BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P17 (953 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 26 1.9 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 24 5.9 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 25.8 bits (54), Expect = 1.9 Identities = 14/55 (25%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Frame = -3 Query: 315 GVSCFRYVYIGYISVIVSHGYSRFIFRPQNKPIFTFTSIK-*TKKYYTNQHVNYF 154 G C+R Y Y S+ + H S + KP + +K +H+NY+ Sbjct: 351 GEKCYRCEYCPYASISMRHLESHLLLHTDQKPYKCDQCAQTFRQKQLLKRHMNYY 405 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 24.2 bits (50), Expect = 5.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +1 Query: 415 FLTRDLIWMHWQNVLKGYYFYI 480 FLTR +W+ W+ L+ + Y+ Sbjct: 384 FLTRGGLWLSWEEGLQHFLKYL 405 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 738,949 Number of Sequences: 2352 Number of extensions: 13908 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 104603103 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -