BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P24 (951 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66130.1 68418.m08331 cell cycle checkpoint protein-related w... 30 2.6 At5g01730.1 68418.m00091 expressed protein 29 6.0 At2g46370.2 68415.m05771 auxin-responsive GH3 family protein sim... 29 6.0 At2g46370.1 68415.m05770 auxin-responsive GH3 family protein sim... 29 6.0 At4g19280.1 68417.m02842 hypothetical protein 28 7.9 At4g16640.1 68417.m02515 matrix metalloproteinase, putative meta... 28 7.9 At4g03890.1 68417.m00546 hypothetical protein contains Pfam prof... 28 7.9 At1g64140.1 68414.m07266 expressed protein similar to putative d... 28 7.9 >At5g66130.1 68418.m08331 cell cycle checkpoint protein-related weak similarity to cell cycle checkpoint protein RAD17 [Homo sapiens] GI:4102916 Length = 599 Score = 29.9 bits (64), Expect = 2.6 Identities = 24/102 (23%), Positives = 44/102 (43%) Frame = +2 Query: 143 VTTRLCREVDASACTVNEVRIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTGLFGL 322 V R+CRE C V + ID + ++ + F P+ + TK+K+ G+ Sbjct: 298 VLQRICRE---EHCKVTTMEIDQMATASGGDIRHAITSLQLFSVKPELNHTKIKSPRPGM 354 Query: 323 KNGAEIPFDALYNADACTLTSCPTEAGKTQTLDFSLHIGKKL 448 ++ +Y+ ++SC G+ +TL +GK L Sbjct: 355 EDNYHGNEQTMYSGLDSGISSC---FGRDETLSLFHALGKFL 393 >At5g01730.1 68418.m00091 expressed protein Length = 1192 Score = 28.7 bits (61), Expect = 6.0 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 1/97 (1%) Frame = +2 Query: 164 EVDASACTVNEVRIDPCVN-SRLCHLKKGKNAKVSFDFTPQFSTTKLKTGLFGLKNGAEI 340 + +A AC V EVR DP +N S HL K +V D + +F ++ +EI Sbjct: 526 KANAEACEVFEVRRDPMLNISPETHLL--KVTQVPQDAYEGGTNDVHSQHVFSVETASEI 583 Query: 341 PFDALYNADACTLTSCPTEAGKTQTLDFSLHIGKKLP 451 AL ++T+ EA +++ D S G +P Sbjct: 584 SVSALVEDQFSSITNQEIEALESE--DISSEAGHFIP 618 >At2g46370.2 68415.m05771 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 404 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 514 K + +DFS +I G++ W++ E NE Q CC Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494 >At2g46370.1 68415.m05770 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +2 Query: 404 KTQTLDFSLHIGKKLPTGNFEFKWKLWNEDNES--QMCC 514 K + +DFS +I G++ W++ E NE Q CC Sbjct: 456 KIEVIDFSSYIDVSTDPGHYAIFWEISGETNEDVLQDCC 494 >At4g19280.1 68417.m02842 hypothetical protein Length = 254 Score = 28.3 bits (60), Expect = 7.9 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = +1 Query: 505 DVLLQNVKKLALSTLLTDCVVNTLCMYLHKKC 600 D+++QN+++ +T+L+ + + C Y K C Sbjct: 27 DLIVQNIERQCFNTVLSIIICLSTCFYFSKTC 58 >At4g16640.1 68417.m02515 matrix metalloproteinase, putative metalloproteinase [Arabidopsis thaliana] GI:3128477; contains InterPro accession IPR001818: Matrixin Length = 364 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 260 VSFDFTPQFSTTKLKTGLFGLKNGAEIPFDAL 355 VSF+ F+T LK G + +G +PFD + Sbjct: 199 VSFEEVDDFTTADLKIGFYAGDHGDGLPFDGV 230 >At4g03890.1 68417.m00546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 301 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 329 GAEIPFDALYNADACTLTSCPTE 397 G EI F+ +YN D T T PTE Sbjct: 241 GREIRFEEVYNEDVQTRTKAPTE 263 >At1g64140.1 68414.m07266 expressed protein similar to putative disease resistance protein GB:CAB40943 GI:4586107 from [Arabidopsis thaliana]; weak similarity to Loricrin (Swiss-Prot:P23490) [Homo sapiens] Length = 646 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 4/38 (10%) Frame = +2 Query: 359 NADACTLTSCPTEAGKTQT----LDFSLHIGKKLPTGN 460 +A ACT S E + + LDFSLH+G + PT + Sbjct: 84 SATACTSLSSARETEEASSMDIELDFSLHLGNEKPTAS 121 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,856,173 Number of Sequences: 28952 Number of extensions: 279515 Number of successful extensions: 777 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2285480280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -