BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P24 (951 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CY... 27 1.1 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 24 5.9 >AY062204-1|AAL58565.1| 150|Anopheles gambiae cytochrome P450 CYP4C28 protein. Length = 150 Score = 26.6 bits (56), Expect = 1.1 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 283 LWCKVERNLRVFPFFEVAQSTVNTGVNSDLVH 188 L C ++ +LR+FP + T+ TGV+ + H Sbjct: 61 LECCIKESLRLFPSIPILSRTLTTGVDIEGHH 92 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 24.2 bits (50), Expect = 5.9 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +2 Query: 359 NADACTLTSCPTEAGKTQTLDFSLHIGKKLPTGNFEFKWK 478 N A PT+A + D+ LH G+ F K K Sbjct: 493 NTTAIQFLGRPTDADRYDAHDYHLHTGRNAMVKEFATKLK 532 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 729,550 Number of Sequences: 2352 Number of extensions: 13201 Number of successful extensions: 39 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 104189652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -