BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P14 (982 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 36 0.038 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 36 0.038 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.038 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 36 0.066 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.066 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.20 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.27 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 33 0.35 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.35 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 32 0.62 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.3 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 27 3.0 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 4.4 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 29 5.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 29 5.8 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.6 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 1/89 (1%) Frame = +2 Query: 719 GGXPXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXP-PXXXXXXXXXXXXXXXRP 895 GG P P PPPP N Q P P P Sbjct: 260 GGEPPP-PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 318 Query: 896 XPPXHKQXXPPXPPPPXXGGGRXPXPPXS 982 PP + P PPPP G P PP S Sbjct: 319 PPPPPSRDQVPLPPPPLRGQIAPPPPPIS 347 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/79 (24%), Positives = 21/79 (26%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPP + PP P PP H + Sbjct: 143 PFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRH 202 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PPPP G P PP Sbjct: 203 G-SAPPPPERSSGPPPPPP 220 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 36.3 bits (80), Expect = 0.038 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 1/89 (1%) Frame = +2 Query: 719 GGXPXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXP-PXXXXXXXXXXXXXXXRP 895 GG P P PPPP N Q P P P Sbjct: 172 GGEPPP-PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATP 230 Query: 896 XPPXHKQXXPPXPPPPXXGGGRXPXPPXS 982 PP + P PPPP G P PP S Sbjct: 231 PPPPPSRDQVPLPPPPLRGQIAPPPPPIS 259 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/79 (24%), Positives = 21/79 (26%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPP + PP P PP H + Sbjct: 55 PFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRH 114 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PPPP G P PP Sbjct: 115 G-SAPPPPERSSGPPPPPP 132 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 36.3 bits (80), Expect = 0.038 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G G P PP Sbjct: 307 PPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP P PPPP GG P PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP GG P PP Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 32.7 bits (71), Expect = 0.47 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPP 615 PPP GG P PP PP G GA P PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDG---GAPPPPPPP 337 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 PP PPPP GG P PP Sbjct: 319 PPPPPPPGDGGAPPPPPP 336 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP P PPPP G P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPP 320 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPP 821 PPPP + PP G APPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPP 316 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXTXXHXRXXXXXXXXXXXXXXXXXXXXXTNXTXXP 929 PPPPP PP G APPP + P Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 364 Query: 930 XPPPPP 947 PPPPP Sbjct: 365 PPPPPP 370 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 899 PPXHKQXXPPXPPPPXXGGGRXPXPP 976 PP PP PPPP GG P PP Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 29.9 bits (64), Expect = 3.3 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 5/81 (6%) Frame = +2 Query: 749 PPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQXXPP 928 PPPPPP ++ PP P PP PP Sbjct: 326 PPPPPPSRSSQRPPPP----------SRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Query: 929 XPPPPXXGG-----GRXPXPP 976 PPPP G G P PP Sbjct: 376 PPPPPIEGRPPSSLGNPPPPP 396 Score = 29.5 bits (63), Expect = 4.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXP 973 P PP + P PPPP R P P Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTK-KXGXXXGAXAXPXPPXRG 624 PPP GG P PP PP + + G P PP RG Sbjct: 366 PPPPPVGG----PPPPPPPIEGRPPSSLGNPPPPPPPGRG 401 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 35.5 bits (78), Expect = 0.066 Identities = 23/85 (27%), Positives = 23/85 (27%), Gaps = 2/85 (2%) Frame = +2 Query: 728 PXXXPXXPPPP--PPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXP 901 P P PPPP P N N PP P P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPP 169 Query: 902 PXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PPPP P PP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 31.9 bits (69), Expect = 0.82 Identities = 20/83 (24%), Positives = 20/83 (24%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPX 907 P P PPPP P P P PP Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Query: 908 HKQXXPPXPPPPXXGGGRXPXPP 976 PP PPPP P PP Sbjct: 215 PNAPNPPYPPPPNAPNPPYPPPP 237 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/68 (26%), Positives = 21/68 (30%) Frame = +2 Query: 749 PPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQXXPP 928 PPPPP + + N+ PP P PP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 405 Query: 929 XPPPPXXG 952 PPPP G Sbjct: 406 PPPPPTNG 413 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXT 830 PPPPP PP G PPP T Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPT 391 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPPXXGGGRXPXP 973 +P PP PP PPPP G P P Sbjct: 373 KPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXT 830 PPPPP PP G PPP T Sbjct: 375 PPPPPPTNGPPPPPPPTNGPPPPPPPT 401 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXT 830 PPPPP PP G PPP T Sbjct: 385 PPPPPPTNGPPPPPPPTNGPPPPPPPT 411 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 720 GGG---PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 GGG P PP PP T T PP PPP Sbjct: 341 GGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPP 377 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP T PP PPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP T PP PPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Score = 28.7 bits (61), Expect = 7.6 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP +K P PPPP G P PP Sbjct: 367 PPPPTNK----PPPPPPPTNGPPPPPPP 390 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPPP GG P PP Sbjct: 665 PPPPGGQAGGAPPPPPPPLPGGAAPPPP 692 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP GG P PP Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PPPP GGG P PP Sbjct: 677 PPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 Score = 32.7 bits (71), Expect = 0.47 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP P PPPP GG P PP Sbjct: 678 PPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP GG PP PP GA P PP GG Sbjct: 663 PPPPPPGGQAGGAPPPPPPP----LPGGAAPPPPPPIGGG 698 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 550 PPXPPTKKXGXXXGAXAXPXPPXRGG 627 PP PP G GA P PP GG Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGG 686 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/20 (60%), Positives = 12/20 (60%), Gaps = 2/20 (10%) Frame = +2 Query: 923 PPXPPPPXXGG--GRXPXPP 976 PP PPPP GG G P PP Sbjct: 660 PPPPPPPPPGGQAGGAPPPP 679 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.5 bits (73), Expect = 0.27 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 +P P PP PPPP GG P PP Sbjct: 187 KPSPMAGMPPPPPPPPPPGFPGGAPPPPP 215 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 33.1 bits (72), Expect = 0.35 Identities = 21/79 (26%), Positives = 22/79 (27%) Frame = +2 Query: 707 TXXXGGXPXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXX 886 T G P PPPPPP + Q PP Sbjct: 355 TDISAGINMSPPPPPPPPPP--PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Query: 887 XRPXPPXHKQXXPPXPPPP 943 P PP PP PPPP Sbjct: 413 PPPPPPAPPPPPPPPPPPP 431 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PP PPPP P PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPP 392 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP R P PP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G P PP Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPP 681 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP GG P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGG--VPGPP 678 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.9 bits (69), Expect = 0.82 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPPXS 982 P PP PP PPPP P PP S Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPP---PPXXGGGRXPXPP 976 +P PP PP PP P GGG P PP Sbjct: 944 QPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPP 975 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 336 GGAPPXXXFFFXGGXPPPPXGGXPXXXXXPXXFFKKKKXXPXKTPPP 196 G APP GG PPP GG P P P PPP Sbjct: 950 GNAPPPPPP--PGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G P PP G A P PP GG Sbjct: 922 PPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGG 961 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP + + PP G APPP Sbjct: 926 PGGNAPLPPPPPGGSAPSQPPP-PGGNAPPP 955 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +1 Query: 508 PPPXGXGGXXXXPX-----PPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G P PP PP G A P PP GG Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGG 979 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 26.2 bits (55), Expect(2) = 2.3 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 893 PXPPXHKQXXP--PXPPPPXXGGGRXP 967 P PP H P P PPPP G P Sbjct: 587 PPPPAHHVNKPGVPPPPPPSKTGKSKP 613 Score = 22.6 bits (46), Expect(2) = 2.3 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXN 781 P P PPPP H N Sbjct: 578 PVATSPPPHPPPPAHHVN 595 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 27.1 bits (57), Expect(2) = 3.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 820 GGGAXPXXWXGGXVXLVXWGGGGGXXRXXXGPPP 719 GGG GG GGGGG GPPP Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 21.4 bits (43), Expect(2) = 3.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 955 SXRGGGGGXG 926 S RGGGGG G Sbjct: 339 SGRGGGGGGG 348 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXTXXH 839 PPPPP PP PPP T H Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTPLH 498 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPPXS 982 PP PPPP G P PP S Sbjct: 712 PPPPPPPPPGCAGLPPPPPS 731 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PP P G P PP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPP 743 Score = 29.1 bits (62), Expect = 5.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP G P PP Sbjct: 730 PSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 29.1 bits (62), Expect = 5.8 Identities = 21/85 (24%), Positives = 21/85 (24%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPX 907 P P PPPPPP PP P PP Sbjct: 916 PEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPL 975 Query: 908 HKQXXPPXPPPPXXGGGRXPXPPXS 982 P PPPP PP S Sbjct: 976 ------PPPPPPVQTTTAPTLPPAS 994 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 719 GGXPXXXPXXPPPPPP 766 GG P P PPPPPP Sbjct: 193 GGPPPPPPPPPPPPPP 208 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.7 bits (61), Expect = 7.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXP 967 P PP PP PPPP G P Sbjct: 869 PPPPPPPPPPPPPPPPPASSTGSTP 893 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPP 943 P PP Q PP PPPP Sbjct: 426 PPPPGFPQFQPPPPPPP 442 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 28.7 bits (61), Expect = 7.6 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 7/35 (20%) Frame = +2 Query: 893 PXPPXHKQXXPPXP-------PPPXXGGGRXPXPP 976 P PP Q PP P PPP G G P PP Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPPPP 603 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.310 0.144 0.473 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,663,676 Number of Sequences: 59808 Number of extensions: 304137 Number of successful extensions: 3157 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2069 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -