BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P15 (949 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 38 0.009 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.021 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 36 0.048 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.063 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 35 0.11 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 33 0.34 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.59 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.59 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.59 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.4 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.4 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 31 1.4 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 31 1.4 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 31 1.8 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.0 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 30 2.4 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 30 2.4 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 30 3.1 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 30 3.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.1 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.2 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 29 4.2 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 4.2 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 29 4.2 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 4.2 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 4.2 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 29 4.2 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 4.2 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 29 4.2 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 29 4.2 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 5.5 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 5.5 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 29 5.5 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 5.5 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.3 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 7.3 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 7.3 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 7.3 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 29 7.3 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 9.6 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 9.6 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 28 9.6 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 813 AGXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 A APPP PP PPP P P PP P P H Sbjct: 70 AAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 813 AGXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 A APPP P PPP P P PP P P P Sbjct: 60 AAPAAPPPPAAAPAAPPP-PAAPPAAPPPPPPLPAPPPPP 98 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP +PP P P P P P P P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAP 85 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 754 PPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXP 915 PP A+P P A PP P PPL P P P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQP 105 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP +PPP P P PP P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP +PPP P P PP P P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 +PPP PP PPP P P PP P P P Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 801 TKXCAGXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 T AG PP PP PPP P P PP P P P Sbjct: 355 TDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP P P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP P P P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP P P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP +PP PPP P P P P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP +PP P P P P PP P P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP PPP P P PP P P Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.1 bits (77), Expect = 0.084 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP PPP P P PP P P Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 P P PP PPP P P PP P+ P P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 +PPP PP PP P P PP P P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P P P P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 +PPP PP PP P P PP P P P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP P PPP P P PP P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P PP P P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP PP PPP P P PP P P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP P PPP P P PP P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PP P P PP P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP PP PPP P P PP P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP PP PPP P P PP P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P P P P P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 828 PPPXXNPP--XTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP P P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPS 908 PPP PP PP P P PP P+ Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 P P PP PP P P PP P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP P PP P P PP P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 638 PPPXXXXFXIXXPPPXXFPXFXPPXLXXPXKKKYRGXGXPLXXXVPXPPPPTP 796 PPP PPP P PP P P P PPPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +1 Query: 754 PPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPTXP 924 PP + PP P+ PP P PP P PPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +1 Query: 769 GAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPTXPXXXXTQP 945 G SPP P PP P PP P PPP P P P Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +1 Query: 784 PPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPTXPXXXXTQP 945 PP P + PP P+ PP P PPP P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/59 (28%), Positives = 18/59 (30%) Frame = +1 Query: 739 PGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXP 915 P PP SPP P PP P PP + P PPP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +1 Query: 754 PPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPTXP 924 PP PP P + PP P PP P PPP P P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 APPP PP PPP P P PP P P P H Sbjct: 463 APPPP--PPPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 36.3 bits (80), Expect = 0.036 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 816 GXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 G PPP PP PPP P P PP P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 846 PPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHT 941 PP PPP P P PP P P P T Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.9 bits (79), Expect = 0.048 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPS 908 PPP PP PPP P P PP PS Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PPP PP PPP P P PP P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP PPP P P P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 849 PXTPPPXPLXPXXXPPXXPSXXXXPXXPXHT 941 P PPP P P PP P P P T Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPST 713 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PPP PP +PPP P P PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPP 230 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPS 908 PP PP PPP P P PP PS Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPS 236 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PPP PP PPP P P PP PS P P Sbjct: 204 PPP---PPPRPPPSP--PPPPPPPSPSPPRPPPPP 233 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 +PPP PP PP P P P P P P Sbjct: 214 SPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/36 (36%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 828 PPPXXNPPXTPPPX-PLXPXXXPPXXPSXXXXPXXP 932 PPP +PP PPP P P P P P Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.063 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +3 Query: 828 PPPXXNPPXTPP-----PXPLXPXXXPPXXPSXXXXPXXPXHTTN 947 PPP NPP PP P P P PP P P P TN Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTN 392 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHTTN 947 PP PP PP P P PP P P P TN Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 412 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHTTN 947 PPP PP PP P P PP P P P TN Sbjct: 365 PPPP--PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTN 402 Score = 29.9 bits (64), Expect = 3.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 816 GXXAPPPXXNPPXTPPPXPLXPXXXPP 896 G PPP N P PPP P PP Sbjct: 383 GPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PP PP PP P P PP P P Sbjct: 384 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP 414 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 810 CAGXXAPP-PXXNPPXTPPPXPLXPXXXPPXXPS 908 C PP P PP TPPP L P PP P+ Sbjct: 425 CGTATPPPTPPPTPPPTPPPTTLPPTTQPPPQPT 458 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 834 PXXNPPXTPPPXPLXPXXXPPXXP 905 P +PP TPPP P P PP P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 638 PPPXXXXFXIXXPPPXXFPXFXPPXLXXPXKKKYRGXGXPLXXXVPXPPPPTP 796 PP + PP P + PP P Y P P PPPP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 828 PPPXXNPPXTP-PPXPLXPXXXPPXXPSXXXXPXXPXHTTN 947 PPP PP P PP P P PP P P + N Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPN 203 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 831 PPXXNPPXTPPP-XPLXPXXXPPXXPSXXXXP 923 PP NPP PPP P P PP P+ P Sbjct: 204 PPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 831 PPXXNPPXTPPP-XPLXPXXXPPXXP 905 PP NPP PPP P P PP P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXP 905 PP NPP PP P P PP P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PPP PP PPP P P PP P Sbjct: 157 PPPLYPPPPNPPP-PNAPYPPPPYPP 181 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP NPP PPP P P P P P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PP NPP PPP P PP P Sbjct: 214 PPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 C G NPP PPP P P PP P P P Sbjct: 80 CGGHPPTNFSPNPPYPPPPYP--PYPPPPPYPPPPNPPYPP 118 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = +1 Query: 754 PPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPTXPXXX 933 PP +PP+ PN P P +PP N P PPP P P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPN---APYPPPPNPPYPPPL 160 Query: 934 XTQP 945 P Sbjct: 161 YPPP 164 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 828 PPPXXNPPXTP-PPXPLXPXXXPPXXP 905 PPP PP P PP P P PP P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +1 Query: 739 PGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXP 915 P PP PP+ P PP P +PP N P PPP P Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP--PNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PP N P PPP P P PP P+ P Sbjct: 196 PPPPNAPNPPPPNP--PYPPPPNAPNPPYPP 224 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP NPP PP P P P P P P Sbjct: 198 PPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/69 (24%), Positives = 19/69 (27%) Frame = +1 Query: 739 PGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPT 918 P PP PP+ P PP P +PP N PP P Sbjct: 120 PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPY 179 Query: 919 XPXXXXTQP 945 P P Sbjct: 180 PPPPNPPYP 188 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP PP P P P P+ P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 828 PP--PXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 PP P PP PPP P P P P P P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G +G GG G G GGG GG GGG Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 943 VVXXGXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 VV G G +G GG G G GGG GG GGG Sbjct: 766 VVVGGGGGGDGGDGGGGGDGGG--GGGGGGGGGGGGGGG 802 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 922 GXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G +G GG G G GGG GG GGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -1 Query: 922 GXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G +G GG G G GGG GG GGG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/82 (28%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +1 Query: 673 APPXXFSXF*XPXPX*XIXKKVPGGRXPPXXXGAXASPPHXXXP---NXARGXXRPPXXP 843 +PP F P + KK G PP PP P N PP P Sbjct: 139 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 198 Query: 844 TRRXHXHPPLSNXXXXPXXPPP 909 R PP P PPP Sbjct: 199 HSRHGSAPPPPERSSGPPPPPP 220 Score = 31.5 bits (68), Expect = 1.0 Identities = 28/91 (30%), Positives = 31/91 (34%), Gaps = 7/91 (7%) Frame = +1 Query: 673 APPXXFSXF*XPXPX*XIXKKVPGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRR 852 APP S P P + P R P G PP P RG PP PTR Sbjct: 230 APPPTGSSRPLPAPPPGENRPPPPMRGPTS--GGEPPPPKNAPPPPKRGSSNPPPPPTRG 287 Query: 853 XHXH------PPL-SNXXXXPXXPPPXPTXP 924 + PPL + P PPP P Sbjct: 288 PPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 318 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.3 bits (70), Expect = 0.59 Identities = 23/82 (28%), Positives = 25/82 (30%), Gaps = 3/82 (3%) Frame = +1 Query: 673 APPXXFSXF*XPXPX*XIXKKVPGGRXPPXXXGAXASPPHXXXP---NXARGXXRPPXXP 843 +PP F P + KK G PP PP P N PP P Sbjct: 51 SPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPP 110 Query: 844 TRRXHXHPPLSNXXXXPXXPPP 909 R PP P PPP Sbjct: 111 HSRHGSAPPPPERSSGPPPPPP 132 Score = 31.5 bits (68), Expect = 1.0 Identities = 28/91 (30%), Positives = 31/91 (34%), Gaps = 7/91 (7%) Frame = +1 Query: 673 APPXXFSXF*XPXPX*XIXKKVPGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRR 852 APP S P P + P R P G PP P RG PP PTR Sbjct: 142 APPPTGSSRPLPAPPPGENRPPPPMRGPTS--GGEPPPPKNAPPPPKRGSSNPPPPPTRG 199 Query: 853 XHXH------PPL-SNXXXXPXXPPPXPTXP 924 + PPL + P PPP P Sbjct: 200 PPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 230 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPS 908 PPP PP +P P P P PP P+ Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTPT 1187 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PPP PP PP P P PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 29.9 bits (64), Expect = 3.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 846 PPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHTT 944 PP PPP P PP P P P TT Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTPTTTT 1190 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPS 908 PPP PP P P P PP P+ Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP + P PPP P PP P P H Sbjct: 552 PPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPH 588 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 542 PPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPH 578 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 478 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 488 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 498 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPH 508 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 538 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPH 548 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASH 558 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPH 598 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P PPP P PP P P H Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPH 468 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP P PPP P PP P P Sbjct: 572 PPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXH 938 PPP P P P P PP P P H Sbjct: 382 PPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPGASH 418 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 813 AGXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 A +P PP PPP P P PP P P P Sbjct: 185 ANKPSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXP 881 +PPP PP PPP PL P Sbjct: 1310 SPPPPPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPP 896 PP PP PPP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP T PP P P P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 828 PPPXXNPPXTPPP-XPLXPXXXPPXXPSXXXXPXXPXHT 941 PPP PP PPP P P P P+ P HT Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAPGGCGAKP-HT 138 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGGA 824 G G G GG G G GGG GG GGGA Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGA 702 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGGA 824 G G G GG G G GGG GG GGA Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGA 705 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGGA 824 G G G GG G G GGG GG G GA Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGA 707 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 1/91 (1%) Frame = +1 Query: 676 PPXXFSXF*XPXPX*XIXKKVPGGRXPPXXXGAXASPPHXXXPNXARGXXRP-PXXPTRR 852 PP P P I G PP A PP P A P P P Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPP--PPPPIAPAATVPAPAVPLAA 185 Query: 853 XHXHPPLSNXXXXPXXPPPXPTXPXXXXTQP 945 PP P PPP P P P Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPPPPILELAAP 216 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP PP PPP P+ PP Sbjct: 195 PPPPPPPPPPPPPPPILELAAPP 217 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 816 GXXAPPPXXN-PPXTPPPXPLXPXXXPPXXP 905 G APPP PP PPP P PP P Sbjct: 960 GGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 +PP PP PPP P PP S P P Sbjct: 913 SPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 846 PPXTPPPXPLXPXXXPPXXPS 908 PP PPP PL P PP P+ Sbjct: 424 PPPPPPPAPLPPPPPPPPQPT 444 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXPL 875 CA PPP PP PPP P+ Sbjct: 100 CAPPPPPPPPPPPPPPPPPPPI 121 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXP 881 APPP PP PPP P P Sbjct: 101 APPPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PP PP PPP P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXP 872 C PPP PP PPP P Sbjct: 99 CCAPPPPPPPPPPPPPPPPPP 119 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXPLXPXXXPP 896 CA P PP PPP P P PP Sbjct: 91 CAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXP 905 A PP P PPP P P PP P Sbjct: 94 ACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 25.8 bits (54), Expect(2) = 2.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G GG G G G GG+ GGG Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGG 152 Score = 23.0 bits (47), Expect(2) = 2.0 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 706 GXKXGKXGRGGXXNXKXXXXGGGXXSXGS 620 G + G GRGG + GGG G+ Sbjct: 157 GGEGGWGGRGGNGGGRGGGEGGGGRGRGT 185 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 P P PP PPP P P PP S P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP PP PPP P P P P Sbjct: 868 PPPPPPPPPPPPPPPPPPASSTGSTPGGDKVP 899 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPS 908 P P P PPP P P PP P+ Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPPA 886 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHT 941 PPP PP PPP P PP P H+ Sbjct: 2184 PPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHS 2221 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP PP PPP P PP Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPP 2196 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 816 GXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 G APPP PP PP P P P PS P P Sbjct: 359 GGAAPPPPPPPPVGGPPPPPPPIEGRP--PSSLGNPPPP 395 Score = 28.7 bits (61), Expect = 7.3 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 8/64 (12%) Frame = +1 Query: 742 GGRXPPXXXGAXASPPHXXX---PNXAR-GXXRPPXXPTRRXHXHPPLSNXXXXP----X 897 G PP GA PP P AR G PP P+R PP S P Sbjct: 294 GAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGM 353 Query: 898 XPPP 909 PPP Sbjct: 354 APPP 357 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +2 Query: 620 GAXRXXPPPXXXXFXIXXPPPXXFPXFXPPXLXXPXKKKYRGXGXPLXXXVPXPPPPT 793 G PPP PPP P PP P G P P PPPPT Sbjct: 286 GGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAP-----PPPPPPT 338 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXP 932 APPP P PPP P P PP P P Sbjct: 303 APPPPPPPGGAPPPPP--PPPPPPPGDGGAPPPPPP 336 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 6/63 (9%) Frame = +1 Query: 739 PGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXX------PTRRXHXHPPLSNXXXXPXX 900 P G PP G PP P A G PP PT + + PP S Sbjct: 54 PAGGYPPPQPGYAGGPP---PPGIAPGIGGPPPSGQYGAPPTSQPYGAPPTSGYPGYQQH 110 Query: 901 PPP 909 PPP Sbjct: 111 PPP 113 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.9 bits (64), Expect = 3.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP +PP TPPP P P Sbjct: 1579 PPPTPSPPQTPPPVNTPPRPETP 1601 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.9 bits (64), Expect = 3.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 5/37 (13%) Frame = +3 Query: 810 CAGXXAPPPXXNP-----PXTPPPXPLXPXXXPPXXP 905 CAG PPP P P PPP P PP P Sbjct: 722 CAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.9 bits (64), Expect = 3.1 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +3 Query: 801 TKXCAGXXAPP-----PXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHTT 944 TK APP P P PPP PL P PP P P P TT Sbjct: 885 TKNPKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPP-----PPPPIQTT 932 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 907 EGXXGGXXXGXRGXGGGVXGGLXXGGG 827 +G GG G G GGG GG GGG Sbjct: 131 DGGGGGGGGGGGGGGGGGGGGGGGGGG 157 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXP 893 PPP PP PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXP 905 PP PP PPP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +3 Query: 801 TKXCAGXXAPPPXXNPPXTPPPXPLXPXXXP 893 TK P P +P TPPP P+ P P Sbjct: 158 TKKPTTKPTPAPHSSPSPTPPPPPIIPPCPP 188 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPS 908 P PP PPP P P PP PS Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPPS 84 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 831 PPXXNPPXTPPPXPLXPXXXPPXXPS 908 P PP PPP P P PP PS Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPPS 308 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G + GG G G GGG GG GGG Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP PP T PP P PP Sbjct: 48 PPPVTQPPVTQPPVTQPPVTQPP 70 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G GG G G GGG GG GGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGG 106 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G GG G G GGG GG GGG Sbjct: 99 GGFGGGGGGGFGGGGGGGGGFGGGGG 124 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 160 GYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -1 Query: 931 GXXGXXXXEGXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G GG G G GGG GG GGG Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXP 872 C +PPP PP PPP P Sbjct: 156 CRSYYSPPPQPPPPPLPPPPP 176 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 PPP P PPP P PP P P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPP 54 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 816 GXXAPPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXPXXPXHTTN 947 G APPP PPP P PP P P T N Sbjct: 175 GILAPPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPPTFN 218 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXP 881 PPP N P PPP P+ P Sbjct: 88 PPPASNVPAPPPPPPVMP 105 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 895 GGXXXGXRGXGGGVXGGLXXGGG 827 GG G G GGGV GG GGG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGG 103 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +3 Query: 804 KXCAGXXAPPPXXN-----PPXTPPPXPLXPXXXPPXXPSXXXXP 923 K G PPP PP TPPP P P PP P+ P Sbjct: 114 KKYLGGYVPPPPPTGTLPPPPVTPPPGPETP--PPPDTPAPPVPP 156 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 810 CAGXXAPPPXXNPPXTPPPXPLXPXXXPP 896 C G P +PP PPP P P PP Sbjct: 517 CCGSYPAPQPPSPP-APPPKPAPPPRSPP 544 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 2/20 (10%) Frame = +3 Query: 828 PPPXXNPPXT--PPPXPLXP 881 PPP +PP T PPP PL P Sbjct: 155 PPPRHSPPQTPVPPPPPLPP 174 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/63 (28%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +1 Query: 742 GGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXP--PPXP 915 G + PP G P P G PP P PP P P PP P Sbjct: 61 GPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGP 120 Query: 916 TXP 924 P Sbjct: 121 QMP 123 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP PP PPP P P PP Sbjct: 73 PPPLCAPPPPPPPPP--PPPPPP 93 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 825 APPPXXNPPXTPPPXP 872 APPP PP PPP P Sbjct: 78 APPPPPPPPPPPPPPP 93 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +3 Query: 816 GXXAPPPXXNP-PXTPPPXPLXPXXXPPXXPSXXXXP 923 G PPP P P PP P P PP P P Sbjct: 1251 GLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPP 896 PPP PP PPP P P PP Sbjct: 274 PPPLCAPPPPPPPPP--PPPPPP 294 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 825 APPPXXNPPXTPPPXP 872 APPP PP PPP P Sbjct: 279 APPPPPPPPPPPPPPP 294 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G GG G RG GGG GG GG Sbjct: 210 GRGGGGYGGGRGGGGGYGGGRRDYGG 235 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G GG G G GGG GG GGG Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 843 NPPXTPPPXPLXPXXXPPXXPS 908 NPP PPP P PP PS Sbjct: 141 NPPPPPPPPSPPPPCHPPALPS 162 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/70 (28%), Positives = 24/70 (34%) Frame = +1 Query: 739 PGGRXPPXXXGAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPXPT 918 PG PP A +S A G PP PT+ P + P P P Sbjct: 752 PGVEWPPL---AKSSSDGAAIDKKALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPP 808 Query: 919 XPXXXXTQPT 948 P T+PT Sbjct: 809 PPPGKPTKPT 818 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 825 APPPXXN--PPXTPPPXPLXPXXXPP 896 APPP + PP PPP + P PP Sbjct: 240 APPPPHSMPPPGMPPPGMMPPPGFPP 265 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +1 Query: 739 PGGRXPPXXX--GAXASPPHXXXPNXARGXXRPPXXPTRRXHXHPPLSNXXXXPXXPPPX 912 PGG PP G PP P PP T PP P PPP Sbjct: 383 PGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Query: 913 PTXP 924 P Sbjct: 443 SDAP 446 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -1 Query: 907 EGXXGGXXXGXRGXGGGVXGGLXXGGG 827 +G GG G RG GGG GG GGG Sbjct: 196 DGGRGGY--GGRGRGGGGRGGYGGGGG 220 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 825 APPPXXNPPXTPPPXPLXPXXXPPXXPSXXXXP 923 A PP PP P P P PP P P Sbjct: 176 AAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 >SB_2033| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 995 Score = 28.3 bits (60), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 828 PPPXXNPPXTPPPXP 872 PPP +PP PPP P Sbjct: 570 PPPTTSPPIVPPPDP 584 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 904 GXXGGXXXGXRGXGGGVXGGLXXGGG 827 G G G RG GGG GG GGG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGG 117 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 825 APPPXXNPPXTPPPXP 872 APPP PP PPP P Sbjct: 169 APPPEILPPTAPPPQP 184 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 828 PPPXXNPPXTPPPXPLXPXXXPPXXP 905 PPP P PPP P PP P Sbjct: 304 PPPTDFAPPPPPPEPTSELPPPPPPP 329 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,672,386 Number of Sequences: 59808 Number of extensions: 171256 Number of successful extensions: 2530 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1676 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2776707833 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -