BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P24 (951 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025467-10|AAB71040.2| 154|Caenorhabditis elegans He1 homologu... 60 2e-09 AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical ... 30 2.1 Z77656-5|CAH04702.1| 308|Caenorhabditis elegans Hypothetical pr... 28 8.5 >AF025467-10|AAB71040.2| 154|Caenorhabditis elegans He1 homologue protein 1 protein. Length = 154 Score = 60.1 bits (139), Expect = 2e-09 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%) Frame = +2 Query: 131 EFNVVTTRLCREVDASACTVNEVRIDPCV-----NSRLCHLKKGKNAKVSFDFTPQFSTT 295 EF + ++C+ S TV++V+ D C ++C KKG + F P T Sbjct: 16 EFIEIGYKVCK----SDGTVSQVKADGCELTVKDGKKVCLFKKGSRPIIQIAFKPSKDTD 71 Query: 296 KLKTGLFGLKNGAEIPFDALYNADACTL-TSCPTEAGKTQTLDFSLHIGKKLPTGN-FEF 469 KLKT + G+ + N+DACT CP AG+ Q + S+ I + P G + Sbjct: 72 KLKTSVRAKVGGSAMVDFPQTNSDACTYGVKCPVSAGENQIFEQSISITENHPAGEVIQV 131 Query: 470 KWKLWNEDNESQMC 511 W+L D+ ++C Sbjct: 132 NWQLTRPDSGKEVC 145 >AL023838-4|CAA19504.1| 218|Caenorhabditis elegans Hypothetical protein Y43C5A.4 protein. Length = 218 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 204 LTPVLTVDCATSKKGKTRRFLSTLH 278 LTP++T C+ KGK ++ LS+ H Sbjct: 31 LTPIITAQCSKKPKGKKKKKLSSSH 55 >Z77656-5|CAH04702.1| 308|Caenorhabditis elegans Hypothetical protein F07B10.6 protein. Length = 308 Score = 28.3 bits (60), Expect = 8.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 452 TGNFEFKWKLWNEDNESQMCCY 517 +G+F F ++L+N+D SQ C+ Sbjct: 59 SGHFVFNYQLFNDDKSSQAACF 80 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,946,732 Number of Sequences: 27780 Number of extensions: 305577 Number of successful extensions: 793 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 792 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2465154230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -