKNGGRWIL 145 >AY094939-1|AAM11292.1| 173|Drosophila melanogaster RH55324p protein. Length = 173 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/58 (39%), Positives = 28/58 (48%) Frame = +1 Query: 247 WXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXW 420 W + L E+ +F VE FW L I S L G ++F G RPMWE GG W Sbjct: 52 WEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRW 109 >AE014297-4300|AAF56840.1| 173|Drosophila melanogaster CG1442-PA protein. Length = 173 Score = 50.0 bits (114), Expect = 5e-06 Identities = 23/58 (39%), Positives = 28/58 (48%) Frame = +1 Query: 247 WXEXLIELXTFXXVEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXW 420 W + L E+ +F VE FW L I S L G ++F G RPMWE GG W Sbjct: 52 WEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRW 109 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 42.3 bits (95), Expect = 0.001 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP T PPP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPP 486 Score = 39.5 bits (88), Expect = 0.007 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 39.5 bits (88), Expect = 0.007 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPP 487 Score = 37.1 bits (82), Expect = 0.037 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP T PPPP PPP Sbjct: 473 PPPPPPPTEPPPPPPPPP 490 Score = 36.3 bits (80), Expect = 0.064 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 467 PPPPPPPPPPPPPTEPPPPPPP 488 Score = 36.3 bits (80), Expect = 0.064 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 471 PPPPPPPPPTEPPPPPPPPPEP 492 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEP 482 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP P L+LS P PPPP Sbjct: 391 PPPPPPCAPPP---PALSLSQPPPPPPP 415 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPXPP--PXTSPPPXP 980 PPPPP P PP + PPP P Sbjct: 392 PPPPPCAPPPPALSLSQPPPPP 413 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-LSXPXXPPPPPXP 743 P PP PPP P + +S P PPP P Sbjct: 319 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEP 350 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP P L+LS P PPPP Sbjct: 196 PPPPPPCAPPP---PALSLSQPPPPPPP 220 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPXPP--PXTSPPPXP 980 PPPPP P PP + PPP P Sbjct: 197 PPPPPCAPPPPALSLSQPPPPP 218 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-LSXPXXPPPPPXP 743 P PP PPP P + +S P PPP P Sbjct: 124 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEP 155 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP P L+LS P PPPP Sbjct: 761 PPPPPPCAPPP---PALSLSQPPPPPPP 785 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPPPPXXPXPP--PXTSPPPXP 980 PPPPP P PP + PPP P Sbjct: 762 PPPPPCAPPPPALSLSQPPPPP 783 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLA-LSXPXXPPPPPXP 743 P PP PPP P + +S P PPP P Sbjct: 689 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEP 720 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 500 PPPPPPPPPPP---PPLANYGAPPPPPPPPP 527 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 485 PPPPP--PPPPLPAFVAPPPPPPPPPPPPP 512 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPX---PPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPP 510 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXX----PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPP 512 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P+ ++ P PPPPP P Sbjct: 485 PPPPPPPPPLPAF-----VAPPPPPPPPPPP 510 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P +PPP P Sbjct: 485 PPPPPPPPPLPAFVAPPPPP 504 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT--SPPPXP 980 P PPPPP P PP +PPP P Sbjct: 500 PPPPPPPPPPPPPLANYGAPPPPP 523 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 486 PPPPPP--PP---LPAFVAPPPPPPPPPPPP 511 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 507 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 540 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXP--------XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P L+ PPPPP P Sbjct: 487 PPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPP 525 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 519 PPPPPPPPPGSGSAPPPPP 537 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 503 PPPPPPPPPPLANYGAPPPPPPPPP 527 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 506 PPPPPPPLANYGAPPPPPPPPP 527 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 524 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 552 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 37.9 bits (84), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 35.9 bits (79), Expect = 0.085 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP-PPXP 980 P PPPPP P PPP + P PP P Sbjct: 235 PQPPPPPPPPPPPPPSYPYPPYP 257 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 150 PAPPPPPPPPPPPPPPPPPP 169 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + P P P PPP P Sbjct: 238 PPPPPPPPPPPPSYP-----YPPYPYPPPGP 263 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P PP +T P P PPPPP Sbjct: 223 PPGPPGPPGTTYPQPPPPPPPPPPPPP 249 Score = 32.3 bits (70), Expect = 1.0 Identities = 27/112 (24%), Positives = 27/112 (24%), Gaps = 2/112 (1%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP-XXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 827 PPPP P PPP P S P P PP Sbjct: 152 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 211 Query: 828 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXP-PPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGP 263 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP + PP P Sbjct: 54 PPPPPPPPPPPQHCNCPPGP 73 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPPPXP 980 P PPPPP P PP P P P P Sbjct: 243 PPPPPPPSYPYPPYPYPPPGPYP 265 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PP PP P Sbjct: 54 PPPPPP--PPP---PPQHCNCPPGPPGPPGP 79 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PP PP T P PP PPP Sbjct: 226 PPGPPGTTYPQPPPPPPP 243 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 490 PPPPPP--PPPPPPPPLANYGAPPPPPPPPP 518 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 475 PPPPP--PPPPLHAFVAPPPPPPPPPPPPP 502 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---SPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPP 514 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 531 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 510 PPPPPPPPPGSGSAPPPPP 528 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +3 Query: 921 PPPPPXXP------XPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPP 500 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 494 PPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 497 PPPPPPPLANYGAPPPPPPPPP 518 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 515 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 37.9 bits (84), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 74 PPPPPPPPPPPPPPPPPPSP 93 Score = 37.9 bits (84), Expect = 0.021 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP SPP P Sbjct: 76 PPPPPPPPPPPPPPPPSPPGVP 97 Score = 37.1 bits (82), Expect = 0.037 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPP 974 LPPPPP P PPP PPP Sbjct: 72 LPPPPPPPPPPPPPPPPPP 90 Score = 36.3 bits (80), Expect = 0.064 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP PP P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPP 94 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P PPP + P + + PP P Sbjct: 80 PPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P + P PP P Sbjct: 79 PPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPPPP P Sbjct: 73 PPPPPPPPPPP----------PPPPPPPPSP 93 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP-PPXP 743 PPPP P PPP P P P PP P Sbjct: 76 PPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 37.9 bits (84), Expect = 0.021 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 35.9 bits (79), Expect = 0.085 Identities = 14/23 (60%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSP-PPXP 980 P PPPPP P PPP + P PP P Sbjct: 237 PQPPPPPPPPPPPPPSYPYPPYP 259 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 152 PAPPPPPPPPPPPPPPPPPP 171 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP + P P P PPP P Sbjct: 240 PPPPPPPPPPPPSYP-----YPPYPYPPPGP 265 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P PP +T P P PPPPP Sbjct: 225 PPGPPGPPGTTYPQPPPPPPPPPPPPP 251 Score = 32.3 bits (70), Expect = 1.0 Identities = 27/112 (24%), Positives = 27/112 (24%), Gaps = 2/112 (1%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP-XXPPPPPXPXXXXXXXXXXXXXXXXXXXXXXXXXXXX 827 PPPP P PPP P S P P PP Sbjct: 154 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 213 Query: 828 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPXXPXP-PPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGP 265 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP + PP P Sbjct: 56 PPPPPPPPPPPQHCNCPPGP 75 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPPPXP 980 P PPPPP P PP P P P P Sbjct: 245 PPPPPPPSYPYPPYPYPPPGPYP 267 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PP PP P Sbjct: 56 PPPPPP--PPP---PPQHCNCPPGPPGPPGP 81 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PP PP T P PP PPP Sbjct: 228 PPGPPGTTYPQPPPPPPP 245 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 500 PPPPPP--PPPPPPPPLANYGAPPPPPPPPP 528 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 485 PPPPP--PPPPLHAFVAPPPPPPPPPPPPP 512 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---SPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPP 524 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 487 PPPPPPPLHAFVAPPPPPPPPPPPPP 512 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 508 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 541 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 520 PPPPPPPPPGSGSAPPPPP 538 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +3 Query: 921 PPPPPXXP------XPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPP 510 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 504 PPPPPPPPPPLANYGAPPPPPPPPP 528 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 507 PPPPPPPLANYGAPPPPPPPPP 528 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 525 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 553 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 490 PPPPPP--PPPPPPPPLANYGAPPPPPPPPP 518 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 475 PPPPP--PPPPLHAFVAPPPPPPPPPPPPP 502 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---SPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPP 514 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 477 PPPPPPPLHAFVAPPPPPPPPPPPPP 502 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 498 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 531 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 510 PPPPPPPPPGSGSAPPPPP 528 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +3 Query: 921 PPPPPXXP------XPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPP 500 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 494 PPPPPPPPPPLANYGAPPPPPPPPP 518 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 497 PPPPPPPLANYGAPPPPPPPPP 518 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 515 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 648 PPPPPP--PPPPPPPPLANYGAPPPPPPPPP 676 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 633 PPPPP--PPPPLHAFVAPPPPPPPPPPPPP 660 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---SPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 648 PPPPPPPPPPPPPPLANYGAPPPPP 672 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 635 PPPPPPPLHAFVAPPPPPPPPPPPPP 660 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 656 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 689 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 668 PPPPPPPPPGSGSAPPPPP 686 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +3 Query: 921 PPPPPXXP------XPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPP 658 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 652 PPPPPPPPPPLANYGAPPPPPPPPP 676 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 655 PPPPPPPLANYGAPPPPPPPPP 676 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 673 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 701 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P LA PPPPP P Sbjct: 595 PPPPPP--PPPPPPPPLANYGAPPPPPPPPP 623 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 580 PPPPP--PPPPLHAFVAPPPPPPPPPPPPP 607 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT---SPPPXP 980 P PPPPP P PPP +PPP P Sbjct: 595 PPPPPPPPPPPPPPLANYGAPPPPP 619 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPP----XXPXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 582 PPPPPPPLHAFVAPPPPPPPPPPPPP 607 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 603 PPPPPPLANYGAPPPPPPPPPGSGSAP--PPPPPAP 636 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 615 PPPPPPPPPGSGSAPPPPP 633 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 6/26 (23%) Frame = +3 Query: 921 PPPPPXXP------XPPPXTSPPPXP 980 PPPPP P PPP PPP P Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPP 605 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 599 PPPPPPPPPPLANYGAPPPPPPPPP 623 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 602 PPPPPPPLANYGAPPPPPPPPP 623 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 620 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 648 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 37.5 bits (83), Expect = 0.028 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPST-----RPXLALSX-PXXPPPPPXP 743 PPPP P PPP T RP A P PPPPP P Sbjct: 644 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 680 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPP------STRPXLALSXPXXPPPPPXP 743 PPPP P PPP RP A PPPPP P Sbjct: 643 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 679 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPP--PPXXPXPPPXTSPPPXP 980 P+ PP PP P PPP PPP P Sbjct: 660 PVRPPYAPPVRPLPPPPPPPPPVP 683 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP T P Sbjct: 643 PPPPPPPPPPPPQTCCAP 660 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRP 663 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 37.5 bits (83), Expect = 0.028 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPST-----RPXLALSX-PXXPPPPPXP 743 PPPP P PPP T RP A P PPPPP P Sbjct: 784 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPP 820 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPP------STRPXLALSXPXXPPPPPXP 743 PPPP P PPP RP A PPPPP P Sbjct: 783 PPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPP 819 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPP--PPXXPXPPPXTSPPPXP 980 P+ PP PP P PPP PPP P Sbjct: 800 PVRPPYAPPVRPLPPPPPPPPPVP 823 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPPPP P PPP T P Sbjct: 783 PPPPPPPPPPPPQTCCAP 800 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRP 803 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 37.1 bits (82), Expect = 0.037 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P +A PPPPP P Sbjct: 595 PPPPPPPPPPP---PPMANYGAPPPPPPPPP 622 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 580 PPPPP--PPPPLPAFVAPPPPPPPPPPPPP 607 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPX---PPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPP 605 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXX----PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 582 PPPPPPPLPAFVAPPPPPPPPPPPPP 607 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P+ ++ P PPPPP P Sbjct: 580 PPPPPPPPPLPAF-----VAPPPPPPPPPPP 605 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P +PPP P Sbjct: 580 PPPPPPPPPLPAFVAPPPPP 599 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT--SPPPXP 980 P PPPPP P PP +PPP P Sbjct: 595 PPPPPPPPPPPPPMANYGAPPPPP 618 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 581 PPPPPP--PP---LPAFVAPPPPPPPPPPPP 606 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 602 PPPPPPMANYGAPPPPPPPPPGSGSAP--PPPPPAP 635 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 614 PPPPPPPPPGSGSAPPPPP 632 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 598 PPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 601 PPPPPPPMANYGAPPPPPPPPP 622 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 619 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 647 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 37.1 bits (82), Expect = 0.037 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P +A PPPPP P Sbjct: 728 PPPPPPPPPPP---PPMANYGAPPPPPPPPP 755 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP +A P PPPPP P Sbjct: 713 PPPPP--PPPPLPAFVAPPPPPPPPPPPPP 740 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPX---PPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPP 738 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXX----PXPPPXTSPPPXP 980 P PPPPP P PPP PPP P Sbjct: 715 PPPPPPPLPAFVAPPPPPPPPPPPPP 740 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P+ ++ P PPPPP P Sbjct: 713 PPPPPPPPPLPAF-----VAPPPPPPPPPPP 738 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P +PPP P Sbjct: 713 PPPPPPPPPLPAFVAPPPPP 732 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT--SPPPXP 980 P PPPPP P PP +PPP P Sbjct: 728 PPPPPPPPPPPPPMANYGAPPPPP 751 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 714 PPPPPP--PP---LPAFVAPPPPPPPPPPPP 739 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + S P PPPPP P Sbjct: 735 PPPPPPMANYGAPPPPPPPPPGSGSAP--PPPPPAP 768 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P P ++PPP P Sbjct: 747 PPPPPPPPPGSGSAPPPPP 765 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 5/25 (20%) Frame = +3 Query: 915 PLPPPPPXXP-----XPPPXTSPPP 974 P PPPPP P PPP PPP Sbjct: 731 PPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 734 PPPPPPPMANYGAPPPPPPPPP 755 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PP P PPPPP Sbjct: 752 PPPPGSGSAPPPPPPAPIEGGGGIPPPPP 780 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 37.1 bits (82), Expect = 0.037 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXP-----PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P PP P A P PPPPP P Sbjct: 44 PPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P P T PP P Sbjct: 68 IPPPPPPPPPAPKNTYIPPAP 88 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAP 52 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 37.1 bits (82), Expect = 0.037 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Frame = +3 Query: 651 PPPPXPXXP-----PPSTRPXLALSXPXXPPPPPXP 743 PPPP P P PP P A P PPPPP P Sbjct: 44 PPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 +PPPPP P P T PP P Sbjct: 68 IPPPPPPPPPAPKNTYIPPAP 88 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAP 52 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 36.7 bits (81), Expect = 0.049 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PP+TRP P PPPP Sbjct: 323 PPPTRPPTKPPTTRPPATYLPPTNKPPPP 351 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P P PP+ +P ++ PPPPP Sbjct: 205 PPTPPPTYLPPTNKPLPPVTTRLPPPPPP 233 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PP+TRP P P PP Sbjct: 237 PPPTRPPTRPPTTRPPATYLPPTNKPLPP 265 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP P PP+TRP P P PP Sbjct: 280 PPPTRPPTRPPTTRPPATYLPPTNKPLPP 308 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 2/22 (9%) Frame = +3 Query: 921 PPP--PPXXPXPPPXTSPPPXP 980 PPP PP P PP T PPP P Sbjct: 558 PPPTRPPTRPPTPPPTRPPPPP 579 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PP T PP P Sbjct: 227 LPPPPPP-PRTPPPTRPPTRP 246 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PP T PP P Sbjct: 270 LPPPPPS-PRTPPPTRPPTRP 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTSPPPXP 980 LPPPPP P PP T PP P Sbjct: 313 LPPPPPP-PRTPPPTRPPTKP 332 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 651 PPPPXPXXPPPSTR-PXLALSXPXXPPPPP 737 PPP P PP+T P + + PPPPP Sbjct: 846 PPPTRPPTKPPTTYLPPVTVVRTTRPPPPP 875 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXP----XXPPPPPXP 743 PP P PPP+ P P PPPPP P Sbjct: 201 PPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPP 234 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPP 971 P PPPPP P P P T PP Sbjct: 314 PPPPPPPRTPPPTRPPTKPP 333 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 915 PLPPPPPXXPXPP-PXTSPP 971 P PPPPP P P P T PP Sbjct: 228 PPPPPPPRTPPPTRPPTRPP 247 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 PPPP P PP TRP P PP Sbjct: 314 PPPPPPPRTPPPTRP--PTKPPTTRPP 338 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP + P P Sbjct: 357 PTPPPTRPPPPPTRASTPAP 376 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP + P P Sbjct: 568 PTPPPTRPPPPPTRASTPAP 587 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 36.3 bits (80), Expect = 0.064 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+GG GG GGG GR G Sbjct: 263 GGGGFGGQGGAGGGYGGGGGGGRGGG 288 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG GG GG GG GGG G G+ + G Sbjct: 191 GGGAGGGSGGGGGGAGGGGGYGSGGGSGRGG 221 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG+GG GG GGG G Sbjct: 328 GGGGYGGQGGAGGGYGGGGGRG 349 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 176 GGGGGSGYGGGSGFGGGGAGGG 197 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 191 GGGAGGGSGGGGGGAGGGGGYG 212 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 298 GGGGFGGQGG-GGGFGGGGGRGGAPGA 323 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 364 GGGGFGGQGG-GGGFGGGGGRGGAPGA 389 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 394 GGGGFGGQGG-GGGYGGGAGRGGAPGA 419 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GG GG G Sbjct: 188 GFGGGGAGGGSGGGGGGAGGGG 209 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGG G Sbjct: 271 GGAGGGYGGGGGGGRGGGGAPG 292 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 182 GYGGGSGFGGGGAGGGSGGGGG 203 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G G GGG G Sbjct: 197 GSGGGGGGAGGGGGYGSGGGSG 218 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGG G G Sbjct: 199 GGGGGGAGGGGGYGSGGGSGRG 220 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG G G G GR G G G Sbjct: 230 GGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGG 269 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 36.3 bits (80), Expect = 0.064 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+GG GG GGG GR G Sbjct: 335 GGGGFGGQGGAGGGYGGGGGGGRGGG 360 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG GG GG GG GGG G G+ + G Sbjct: 263 GGGAGGGSGGGGGGAGGGGGYGSGGGSGRGG 293 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG+GG GG GGG G Sbjct: 400 GGGGYGGQGGAGGGYGGGGGRG 421 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 248 GGGGGSGYGGGSGFGGGGAGGG 269 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGGG G Sbjct: 263 GGGAGGGSGGGGGGAGGGGGYG 284 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 370 GGGGFGGQGG-GGGFGGGGGRGGAPGA 395 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 436 GGGGFGGQGG-GGGFGGGGGRGGAPGA 461 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGA 523 GG G GG+GG GG GGG G GA Sbjct: 466 GGGGFGGQGG-GGGYGGGAGRGGAPGA 491 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 42 GPGGGFGGGGGFGGGGAGGGYG 63 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 48 GGGGGFGGGGAGGGYGGGGGGG 69 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GG GG G Sbjct: 260 GFGGGGAGGGSGGGGGGAGGGG 281 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGGG G Sbjct: 343 GGAGGGYGGGGGGGRGGGGAPG 364 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 254 GYGGGSGFGGGGAGGGSGGGGG 275 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G G GGG G Sbjct: 269 GSGGGGGGAGGGGGYGSGGGSG 290 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGG G G Sbjct: 271 GGGGGGAGGGGGYGSGGGSGRG 292 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG G G G GR G G G Sbjct: 302 GGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGG 341 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 35.9 bits (79), Expect = 0.085 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP+ RP P PPP P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQP 107 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P P PPP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPP 228 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P PP P Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPP 245 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P + P PPP P P Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTP 109 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P P P PPPPP P Sbjct: 206 PQPPPPPPPRPQPTPGYG---PPPPPPPPKP 233 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P PS P P PPP P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTP 86 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPST-RPXLALSXPXXPPPPPXP 743 PPP P P PS P + P PPP P P Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPPS P + P PPP P P Sbjct: 107 PTPSAPAPPPPSYGP--PQTPPPRPPPQPTP 135 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P PPP P Sbjct: 112 PAPPPPSYGPPQTPPPRPPPQP 133 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P P PS P PP PP P Sbjct: 155 PPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPPPPP 737 PP P P PP +P S P PPPPP Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PP TRP P PP P P Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRP 91 Score = 30.3 bits (65), Expect = 4.2 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 10/120 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPP---PPPXPXXXXXXXXXXXXXXXXXXXXXXX 812 PPPP P PPP P S P PP PP P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQ 173 Query: 813 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPX-XPXP---PPXTSPPPXP 980 P PPPPP P P PP PPP P Sbjct: 174 PPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P P P PPP P P Sbjct: 224 PPPPPPPPKPQPTPGYG---PPTPPPGPGP 250 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PP T+P P P P P Sbjct: 86 PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 35.9 bits (79), Expect = 0.085 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP+ RP P PPP P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQP 107 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P P PPP P Sbjct: 209 PPPPPPRPQPTPGYGPPPPP 228 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P PP P Sbjct: 224 PPPPPPPPKPQPTPGYGPPTPP 245 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P + P PPP P P Sbjct: 79 PPPPQPTPPAPRPSYGPPQTQPPRPPPQPTP 109 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P P P PPPPP P Sbjct: 206 PQPPPPPPPRPQPTPGYG---PPPPPPPPKP 233 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P P PS P P PPP P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTP 86 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 651 PPPPXPXXPPPST-RPXLALSXPXXPPPPPXP 743 PPP P P PS P + P PPP P P Sbjct: 125 PPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPPS P + P PPP P P Sbjct: 107 PTPSAPAPPPPSYGP--PQTPPPRPPPQPTP 135 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P P PPP P Sbjct: 112 PAPPPPSYGPPQTPPPRPPPQP 133 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P P PS P PP PP P Sbjct: 155 PPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPPPPP 737 PP P P PP +P S P PPPPP Sbjct: 182 PPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PP TRP P PP P P Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRP 91 Score = 30.3 bits (65), Expect = 4.2 Identities = 30/120 (25%), Positives = 30/120 (25%), Gaps = 10/120 (8%) Frame = +3 Query: 651 PPPPX---PXXPPPSTRPXLALSXPXXPP---PPPXPXXXXXXXXXXXXXXXXXXXXXXX 812 PPPP P PPP P S P PP PP P Sbjct: 114 PPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQ 173 Query: 813 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPPPPPX-XPXP---PPXTSPPPXP 980 P PPPPP P P PP PPP P Sbjct: 174 PPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P P P PPP P P Sbjct: 224 PPPPPPPPKPQPTPGYG---PPTPPPGPGP 250 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P PP T+P P P P P Sbjct: 86 PPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 >AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA protein. Length = 1027 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP PP+ P A + P PPPPP P Sbjct: 456 PAPPALAPAPPARSPTPAAAAPPPPPPPPSP 486 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPPPPXXPX---PPPXTSPPP 974 P PPPPP P PPP +PPP Sbjct: 477 PPPPPPPPSPSYEPPPPSYAPPP 499 >BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p protein. Length = 335 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 201 GVGGGGAAGGGGGSVGGGGGGG 222 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P LA P PPPPP Sbjct: 646 PPPPEPQYLPPP--PPLANVRPLGPPPPP 672 >AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-PA protein. Length = 335 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 201 GVGGGGAAGGGGGSVGGGGGGG 222 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP P LA P PPPPP Sbjct: 646 PPPPEPQYLPPP--PPLANVRPLGPPPPP 672 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 35.1 bits (77), Expect = 0.15 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP T P P Sbjct: 228 PPPPPPPPPPPPPPPTLSPSLP 249 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP 716 PPPP P PPP P L+ S P Sbjct: 228 PPPPPPPPPPPPPPPTLSPSLP 249 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP PPPP PPP T Sbjct: 228 PPPPP----PPPPPPPPPPT 243 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLAL 707 PPPP P PPP+ P L L Sbjct: 232 PPPPPPPPPPPTLSPSLPL 250 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 675 PPPSTRPXLALSXPXXPPPPPXP 743 PPP +P P PPPPP P Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPP 237 >BT022089-1|AAY33505.1| 248|Drosophila melanogaster RE12368p protein. Length = 248 Score = 34.7 bits (76), Expect = 0.20 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 286 VEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 V+ +W L H+ + L ++F G PMWE A GG W I Sbjct: 81 VQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLI 127 >AY094966-1|AAM11319.1| 223|Drosophila melanogaster SD07020p protein. Length = 223 Score = 34.7 bits (76), Expect = 0.20 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 286 VEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 V+ +W L H+ + L ++F G PMWE A GG W I Sbjct: 81 VQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLI 127 >AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 protein. Length = 359 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP P P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP-----XLALSXPXXPP 728 PPPP P PPP RP +A+ P PP Sbjct: 170 PPPPLPPPPPPPPRPTPIPVSVAIPSPAVPP 200 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPP P P PPP +P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 >AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA protein. Length = 359 Score = 34.7 bits (76), Expect = 0.20 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PPP P P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRP-----XLALSXPXXPP 728 PPPP P PPP RP +A+ P PP Sbjct: 170 PPPPLPPPPPPPPRPTPIPVSVAIPSPAVPP 200 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPP P P PPP +P P Sbjct: 169 PPPPPLPPPPPPPPRPTPIP 188 >AE014297-3455|AAF56233.2| 223|Drosophila melanogaster CG33100-PA protein. Length = 223 Score = 34.7 bits (76), Expect = 0.20 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +1 Query: 286 VEXFWXLXHHIKLXSXLCXGXXXVVFXXGXRPMWEXXAXXMGGXWXI 426 V+ +W L H+ + L ++F G PMWE A GG W I Sbjct: 81 VQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLI 127 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP T+ + + P PPPPP Sbjct: 382 PPPPPPVYIPPPTKKVVVYTPP--PPPPP 408 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP + P PPPPP Sbjct: 180 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 213 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 651 PPPPXPXX-----PPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP + P PPPPP Sbjct: 280 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 313 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P A P PPPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXX----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + PPPPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P + + PPPPP Sbjct: 558 PPPPGMGGPPPPPMPGM-MRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPPPP PP PPP P Sbjct: 512 PMPPPPPGGGGAPP-PPPPPMP 532 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P + P PPPP Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPP 584 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP +P Sbjct: 557 PPPPPGMGGPPPPPMP 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P P + P P PPPPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P A P PPPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXX----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + PPPPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P + + PPPPP Sbjct: 558 PPPPGMGGPPPPPMPGM-MRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPPPP PP PPP P Sbjct: 512 PMPPPPPGGGGAPP-PPPPPMP 532 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P + P PPPP Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPP 584 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP +P Sbjct: 557 PPPPPGMGGPPPPPMP 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P P + P P PPPPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >AE014297-952|AAF54387.1| 632|Drosophila melanogaster CG9373-PA protein. Length = 632 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 152 GGGGGGVQGGNGGNNGGGGGGG 173 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P A P PPPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXX----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + PPPPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P + + PPPPP Sbjct: 558 PPPPGMGGPPPPPMPGM-MRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPPPP PP PPP P Sbjct: 512 PMPPPPPGGGGAPP-PPPPPMP 532 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P + P PPPP Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPP 584 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP +P Sbjct: 557 PPPPPGMGGPPPPPMP 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P P + P P PPPPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 34.3 bits (75), Expect = 0.26 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 651 PPPPXP---XXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PPP P A P PPPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMP 548 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 651 PPPPXPXX----PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + PPPPP P Sbjct: 527 PPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPP 561 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP P + + PPPPP Sbjct: 558 PPPPGMGGPPPPPMPGM-MRPGGGPPPPP 585 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+PPPPP PP PPP P Sbjct: 512 PMPPPPPGGGGAPP-PPPPPMP 532 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPP 558 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P P P + P PPPP Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPP 584 Score = 30.3 bits (65), Expect = 4.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIP 967 PPPPP PPPP +P Sbjct: 557 PPPPPGMGGPPPPPMP 572 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPP 560 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P P + P P PPPPP P Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 33.9 bits (74), Expect = 0.34 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGG---GXXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG GG GG G GR G + G G G Sbjct: 175 GGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGG 217 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 19 GGGGGRGFGGGGGGRGGGGGRG 40 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 25 GFGGGGGGRGGGGGRGGGGGFG 46 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 32 GRGGGGGRGGGGGFGRGGGGRG 53 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+GG GG GGG GR G Sbjct: 27 GGGGGGRGG-GGGRGGGGGFGRGGG 50 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 34 GGGGGRGGGGGFGRGGGGRGGG 55 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 10 GGGGGRGFGGGGGGRGFGGGGG 31 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 16 GFGGG---GGGRGFGGGGGGRG 34 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG GGGGG G Sbjct: 199 GRGGGGFRGGAGRNGGGGGGGG 220 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P P PPPPP P Sbjct: 214 PPPPPFYPPYYGYPPYYPPYPYPPPPPPPP 243 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 88 PPPQRPWGPPPPPGPP-----PPGPPPPPGP 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 93 PWGPPPPPGP-PPPGPPPPPGP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PPP RP P PPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXP--XPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 84 PAYPPPPQRPWGPPPPPGPPPPGP 107 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPP 104 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P L L+ P PPPPP P Sbjct: 1271 PTPPKPVAAPVPP-PPLPLTPPAAPPPPPPP 1300 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PP PPP P Sbjct: 1280 PVPPPPLPLTPPAAPPPPPP 1299 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P PP P + P PPPPP Sbjct: 1273 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1301 >AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p protein. Length = 950 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 420 GGGGGRSGGGGGGGAGGGGGVG 441 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 419 GGGGGGRSGGGGGGGAGGGG 438 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G G GGG G Sbjct: 418 GGGGGGGRSGGGGGGGAGGGGG 439 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPP--PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PPP++ P L+L P P P P P Sbjct: 304 PPPASPSPSLPPPAS-PSLSLPPPASPSPSPSP 335 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P S PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT----SPPPXP 980 P PPPPP P PP T SPPP P Sbjct: 338 PPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPPXT 979 T PPPP PPPP PP T Sbjct: 332 TAAPPPPPPPPPPPPPPPPAQT 353 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P+ PP P PPP PPP Sbjct: 330 PVTAAPPPPPPPPPPPPPPP 349 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 118 PPPQRPWGPPPPPGPP-----PPGPPPPPGP 143 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 123 PWGPPPPPGP-PPPGPPPPPGP 143 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PPP RP P PPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPP 139 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXP--XPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 114 PAYPPPPQRPWGPPPPPGPPPPGP 137 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPP 134 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGSG 89 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGG 79 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 33.9 bits (74), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP P P P Sbjct: 167 PAEPPPPPPPPPPPTAPPRPRP 188 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP P P P Sbjct: 171 PPPPPPPPPPTAPPRPRPRPRP 192 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP T P P P P P Sbjct: 170 PPPPPPPPPPPTAPPRPRPRPRPRPQQPDP 199 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P P P P Sbjct: 173 PPPPPPPPTAPPRPRPRPRPRP 194 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 1280 GSGGGGNGGGGNGGGGGGGGGG 1301 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 1284 GGNGGGGNGGGGGGGGGG 1301 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG+ GG G GGGGG G Sbjct: 1283 GGGNGGGGNGGGGGGGGGGG 1302 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GG GGG G GGGGG Sbjct: 1284 GGNGGGGNGGGGGGGGGGGG 1303 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG G G G GGGGG G Sbjct: 1282 GGGGNGGGGNGGGGGGGGGGGG 1303 >AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC, isoform C protein. Length = 2148 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 24 GAGGGAVGSGGAGGGGGGGGAG 45 >AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB, isoform B protein. Length = 2196 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG V GG G GGGGG G Sbjct: 24 GAGGGAVGSGGAGGGGGGGGAG 45 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGG 86 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGG 87 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 68 GGGGGGGGGGGGGGGGGGGGSG 89 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G GGG G GGGGG G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGG 79 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPP--PXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P PPP++ P L+L P P P P P Sbjct: 2571 PPPASPSPSLPPPAS-PSLSLPPPASPSPSPSP 2602 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P P P L L+ P PPPPP P Sbjct: 1331 PTPPKPVAAPVPP-PPLPLTPPAAPPPPPPP 1360 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 P PPP P PP PPP P Sbjct: 1340 PVPPPPLPLTPPAAPPPPPP 1359 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PP P PP P + P PPPPP Sbjct: 1333 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1361 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 195 GGGGGGGGGGGIGGAGGGGGGG 216 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGG 213 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 193 GGGGGGGGGGGGGIGGAGGGGG 214 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 199 GGGGGGGIGGAGGGGGGGGGNG 220 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG + G G G GGGG G Sbjct: 200 GGGGGGIGGAGGGGGGGGGNGG 221 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 196 GGGGGGGGGGIGGAGGGGGGGG 217 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 967 GDVXGGGXGXXGGGGGXG 914 G V GGG G GGGGG G Sbjct: 188 GAVSGGGGGGGGGGGGGG 205 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 118 PPPQRPWGPPPPPGPP-----PPGPPPPPGP 143 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 123 PWGPPPPPGP-PPPGPPPPPGP 143 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PPP RP P PPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPP 139 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXP--XPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 114 PAYPPPPQRPWGPPPPPGPPPPGP 137 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 117 PPPPQRPWGPPPPPGPPP 134 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPPPP P Sbjct: 88 PPPQRPWGPPPPPGPP-----PPGPPPPPGP 113 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 93 PWGPPPPPGP-PPPGPPPPPGP 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P PPP RP P PPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPP 109 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPPPXXP--XPPPXTSPPPXP 980 P PPPP P PPP PPP P Sbjct: 84 PAYPPPPQRPWGPPPPPGPPPPGP 107 Score = 30.7 bits (66), Expect = 3.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPP PPPP PPP Sbjct: 87 PPPPQRPWGPPPPPGPPP 104 >AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA protein. Length = 950 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 420 GGGGGRSGGGGGGGAGGGGGVG 441 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 419 GGGGGGRSGGGGGGGAGGGG 438 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G G GGG G Sbjct: 418 GGGGGGGRSGGGGGGGAGGGGG 439 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 33.9 bits (74), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PPP P S PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 33.9 bits (74), Expect = 0.34 Identities = 15/26 (57%), Positives = 15/26 (57%), Gaps = 4/26 (15%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXT----SPPPXP 980 P PPPPP P PP T SPPP P Sbjct: 338 PPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPPXT 979 T PPPP PPPP PP T Sbjct: 332 TAAPPPPPPPPPPPPPPPPAQT 353 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P+ PP P PPP PPP Sbjct: 330 PVTAAPPPPPPPPPPPPPPP 349 >AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-PJ, isoform J protein. Length = 757 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 684 GGIGGGGSGGGGGGGGGG 701 >AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 684 GGIGGGGSGGGGGGGGGG 701 >AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 684 GGIGGGGSGGGGGGGGGG 701 >AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 684 GGIGGGGSGGGGGGGGGG 701 >AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGGG G Sbjct: 680 GGAGGGIGGGGSGGGGGGGGGG 701 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 684 GGIGGGGSGGGGGGGGGG 701 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G G+GG GG GGG GR G Sbjct: 25 GGGGFRGRGGGGGGGGGGFGGGRGRG 50 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 23 GGGGGGFRGRGGGGGGGGGGFG 44 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG GG+GG GG GGG G G Sbjct: 51 GGGDRGGRGGFGGGRGGGGRGGGGGG 76 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGG 39 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 89 GRGGGGRGGGGRGGGGRGGGAG 110 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGG 40 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = -1 Query: 603 GGXGXGGKG-----GXXGGXGGGXXXGRXXGACKXGXVXXGXXXGXTXXXXP 463 GG G GG+G G GG GGG G G G G G T P Sbjct: 71 GGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGGKTVTIEP 122 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 460 PPPAPGGPGAPPPPPPPP 477 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP +T P PPPP P Sbjct: 63 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP-----PPPXP 743 PPP P PP +TRP P P PPP P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPP 92 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTSPPP 974 P PPP PP P PPP T+ PP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPP 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PP P PPP PPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPP 66 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPPXT 979 P PP PPPP PPP T Sbjct: 50 PAPPPKPRPPPPPPPPPTT 68 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PP T+P P Sbjct: 59 PPPPPPPPTTTRPPTTTPTP 78 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P P T Sbjct: 61 PPPPPPTTTRPPTTTPTPTT 80 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 P P P PPP PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPP 62 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP +T P PPPP P Sbjct: 63 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP-----PPPXP 743 PPP P PP +TRP P P PPP P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPP 92 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTSPPP 974 P PPP PP P PPP T+ PP Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPP 72 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PP P PPP PPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPP 66 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPPXT 979 P PP PPPP PPP T Sbjct: 50 PAPPPKPRPPPPPPPPPTT 68 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PP T+P P Sbjct: 59 PPPPPPPPTTTRPPTTTPTP 78 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P P T Sbjct: 61 PPPPPPTTTRPPTTTPTPTT 80 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 P P P PPP PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPP 62 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 449 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 463 PPPAPGGPGAPPPPPPPP 480 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G G+GG GG GGG GR G Sbjct: 18 GGGGFRGRGGGGGGGGGGFGGGRGRG 43 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 16 GGGGGGFRGRGGGGGGGGGGFG 37 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGG 32 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 69 GRGGGGRGGGGRGGGGRGGGAG 90 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGG 33 Score = 29.5 bits (63), Expect = 7.4 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -1 Query: 603 GGXGX-GGKGGXXGGXGGGXXXGRXXGACKXGXVXXGXXXGXTXXXXP 463 GG G GG+GG GG GGG G G G G G T P Sbjct: 56 GGRGAFGGRGGG-GGRGGGGRGGGGRGGGGRGGGAGGFKGGKTVTIEP 102 >AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p protein. Length = 393 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG + GGG G GGGGG Sbjct: 178 GGGGGGLLGGGGGDNGGGGG 197 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 592 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 606 PPPAPGGPGAPPPPPPPP 623 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 21 GGGGGRGFGGGGGGRGGGGGRG 42 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 16 GFGGGG-GGGGRGFGGGGGGRG 36 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 27 GFGGGGGGRGGGGGRGGGGGFG 48 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 34 GRGGGGGRGGGGGFGRGGGGRG 55 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+G GG GGG G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGG 33 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+GG GG GGG GR G Sbjct: 29 GGGGGGRGG-GGGRGGGGGFGRGGG 52 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 36 GGGGGRGGGGGFGRGGGGRGGG 57 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP+ P PPPPP P Sbjct: 385 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP+ P PPPPP P Sbjct: 385 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP+ P PPPPP P Sbjct: 501 PPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 >AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA protein. Length = 393 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG + GGG G GGGGG Sbjct: 178 GGGGGGLLGGGGGDNGGGGG 197 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 33.5 bits (73), Expect = 0.45 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP +T P PPPP P Sbjct: 45 PPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 75 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPP-----PPPXP 743 PPP P PP +TRP P P PPP P Sbjct: 40 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPP 74 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Frame = +3 Query: 915 PLPPP---PPXXPXPPPXTSPPP 974 P PPP PP P PPP T+ PP Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPP 54 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P P PP P PPP PPP Sbjct: 29 PSAPAPPPKPRPPPPPPPPP 48 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPPPXT 979 P PP PPPP PPP T Sbjct: 32 PAPPPKPRPPPPPPPPPTT 50 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP PP T+P P Sbjct: 41 PPPPPPPPTTTRPPTTTPTP 60 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P P T Sbjct: 43 PPPPPPTTTRPPTTTPTPTT 62 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 P P P PPP PPP P Sbjct: 27 PTPSAPAPPPKPRPPPPP 44 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G G+GG GG GGG GR G Sbjct: 18 GGGGFRGRGGGGGGGGGGFGGGRGRG 43 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 16 GGGGGGFRGRGGGGGGGGGGFG 37 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG GG+GG GG GGG G G Sbjct: 44 GGGDRGGRGGFGGGRGGGGRGGGGGG 69 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGGG G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGG 32 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 82 GRGGGGRGGGGRGGGGRGGGAG 103 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGG 33 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 5/52 (9%) Frame = -1 Query: 603 GGXGXGGKG-----GXXGGXGGGXXXGRXXGACKXGXVXXGXXXGXTXXXXP 463 GG G GG+G G GG GGG G G G G G T P Sbjct: 64 GGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGGKTVTIEP 115 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 21 GGGGGRGFGGGGGGRGGGGGRG 42 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 16 GFGGGG-GGGGRGFGGGGGGRG 36 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 27 GFGGGGGGRGGGGGRGGGGGFG 48 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 34 GRGGGGGRGGGGGFGRGGGGRG 55 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G GG+G GG GGG G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGG 33 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G GG+GG GG GGG GR G Sbjct: 29 GGGGGGRGG-GGGRGGGGGFGRGGG 52 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G G Sbjct: 36 GGGGGRGGGGGFGRGGGGRGGG 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG--XXXGRXXGACKXGXVXXGXXXG 484 GG G GG+GG G GGG GR G G G G Sbjct: 186 GGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGG 227 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG GGGGG G Sbjct: 198 GRGGGGFRGGAGRNGGGGGGGG 219 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 591 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 605 PPPAPGGPGAPPPPPPPP 622 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 460 PPPAPGGPGAPPPPPPPP 477 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 460 PPPAPGGPGAPPPPPPPP 477 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 460 PPPAPGGPGAPPPPPPPP 477 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P P P A P PPPPP P Sbjct: 449 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPP 974 PPP P P PP PPP Sbjct: 463 PPPAPGGPGAPPPPPPPP 480 >BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p protein. Length = 758 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 257 GGGGGVDGGGGGGGAGGGGGGG 278 >BT021210-1|AAX33358.1| 1557|Drosophila melanogaster SD09985p protein. Length = 1557 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP R ++ P PPPPP P Sbjct: 629 PPAPPPRPRKQREMTPPAVPPPPPKP 654 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P + PPPPP P Sbjct: 163 PPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAP 193 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP------XXPPPPPXP 743 PPPP PPP P + P PPPPP P Sbjct: 131 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAP 167 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPP---PPPXXPXPPPXTSPPPXP 980 P PP PPP P PP PPP P Sbjct: 165 PAPPTVEPPPPPPPAPPTVEPPPPP 189 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P PPPPP P Sbjct: 185 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 215 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 151 PPPPAPPTIKPPPPPAPP-TVEPP--PPPPPAP 180 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 161 PPPPPAPPTVEPPPPPPPAP 180 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPP P PPPP P P T Sbjct: 163 PPPAPPTVEPPPPPPPAPPT 182 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPP 970 PPPP PPPP PP Sbjct: 131 PPPPHTIEPPPPPAPP 146 Score = 29.9 bits (64), Expect = 5.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP-----PPPXP 743 PPPP P PPP P + P PP PPP P Sbjct: 140 PPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 178 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +2 Query: 920 PPPPPXXT--XPPPPXIPP 970 PPPPP T PPPP PP Sbjct: 209 PPPPPAPTELEPPPPPAPP 227 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 141 PPPAPPTLVPPPPPAPP 157 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 152 PPPAPPTIKPPPPPAPP 168 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP T PP P Sbjct: 121 PQPPASPRFDPPPPHTIEPPPP 142 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPP T PPP PP T Sbjct: 175 PPPPAPPTVEPPPPPPPAPT 194 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPPPP P Sbjct: 199 PPPPAPAEVEPPPPPAPT-----ELEPPPPPAP 226 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP 728 PPPP P PPP P + L P PP Sbjct: 210 PPPPAPTELEPPPPPAPPKVELPPPPAPP 238 >AF100152-1|AAC80557.1| 1557|Drosophila melanogaster connector enhancer of KSR proteinCNK protein. Length = 1557 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP R ++ P PPPPP P Sbjct: 629 PPAPPPRPRKQREMTPPAVPPPPPKP 654 >AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA, isoform A protein. Length = 758 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 257 GGGGGVDGGGGGGGAGGGGGGG 278 >AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC, isoform C protein. Length = 702 Score = 33.1 bits (72), Expect = 0.60 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 201 GGGGGVDGGGGGGGAGGGGGGG 222 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P + PPPPP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAP 456 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP------XXPPPPPXP 743 PPPP PPP P + P PPPPP P Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPP---PPPXXPXPPPXTSPPPXP 980 P PP PPP P PP PPP P Sbjct: 428 PAPPTVEPPPPPPPAPPTVEPPPPP 452 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P PPPPP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 414 PPPPAPPTIKPPPPPAPP-TVEPP--PPPPPAP 443 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 424 PPPPPAPPTVEPPPPPPPAP 443 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPP P PPPP P P T Sbjct: 426 PPPAPPTVEPPPPPPPAPPT 445 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPP 970 PPPP PPPP PP Sbjct: 394 PPPPHTIEPPPPPAPP 409 Score = 29.9 bits (64), Expect = 5.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP-----PPPXP 743 PPPP P PPP P + P PP PPP P Sbjct: 403 PPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +2 Query: 920 PPPPPXXT--XPPPPXIPP 970 PPPPP T PPPP PP Sbjct: 472 PPPPPAPTELEPPPPPAPP 490 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 404 PPPAPPTLVPPPPPAPP 420 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 415 PPPAPPTIKPPPPPAPP 431 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP T PP P Sbjct: 384 PQPPASPRFDPPPPHTIEPPPP 405 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPP T PPP PP T Sbjct: 438 PPPPAPPTVEPPPPPPPAPT 457 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPPPP P Sbjct: 462 PPPPAPAEVEPPPPPAPT-----ELEPPPPPAP 489 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP 728 PPPP P PPP P + L P PP Sbjct: 473 PPPPAPTELEPPPPPAPPKVELPPPPAPP 501 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 33.1 bits (72), Expect = 0.60 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PP P + PPPPP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 32.7 bits (71), Expect = 0.79 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAP 456 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP------XXPPPPPXP 743 PPPP PPP P + P PPPPP P Sbjct: 394 PPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAP 430 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXP--XXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPP---PPPXXPXPPPXTSPPPXP 980 P PP PPP P PP PPP P Sbjct: 428 PAPPTVEPPPPPPPAPPTVEPPPPP 452 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P P PPPPP P Sbjct: 448 PPPPPPPAPTKVEPPPPPAPAEVEPPPPPAP 478 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P + P PPPPP P Sbjct: 414 PPPPAPPTIKPPPPPAPP-TVEPP--PPPPPAP 443 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P P PPP P Sbjct: 424 PPPPPAPPTVEPPPPPPPAP 443 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPP P PPPP P P T Sbjct: 426 PPPAPPTVEPPPPPPPAPPT 445 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 923 PPPPXXTXPPPPXIPP 970 PPPP PPPP PP Sbjct: 394 PPPPHTIEPPPPPAPP 409 Score = 29.9 bits (64), Expect = 5.6 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 8/39 (20%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP-----PPPXP 743 PPPP P PPP P + P PP PPP P Sbjct: 403 PPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/19 (63%), Positives = 12/19 (63%), Gaps = 2/19 (10%) Frame = +2 Query: 920 PPPPPXXT--XPPPPXIPP 970 PPPPP T PPPP PP Sbjct: 472 PPPPPAPTELEPPPPPAPP 490 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 404 PPPAPPTLVPPPPPAPP 420 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPP 970 PPP P PPPP PP Sbjct: 415 PPPAPPTIKPPPPPAPP 431 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PP P PPP T PP P Sbjct: 384 PQPPASPRFDPPPPHTIEPPPP 405 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPP T PPP PP T Sbjct: 438 PPPPAPPTVEPPPPPPPAPT 457 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPXPXX--PPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PPP P PPPPP P Sbjct: 462 PPPPAPAEVEPPPPPAPT-----ELEPPPPPAP 489 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +3 Query: 651 PPPPXPXX---PPPSTRPXLALSXPXXPP 728 PPPP P PPP P + L P PP Sbjct: 473 PPPPAPTELEPPPPPAPPKVELPPPPAPP 501 >AE014297-1933|AAF55130.1| 537|Drosophila melanogaster CG3984-PA protein. Length = 537 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P P PP P P P T+PPP P Sbjct: 268 PANPTPPPRPIPVPVTTPPPDP 289 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP RP P PPP P P Sbjct: 51 PPPPPPS--PPCGRPPPGSPPPGPPPPGPPP 79 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +3 Query: 921 PPPPPXXPXP-PPXTSPPPXP 980 PPPPP P PP SPPP P Sbjct: 52 PPPPPSPPCGRPPPGSPPPGP 72 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P P P PPPS P P PPP P P Sbjct: 46 PDPTRPPPPPPS--PPCGRPPPGSPPPGPPP 74 >AE013599-2454|AAF57874.1| 1557|Drosophila melanogaster CG6556-PA protein. Length = 1557 Score = 33.1 bits (72), Expect = 0.60 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 666 PXXPPPSTRPXLALSXPXXPPPPPXP 743 P PPP R ++ P PPPPP P Sbjct: 629 PPAPPPRPRKQREMTPPAVPPPPPKP 654 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 26 GGGGGGYGGGGGGGYGGGGG 45 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 27 GGGGGYGGGGGGGYGGGGGG 46 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 34 GGGGGGYGGGGGGQSGYGGG 53 >AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p protein. Length = 335 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 29 GGGGGLNLGGGGGNGGGGGGSG 50 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG + GG G GGGGG Sbjct: 28 GGGGGGLNLGGGGGNGGGGG 47 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGG 44 >AY061579-1|AAL29127.1| 613|Drosophila melanogaster SD02991p protein. Length = 613 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P P P A P PPPP Sbjct: 464 PPPPVPDQHSPKMSPPNAAPPPPPPPPP 491 >AF247763-1|AAF74194.1| 613|Drosophila melanogaster SCAR protein. Length = 613 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P P P A P PPPP Sbjct: 464 PPPPVPDQHSPKMSPPNAAPPPPPPPPP 491 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 26 GGGGGGYGGGGGGGYGGGGG 45 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 27 GGGGGYGGGGGGGYGGGGGG 46 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 34 GGGGGGYGGGGGGQSGYGGG 53 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 26 GGGGGGYGGGGGGGYGGGGG 45 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 27 GGGGGYGGGGGGGYGGGGGG 46 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGG 46 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 34 GGGGGGYGGGGGGQSGYGGG 53 >AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA protein. Length = 376 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 29 GGGGGLNLGGGGGNGGGGGGSG 50 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG + GG G GGGGG Sbjct: 28 GGGGGGLNLGGGGGNGGGGG 47 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG GGGG G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGG 44 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 651 PPPPXPXXP--PPSTRPXLALSXPXXPPPP 734 PPPP P P PP P + + P PPPP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P + P PPPPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 271 PPPPPPPMAPAAPP---PPPPP 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP P + ++ PPPPP P Sbjct: 286 PPPPINGAAPPPPPPPM-INGGALPPPPPPP 315 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP PP PPP Sbjct: 270 TPPPPPPPMAPAAPPPPPPP 289 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP P P PPP Sbjct: 269 TTPPPPPPPMAPAAPPPPPP 288 >AE014134-2001|AAF53042.1| 613|Drosophila melanogaster CG4636-PA protein. Length = 613 Score = 32.7 bits (71), Expect = 0.79 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPPP P P P A P PPPP Sbjct: 464 PPPPVPDQHSPKMSPPNAAPPPPPPPPP 491 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 32.7 bits (71), Expect = 0.79 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 651 PPPPXPXXP--PPSTRPXLALSXPXXPPPP 734 PPPP P P PP P + + P PPPP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P + P PPPPP P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P PP PPP P Sbjct: 271 PPPPPPPMAPAAPP---PPPPP 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP PP P + ++ PPPPP P Sbjct: 286 PPPPINGAAPPPPPPPM-INGGALPPPPPPP 315 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP PP PPP Sbjct: 270 TPPPPPPPMAPAAPPPPPPP 289 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 914 TXPPPPPXXTXPPPPXIPPP 973 T PPPPP P P PPP Sbjct: 269 TTPPPPPPPMAPAAPPPPPP 288 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PL PPPP P PPP PPP Sbjct: 268 PLAPPPPPPPPPPP--PPPP 285 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 930 PPXXPXPPPXTSPPPXP 980 PP P PPP PPP P Sbjct: 267 PPLAPPPPPPPPPPPPP 283 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP 728 PPPP P PPP + +S PP Sbjct: 275 PPPPPPPPPPPQQQQQQYISTGVPPP 300 >AY122075-1|AAM52587.1| 503|Drosophila melanogaster AT17506p protein. Length = 503 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG V GGG G G GGG Sbjct: 448 GVGGGGVGGGGAGGVGSGGG 467 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 147 GGGSAGGGGGGGGGGGGG 164 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG G GG GGG G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG GGGGG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGG 159 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P +P A P PPPPP P Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPP 488 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 476 PPPPPPPPPPPPPP 489 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 477 PPPPPPPPPPPPPP 490 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 472 PAAAPPPPPPPPPP---PPPPP 490 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P +P A P PPPPP P Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 658 PPPPPPPPPPPPPP 671 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 659 PPPPPPPPPPPPPP 672 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 654 PAAAPPPPPPPPPP---PPPPP 672 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 147 GGGSAGGGGGGGGGGGGG 164 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG G GG GGG G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG GGGGG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGG 159 >AJ252082-1|CAB64385.1| 979|Drosophila melanogaster BAB-I protein protein. Length = 979 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG V GGG G G GGG Sbjct: 471 GVGGGGVGGGGAGGVGSGGG 490 >AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA protein. Length = 263 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 144 GAGGGGSAGGGGGGGGGGGG 163 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 147 GGGSAGGGGGGGGGGGGG 164 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXG 538 GG G GG G GG GGG G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGG 164 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG GGGGG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGG 159 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PL PPPP P PPP PPP Sbjct: 266 PLAPPPPPPPPPPP--PPPP 283 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 930 PPXXPXPPPXTSPPPXP 980 PP P PPP PPP P Sbjct: 265 PPLAPPPPPPPPPPPPP 281 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPP 728 PPPP P PPP + +S PP Sbjct: 273 PPPPPPPPPPPQQQQQQYISTGVPPP 298 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P +P A P PPPPP P Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 658 PPPPPPPPPPPPPP 671 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 659 PPPPPPPPPPPPPP 672 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 654 PAAAPPPPPPPPPP---PPPPP 672 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 657 PPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P P +P A P PPPPP P Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPP 670 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 658 PPPPPPPPPPPPPP 671 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 659 PPPPPPPPPPPPPP 672 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P PPP PPP P Sbjct: 654 PAAAPPPPPPPPPP---PPPPP 672 >AE014296-173|AAS64927.1| 526|Drosophila melanogaster CG9097-PA, isoform A protein. Length = 526 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG V GGG G G GGG Sbjct: 471 GVGGGGVGGGGAGGVGSGGG 490 >AE014296-172|AAF47439.2| 977|Drosophila melanogaster CG9097-PB, isoform B protein. Length = 977 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG V GGG G G GGG Sbjct: 471 GVGGGGVGGGGAGGVGSGGG 490 >AE013599-1228|AAF58703.1| 120|Drosophila melanogaster CG13227-PA protein. Length = 120 Score = 32.3 bits (70), Expect = 1.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 927 PPPXXPXPPPXTSPPPXP 980 PPP P PPP PPP P Sbjct: 65 PPPFGPPPPPFFGPPPPP 82 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 57 GWGGGGGWGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPG 80 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 223 GHGGGGHGGGGFGPGGGGGG 242 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 285 GHGGGGGFKGGYGGGGGGGGGG 306 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 178 GFGGG--IGGGGGHSGGGGGIG 197 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGG 308 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 155 GGGGGIGGGGGHSGGGSGIG 174 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 288 GGGGFKGGYGGGGGGGGGGGGGYG 311 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 147 GFGSGGYSGGGGGIGGGGGHSG 168 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGGGYG 311 >BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p protein. Length = 1596 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P+PPPP P P P SPP Sbjct: 636 PIPPPPANVPPPEPPRSPP 654 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 26 GGGGAGGGGGGGGGGSGGPG 45 >AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p protein. Length = 155 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSG 77 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXV 505 GG G GG GG GG GGG G G G + Sbjct: 55 GGGGGGGSGG-GGGGGGGAGGGSGSGEGGGGAI 86 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 55 GGGGGGGSGGGGGGGGGAGG 74 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGG G G Sbjct: 58 GGGGSGGGGGGGGGAGGGSGSG 79 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPP--STRPXLALSXPXXPPPPPXP 743 PP P PPP + P +S P PPPP P Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPP 387 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPP ++ P PPPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 383 PPPPPPPPAAVPPP--PPPPMP 402 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+ PPP P PP PPP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPP 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 385 PPPPPPAAVPPPP--PPP 400 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 914 TXPPPPP---XXTXPPPPXIPPP 973 T PPPPP PPPP PPP Sbjct: 368 TAPPPPPVSAPVVAPPPPPPPPP 390 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PP T+PPP P Sbjct: 357 PPPPNRP-PPISTAPPPPP 374 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P + P PPPPP P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPP-PPPPPMP 402 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 496 PXXXPXXLTCPXXAPXXXP--APXPPXXXPLASXSPPP 603 P P T P P P AP PP P A+ PPP Sbjct: 360 PNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP PPP + P PPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 >AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p protein. Length = 108 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 57 GWGGGGGWGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPG 80 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGG 369 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -1 Query: 603 GGXGXGG--KGGXXGGXGGGXXXGRXXG 526 GG G GG +GG GG GGG GR G Sbjct: 337 GGRGGGGNFRGGRGGGGGGGFGGGRGGG 364 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGG 369 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GG G GGGGG Sbjct: 351 GGGGGGFGGGRGGGGGGGGG 370 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 55 GGGGGGGGGGSGGGGGGGSG 74 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 55 GGGGGGGGGGSGGGGGGGSG 74 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 55 GGGGGGGGGGSGGGGGGGSG 74 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 55 GGGGGGGGGGSGGGGGGGSG 74 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG GGGGG G Sbjct: 55 GGGGGGGGGGSGGGGGGGSG 74 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGG G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSG 76 >AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 65 GGGGGSGSGGGSGSGDGGGG 84 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 59 GGGGGGSGGGGGGGSGSGGGSG 80 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 68 GGGGGSGSGGGSGSGDGGGG 87 >AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGG Sbjct: 65 GGGGGSGSGGGSGSGDGGGG 84 >AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 57 GWGGGGGWGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPG 80 >AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-PB, isoform B protein. Length = 1596 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P+PPPP P P P SPP Sbjct: 636 PIPPPPANVPPPEPPRSPP 654 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 26 GGGGAGGGGGGGGGGSGGPG 45 >AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-PA, isoform A protein. Length = 1596 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPP 971 P+PPPP P P P SPP Sbjct: 636 PIPPPPANVPPPEPPRSPP 654 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GG GG G Sbjct: 26 GGGGAGGGGGGGGGGSGGPG 45 >AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA protein. Length = 1868 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 156 GSGGGGGGGGGGGGGGGGGG 175 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 159 GGGGGGGGGGGGGGGGGG 176 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGG 923 G GGG GGG G GGGG Sbjct: 158 GGGGGGGGGGGGGGGGGGG 176 >AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA protein. Length = 110 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 57 GWGGGGGWGGGGGGGGGGGG 76 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGG 920 GGG GGG G GGGGG Sbjct: 60 GGGGWGGGGGGGGGGGGG 77 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPG 80 >AE014298-1194|AAF46386.3| 1195|Drosophila melanogaster CG11219-PA protein. Length = 1195 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP P PP+ RP PPP P Sbjct: 902 PPPPLPQRRPPTKRPATPPIYDAVPPPLP 930 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPP--STRPXLALSXPXXPPPPPXP 743 PP P PPP + P +S P PPPP P Sbjct: 324 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPP 354 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPP ++ P PPPPP Sbjct: 330 PPPISTAPPPPPVSAPVVAPPPPPPPPP 357 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 350 PPPPPPPPAAVPPP--PPPPMP 369 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+ PPP P PP PPP P Sbjct: 345 PVVAPPPPPPPPPAAVPPPPPP 366 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 352 PPPPPPAAVPPPP--PPP 367 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 914 TXPPPPP---XXTXPPPPXIPPP 973 T PPPPP PPPP PPP Sbjct: 335 TAPPPPPVSAPVVAPPPPPPPPP 357 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PP T+PPP P Sbjct: 324 PPPPNRP-PPISTAPPPPP 341 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P + P PPPPP P Sbjct: 338 PPPPVSAPVVAPPPPPPPPPAAVPP-PPPPPMP 369 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 496 PXXXPXXLTCPXXAPXXXP--APXPPXXXPLASXSPPP 603 P P T P P P AP PP P A+ PPP Sbjct: 327 PNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 364 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP PPP + P PPPP Sbjct: 330 PPPISTAPPPPPVSAPVVAPPPPPPPPP 357 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPP--STRPXLALSXPXXPPPPPXP 743 PP P PPP + P +S P PPPP P Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPP 387 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPP ++ P PPPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 383 PPPPPPPPAAVPPP--PPPPMP 402 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+ PPP P PP PPP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPP 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 385 PPPPPPAAVPPPP--PPP 400 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 914 TXPPPPP---XXTXPPPPXIPPP 973 T PPPPP PPPP PPP Sbjct: 368 TAPPPPPVSAPVVAPPPPPPPPP 390 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PP T+PPP P Sbjct: 357 PPPPNRP-PPISTAPPPPP 374 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P + P PPPPP P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPP-PPPPPMP 402 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 496 PXXXPXXLTCPXXAPXXXP--APXPPXXXPLASXSPPP 603 P P T P P P AP PP P A+ PPP Sbjct: 360 PNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP PPP + P PPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 2/31 (6%) Frame = +3 Query: 657 PPXPXXPPP--STRPXLALSXPXXPPPPPXP 743 PP P PPP + P +S P PPPP P Sbjct: 357 PPPPNRPPPISTAPPPPPVSAPVVAPPPPPP 387 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPP PPP ++ P PPPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP PPP PPP P Sbjct: 383 PPPPPPPPAAVPPP--PPPPMP 402 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P+ PPP P PP PPP P Sbjct: 378 PVVAPPPPPPPPPAAVPPPPPP 399 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPP 973 PPPPP PPPP PPP Sbjct: 385 PPPPPPAAVPPPP--PPP 400 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 3/23 (13%) Frame = +2 Query: 914 TXPPPPP---XXTXPPPPXIPPP 973 T PPPPP PPPP PPP Sbjct: 368 TAPPPPPVSAPVVAPPPPPPPPP 390 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PP T+PPP P Sbjct: 357 PPPPNRP-PPISTAPPPPP 374 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 651 PPPPX--PXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P + P PPPPP P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPP-PPPPPMP 402 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 496 PXXXPXXLTCPXXAPXXXP--APXPPXXXPLASXSPPP 603 P P T P P P AP PP P A+ PPP Sbjct: 360 PNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPP 397 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPP 734 PPP PPP + P PPPP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPP 390 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGG 369 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -1 Query: 603 GGXGXGG--KGGXXGGXGGGXXXGRXXG 526 GG G GG +GG GG GGG GR G Sbjct: 337 GGRGGGGNFRGGRGGGGGGGFGGGRGGG 364 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGG 369 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GG G GGGGG Sbjct: 351 GGGGGGFGGGRGGGGGGGGG 370 >AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA protein. Length = 155 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G G GGG G Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSG 77 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXV 505 GG G GG GG GG GGG G G G + Sbjct: 55 GGGGGGGSGG-GGGGGGGAGGGSGSGEGGGGAI 86 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GG GG Sbjct: 55 GGGGGGGSGGGGGGGGGAGG 74 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG G GGG G G Sbjct: 58 GGGGSGGGGGGGGGAGGGSGSG 79 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G GGGGG Sbjct: 209 GHGGGGHGGGGFGPGGGGGG 228 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGG 292 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 164 GFGGG--IGGGGGHSGGGGGIG 183 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG G G G GGGGG G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGG 294 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIG 160 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 2/24 (8%) Frame = -3 Query: 979 GXGG--GDVXGGGXGXXGGGGGXG 914 G GG G GGG G GGGGG G Sbjct: 274 GGGGFKGGYGGGGGGGGGGGGGYG 297 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G GGG G GGGG G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSG 154 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 600 GXGXGGKGGXXGGXGGGXXXGRXXG 526 G G G KGG GG GGG G G Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYG 297 >EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-peptidase protein. Length = 528 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 P PPPPP P PP + PP Sbjct: 229 PPPPPPPPLPTPPAVVTVPP 248 Score = 30.7 bits (66), Expect = 3.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPP 731 P PP P PP T P + P PPP Sbjct: 227 PAPPPPPPPPLPTPPAVVTVPPATPPP 253 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPP 734 P P P PPP P ++ P PPP Sbjct: 227 PAPPPPPPPPLPTPPAVVTVPPATPPP 253 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/25 (52%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +3 Query: 915 PLPPPPPXXPXPPP---XTSPPPXP 980 P PPPPP P P P T PP P Sbjct: 227 PAPPPPPPPPLPTPPAVVTVPPATP 251 >BT011350-1|AAR96142.1| 489|Drosophila melanogaster RH05790p protein. Length = 489 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P PPP T Sbjct: 453 PPPPPSLTLPPLPP-PPPTT 471 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 549 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 574 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P S+ P P PPP P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPPP 728 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 918 LPPPPPXXPXPPPXTS--PPPXP 980 LPPPPP P P +S PPP P Sbjct: 695 LPPPPPPMPASPTASSAAPPPPP 717 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPP P P PPP SP P Sbjct: 715 PPPPPAPPAPPPPPGFSPLGSP 736 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 713 PPPPPPPAPPAPPP 726 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P P S A P PP PP P Sbjct: 696 PPPPPPM--PASPTASSAAPPPPPPPAPPAP 724 >AY119154-1|AAM51014.1| 380|Drosophila melanogaster RE65163p protein. Length = 380 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P PPP T Sbjct: 344 PPPPPSLTLPPLPP-PPPTT 362 >AY119067-1|AAM50927.1| 217|Drosophila melanogaster LP08165p protein. Length = 217 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 924 PPPPXXPXPPPXTSPPPXP 980 PPPP P PPP +PPP P Sbjct: 98 PPPP--PPPPPAPAPPPPP 114 Score = 29.9 bits (64), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 915 PLPPPPPXXPXPPP 956 P PPPPP P PPP Sbjct: 99 PPPPPPPPAPAPPP 112 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 165 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 190 >AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-PA protein. Length = 991 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 30 GGGGGGGGGGGLGGYGGGGSGG 51 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 27 GGGGGGGGGGGGGGLGGYGGGG 48 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGGG G Sbjct: 24 GAGGG---GGGGGGGGGGGGLG 42 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGGG G Sbjct: 118 GGGGGGHSGGGGGWSSGGGGGG 139 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG GGG GGGGG G Sbjct: 55 GSSGGGGGGGGWSSGGGGGGGG 76 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 579 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 604 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 579 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 604 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 165 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 190 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 P PP P PP TRP P PP PP P Sbjct: 165 PGPPGPPGPPGPTRP-----GPYGPPGPPGP 190 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPP 737 PPPP PPP + P P PPP Sbjct: 306 PPPPPKYLPPPQVKQGYDYPKPAIPFPPP 334 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PP PP T PPP PPP T Sbjct: 1262 PPLPPSRTSAPPPPPPPPST 1281 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPP 974 PLPP PP PP PPP Sbjct: 1260 PLPPLPPSRTSAPPPPPPPP 1279 >AE014134-2891|AAN11175.1| 475|Drosophila melanogaster CG5674-PC, isoform C protein. Length = 475 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P PPP T Sbjct: 439 PPPPPSLTLPPLPP-PPPTT 457 >AE014134-2886|AAN11174.1| 489|Drosophila melanogaster CG5674-PA, isoform A protein. Length = 489 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +2 Query: 920 PPPPPXXTXPPPPXIPPPXT 979 PPPPP T PP P PPP T Sbjct: 453 PPPPPSLTLPPLPP-PPPTT 471 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPPP P P PPP P Sbjct: 187 PPPPPPPYYPPYPYYPPPPPPP 208 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = +3 Query: 915 PLPPPP--PXXPXPPPXTSPPPXP 980 P PPPP P P PP PPP P Sbjct: 188 PPPPPPYYPPYPYYPPPPPPPPLP 211 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 654 PPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPP P PPP P P PPP P P Sbjct: 186 PPPPP--PPPYYPPYPYYPPPPPPPPLPPP 213 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 921 PPPPPXXPXPPPXTSPPPXP 980 PPPPP P PP PP P Sbjct: 186 PPPPPPPPYYPPYPYYPPPP 205 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PPPP P PP P P PPPPP P Sbjct: 188 PPPPPPYYPP---YPY----YPPPPPPPPLP 211 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G G GG GG GGG G G+ G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 104 GSGGGFGGGGSIGGFGGGGGGG 125 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG G GG+GG GG GGG G G + G Sbjct: 654 GGGGFGGRGG--GGRGGGGGFGGRGGGGRGG 682 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 674 GRGGGGRGGGGFGGRGGRGGGG 695 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG G G G GGGGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFG 673 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G G GG GG GGG G G+ G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 104 GSGGGFGGGGSIGGFGGGGGGG 125 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 70 GGGFSSGGGGGFSSGGGGGG 89 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFG 98 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 >BT003608-1|AAO39611.1| 377|Drosophila melanogaster GH19274p protein. Length = 377 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP + PP P Sbjct: 112 PCPPPPSCGSCPPPPSCGPPCP 133 >BT003318-1|AAO25078.1| 517|Drosophila melanogaster AT26991p protein. Length = 517 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP + PP P Sbjct: 252 PCPPPPSCGSCPPPPSCGPPCP 273 >BT001317-1|AAN71072.1| 517|Drosophila melanogaster AT15066p protein. Length = 517 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 915 PLPPPPPXXPXPPPXTSPPPXP 980 P PPPP PPP + PP P Sbjct: 252 PCPPPPSCGSCPPPPSCGPPCP 273 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G+ GGG G GGGGG G Sbjct: 84 GPGYGNGGGGGGGGYGGGGGGG 105 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGG G Sbjct: 51 GGGGYNAGGGGGGYYNGGGGGG 72 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 61 GGGGGGYSGGYSGGHGGGGGYG 82 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G G GG GG GGG G G Sbjct: 132 GGYGGGSSGGYSGGHGGGWSSGGGYG 157 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 80 GYGGGGYGGGGYGGGGHGGG 99 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G G GG GG GGG G G+ G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 104 GSGGGFGGGGSIGGFGGGGGGG 125 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 70 GGGFSSGGGGGFSSGGGGGG 89 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFG 98 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG G GG+GG GG GGG G G + G Sbjct: 654 GGGGFGGRGG--GGRGGGGGFGGRGGGGRGG 682 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 674 GRGGGGRGGGGFGGRGGRGGGG 695 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG G G G GGGGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFG 673 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 36 GGGGGGYSGGYSGGHGGGGGYG 57 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXG 526 GG G G GG GG GGG G G Sbjct: 107 GGYGGGSSGGYSGGHGGGWSSGGGYG 132 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGG 920 G GGG GGG G G GGG Sbjct: 55 GYGGGGYGGGGYGGGGHGGG 74 >AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA, isoform A protein. Length = 2602 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP RP +++ P PP P P Sbjct: 1432 PPAPSVPAPPPPIRPP-SMAPPAPPPAPQSP 1461 >AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB, isoform B protein. Length = 2693 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 651 PPPPXPXXPPPSTRPXLALSXPXXPPPPPXP 743 PP P PPP RP +++ P PP P P Sbjct: 1523 PPAPSVPAPPPPIRPP-SMAPPAPPPAPQSP 1552 >AE014298-846|AAF46127.2| 2893|Drosophila melanogaster CG15899-PB protein. Length = 2893 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGG 550 GG G GG GG GG GGG Sbjct: 2651 GGVGGGGSGGGGGGLGGG 2668 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXGXVXXG 496 GG G G GG GG GGG G G+ G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GG G GGGGG G Sbjct: 104 GSGGGFGGGGSIGGFGGGGGGG 125 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG GGG G GGGG G Sbjct: 70 GGGFSSGGGGGFSSGGGGGG 89 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGG-GGGXG 914 G GGG GGG G GG GGG G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFG 98 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GGG G Sbjct: 86 GGGGGGGFGGGFGGGSGGGSGG 107 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G G G+ GGG G GGGGG G Sbjct: 84 GPGYGNGGGGGGGGYGGGGGGG 105 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GG + GGG G GGGG G Sbjct: 51 GGGGYNAGGGGGGYYNGGGGGG 72 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 603 GGXGXGGKGGXXGGXGGGXXXGRXXGACKXG 511 GG G GG+GG GG GGG G G + G Sbjct: 654 GGGGFGGRGG--GGRGGGGGFGGRGGGGRGG 682 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 979 GXGGGDVXGGGXGXXGGGGGXG 914 G GGG GGG G GG GG G Sbjct: 674 GRGGGGRGGGGFGGRGGRGGGG 695 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 973 GGGDVXGGGXGXXGGGGGXG 914 GGG G G G GGGGG G Sbjct: 654 GGGGFGGRGGGGRGGGGGFG 673 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,866,357 Number of Sequences: 53049 Number of extensions: 627322 Number of successful extensions: 34540 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22934 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4935487923 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -