BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P19 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 30 2.9 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 3.9 SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) 28 9.0 SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 28 9.0 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/82 (24%), Positives = 20/82 (24%) Frame = +2 Query: 632 PPXXXXXXXPXXXPPXXXXPXXXXXXXXPXXPXPPXGGAXXXXXXXPXXPXXXPXXXXXX 811 PP P PP P P P PP P P P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPN----PPYPPPPNPPYPPPPNAPNP 204 Query: 812 PXPXXXXXPPXXXXXPXXXPXP 877 P P PP P P P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPP 226 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/87 (24%), Positives = 21/87 (24%), Gaps = 5/87 (5%) Frame = +2 Query: 632 PPXXXXXXXPXXXPPXXXXPXXXXXXXXPXXPXPPXGGAXXXXXXXPXXP-----XXXPX 796 PP P PP P P P PP A P P P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 797 XXXXXPXPXXXXXPPXXXXXPXXXPXP 877 P P PP P P P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPP 170 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +2 Query: 632 PPXXXXXXXPXXXPPXXXXPXXXXXXXXPXXPXPPXGGAXXXXXXXPXXPXXXPXXXXXX 811 PP P PP P P P PP G P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 812 PXPXXXXXPP 841 P P PP Sbjct: 406 PPPPPTNGPP 415 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/70 (24%), Positives = 17/70 (24%) Frame = +1 Query: 631 PXXPXXPPXPXXXXPXXXXPPXXXXXXXXXXPXPPXXGGXXXXXXXPXXXXXPPXXXXXX 810 P P PP P P PP P PP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Query: 811 PXXXXXXXPP 840 P PP Sbjct: 432 PALRLACAPP 441 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/67 (23%), Positives = 16/67 (23%) Frame = +2 Query: 671 PPXXXXPXXXXXXXXPXXPXPPXGGAXXXXXXXPXXPXXXPXXXXXXPXPXXXXXPPXXX 850 PP P P P PP P P P P P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 851 XXPXXXP 871 P P Sbjct: 425 PPPPPPP 431 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 185 SSADRAESQHQREDEAQNTYKIHFTEIL*CRRIQNSN 75 + D E + + E+E +++Y+ +TEIL RR+ + N Sbjct: 341 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 377 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = -3 Query: 185 SSADRAESQHQREDEAQNTYKIHFTEIL*CRRIQNSN 75 + D E + + E+E +++Y+ +TEIL RR+ + N Sbjct: 985 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRVVSFN 1021 >SB_5940| Best HMM Match : Antimicrobial_3 (HMM E-Value=2.4) Length = 409 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -3 Query: 236 VASHFLNFLEELPPGLGSSADRAESQHQREDEAQNTYKI 120 + S L+ +E+ PG+G DR + R+ EAQ ++ Sbjct: 12 IMSRILSTIEKTQPGVGVVHDRQRTHDPRDKEAQEEERV 50 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 Query: 232 RPTFSIFLKSFHLGSGAALTAPRASTN 152 RP+F + LKS G+GAA P TN Sbjct: 1831 RPSFKLVLKSLEEGNGAARVRPCRITN 1857 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,572,322 Number of Sequences: 59808 Number of extensions: 272354 Number of successful extensions: 671 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -