BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P14 (982 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 40 0.007 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 40 0.007 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 40 0.007 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 40 0.007 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 40 0.007 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 38 0.028 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 38 0.028 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 38 0.028 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 37 0.049 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 37 0.049 AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-P... 35 0.20 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 34 0.26 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 34 0.26 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 34 0.26 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 34 0.26 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 34 0.26 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 34 0.26 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 34 0.26 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 34 0.26 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 33 0.60 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 33 0.60 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 33 0.60 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 33 0.60 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 30 0.74 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 30 0.74 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 30 0.74 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 25 0.80 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 25 0.81 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 32 1.0 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 32 1.0 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 32 1.0 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 32 1.0 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 32 1.0 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 24 1.2 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 32 1.4 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 32 1.4 AY058563-1|AAL13792.1| 652|Drosophila melanogaster LD25239p pro... 31 2.4 AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p pro... 31 2.4 AE014296-1420|AAF50445.2| 652|Drosophila melanogaster CG7185-PA... 31 2.4 AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC... 31 2.4 AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB... 31 2.4 AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA... 31 2.4 AE014134-231|AAF51393.1| 80|Drosophila melanogaster CG5011-PA ... 27 3.1 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 23 3.6 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 23 3.6 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 25 4.4 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 25 4.4 L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. 25 4.8 AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p pro... 25 4.8 AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA ... 25 4.8 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 27 4.9 BT030179-1|ABN49318.1| 82|Drosophila melanogaster IP17830p pro... 30 5.6 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 30 5.6 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 30 5.6 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 30 5.6 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 30 5.6 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 30 5.6 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 30 5.6 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 30 5.6 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 30 5.6 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 30 5.6 Y07653-1|CAA68937.1| 1263|Drosophila melanogaster spalt-related ... 29 7.4 BT016151-1|AAV37036.1| 1267|Drosophila melanogaster AT17006p pro... 29 7.4 BT016144-1|AAV37029.1| 1267|Drosophila melanogaster AT24316p pro... 29 7.4 AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p pro... 29 7.4 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 29 7.4 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 29 7.4 AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-P... 29 7.4 AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-P... 29 7.4 AE014134-2065|AAN10780.1| 1267|Drosophila melanogaster CG4881-PB... 29 7.4 AE014134-2064|AAF53096.1| 1267|Drosophila melanogaster CG4881-PA... 29 7.4 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 29 7.4 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 25 8.7 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 25 8.7 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 29 9.8 AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p pro... 29 9.8 AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA... 29 9.8 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 29 9.8 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 29 9.8 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPPPP H PP P PP Sbjct: 475 PPPPPPPPPLHAF-----------VAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSA 523 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PP PP P GGG P PP Sbjct: 524 PPPPPPAPIEGGGGIPPPP 542 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP PP G PPP Sbjct: 483 PLHAFVAPPPPPPPPPPPPPPLANYGAPPPP 513 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPPPP H PP P PP Sbjct: 485 PPPPPPPPPLHAF-----------VAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSA 533 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PP PP P GGG P PP Sbjct: 534 PPPPPPAPIEGGGGIPPPP 552 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP PP G PPP Sbjct: 493 PLHAFVAPPPPPPPPPPPPPPLANYGAPPPP 523 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPPPP H PP P PP Sbjct: 475 PPPPPPPPPLHAF-----------VAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSA 523 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PP PP P GGG P PP Sbjct: 524 PPPPPPAPIEGGGGIPPPP 542 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP PP G PPP Sbjct: 483 PLHAFVAPPPPPPPPPPPPPPLANYGAPPPP 513 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPPPP H PP P PP Sbjct: 633 PPPPPPPPPLHAF-----------VAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSA 681 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PP PP P GGG P PP Sbjct: 682 PPPPPPAPIEGGGGIPPPP 700 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP PP G PPP Sbjct: 641 PLHAFVAPPPPPPPPPPPPPPLANYGAPPPP 671 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 39.5 bits (88), Expect = 0.007 Identities = 24/79 (30%), Positives = 24/79 (30%) Frame = +2 Query: 740 PXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPXHKQX 919 P PPPPPP H PP P PP Sbjct: 580 PPPPPPPPPLHAF-----------VAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSA 628 Query: 920 XPPXPPPPXXGGGRXPXPP 976 PP PP P GGG P PP Sbjct: 629 PPPPPPAPIEGGGGIPPPP 647 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 729 PXXXLXXPPPPPQXTXKTXPPXHXXGXAPPP 821 P PPPPP PP G PPP Sbjct: 588 PLHAFVAPPPPPPPPPPPPPPLANYGAPPPP 618 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 37.5 bits (83), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G G P PP Sbjct: 509 PPPPLANYGAPPPPPPPPPGSGSAPPPP 536 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PP P GGG P PP Sbjct: 524 PPPPGSGSAPPPPPPAPIEGGGGIPPPP 551 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + PP PPPP G P PP Sbjct: 510 PPPLANYGAPPPPPPPPPGSGSAPPPPP 537 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 37.5 bits (83), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G G P PP Sbjct: 604 PPPPMANYGAPPPPPPPPPGSGSAPPPP 631 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PP P GGG P PP Sbjct: 619 PPPPGSGSAPPPPPPAPIEGGGGIPPPP 646 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + PP PPPP G P PP Sbjct: 605 PPPMANYGAPPPPPPPPPGSGSAPPPPP 632 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 37.5 bits (83), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G G P PP Sbjct: 737 PPPPMANYGAPPPPPPPPPGSGSAPPPP 764 Score = 36.3 bits (80), Expect = 0.064 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PP P GGG P PP Sbjct: 752 PPPPGSGSAPPPPPPAPIEGGGGIPPPP 779 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + PP PPPP G P PP Sbjct: 738 PPPMANYGAPPPPPPPPPGSGSAPPPPP 765 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 36.7 bits (81), Expect = 0.049 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP GG P PP Sbjct: 285 PPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G P PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + PP PPP GG P PP Sbjct: 286 PPPPINGAAPPPPPPPMINGGALPPPPP 313 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP P PPPP G P PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPP 299 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 36.7 bits (81), Expect = 0.049 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP GG P PP Sbjct: 285 PPPPPINGAAPPPPPPPMINGGALPPPP 312 Score = 34.3 bits (75), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G P PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPP 300 Score = 33.9 bits (74), Expect = 0.34 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + PP PPP GG P PP Sbjct: 286 PPPPINGAAPPPPPPPMINGGALPPPPP 313 Score = 31.5 bits (68), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP P PPPP G P PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPP 299 >AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-PA protein. Length = 733 Score = 34.7 bits (76), Expect = 0.20 Identities = 22/84 (26%), Positives = 23/84 (27%), Gaps = 1/84 (1%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRP-XPP 904 P P PPPPPP N + PP P P Sbjct: 117 PQPQPQPPPPPPPSIIINAAAAASSGPTVDYRYTEYKPPPNYASLYPSTHPPIYTPTYPA 176 Query: 905 XHKQXXPPXPPPPXXGGGRXPXPP 976 H PP PPP P PP Sbjct: 177 AHPPTQPPTYPPPTHPPTPPPTPP 200 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 437 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 440 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 570 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 597 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 583 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 624 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 569 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 596 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 582 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 623 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 437 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 437 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 451 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 437 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP Q PPPP GGG P PP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPP 454 Score = 29.1 bits (62), Expect = 9.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXG---XXXGAXAXPXPPXRGG 627 PPP GG P PP PP G G A P PP G Sbjct: 440 PPPPAMGGGPP-PAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P PP PP PPPP G GG P PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G PP PP G G P PP GG Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + P PPPP GGG P PP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPP 528 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPPP G G P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G GG P PP PP G G P PP G Sbjct: 515 PPPPGGGGA---PPPPPPP--MPGRAGGGPPPPPPPPMPG 549 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP GG P PP P + G P P GG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGG 553 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP--PXXGGGRXPXPP 976 P PP PP PPP GGG P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P P PP PPPP G GG P PP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P PP PP PPPP G GG P PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G PP PP G G P PP GG Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + P PPPP GGG P PP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPP 528 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPPP G G P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G GG P PP PP G G P PP G Sbjct: 515 PPPPGGGGA---PPPPPPP--MPGRAGGGPPPPPPPPMPG 549 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP GG P PP P + G P P GG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGG 553 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP--PXXGGGRXPXPP 976 P PP PP PPP GGG P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P P PP PPPP G GG P PP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P PP PP PPPP G GG P PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G PP PP G G P PP GG Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + P PPPP GGG P PP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPP 528 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPPP G G P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G GG P PP PP G G P PP G Sbjct: 515 PPPPGGGGA---PPPPPPP--MPGRAGGGPPPPPPPPMPG 549 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP GG P PP P + G P P GG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGG 553 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP--PXXGGGRXPXPP 976 P PP PP PPP GGG P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P P PP PPPP G GG P PP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P PP PP PPPP G GG P PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPP 543 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G PP PP G G P PP GG Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGG 565 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P + P PPPP GGG P PP Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPP 528 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPPP G G P PP Sbjct: 543 PPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP G GG P PP PP G G P PP G Sbjct: 515 PPPPGGGGA---PPPPPPP--MPGRAGGGPPPPPPPPMPG 549 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 508 PPPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PPP GG P PP P + G P P GG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGG 553 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP--PXXGGGRXPXPP 976 P PP PP PPP GGG P PP Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXG--GGRXPXPP 976 P P PP PPPP G GG P PP Sbjct: 530 PMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 >AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB, isoform B protein. Length = 2716 Score = 30.3 bits (65), Expect(2) = 0.74 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXP 973 P PP +Q PPP GGG P P Sbjct: 1292 PPPPQQQQGQQGQQPPPSVGGGPPPAP 1318 Score = 21.0 bits (42), Expect(2) = 0.74 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 740 PXXPPPPPPXHQ 775 P P PPPP Q Sbjct: 1287 PGLPGPPPPQQQ 1298 >AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. Length = 2715 Score = 30.3 bits (65), Expect(2) = 0.74 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXP 973 P PP +Q PPP GGG P P Sbjct: 1291 PPPPQQQQGQQGQQPPPSVGGGPPPAP 1317 Score = 21.0 bits (42), Expect(2) = 0.74 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 740 PXXPPPPPPXHQ 775 P P PPPP Q Sbjct: 1286 PGLPGPPPPQQQ 1297 >AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA, isoform A protein. Length = 2703 Score = 30.3 bits (65), Expect(2) = 0.74 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXP 973 P PP +Q PPP GGG P P Sbjct: 1279 PPPPQQQQGQQGQQPPPSVGGGPPPAP 1305 Score = 21.0 bits (42), Expect(2) = 0.74 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 740 PXXPPPPPPXHQ 775 P P PPPP Q Sbjct: 1274 PGLPGPPPPQQQ 1285 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 24.6 bits (51), Expect(3) = 0.80 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 728 PXXXPXXPPPPPP 766 P P PPPPPP Sbjct: 779 PSYPPPPPPPPPP 791 Score = 23.8 bits (49), Expect(3) = 0.80 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 740 PXXPPPPPPXHQ 775 P PPPPPP Q Sbjct: 784 PPPPPPPPPPPQ 795 Score = 21.0 bits (42), Expect(3) = 0.80 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPP 943 RP + PP PPPP Sbjct: 802 RPPYAPPVRPLPPPPPPP 819 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 24.6 bits (51), Expect(3) = 0.81 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 728 PXXXPXXPPPPPP 766 P P PPPPPP Sbjct: 639 PSYPPPPPPPPPP 651 Score = 23.8 bits (49), Expect(3) = 0.81 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 740 PXXPPPPPPXHQ 775 P PPPPPP Q Sbjct: 644 PPPPPPPPPPPQ 655 Score = 21.0 bits (42), Expect(3) = 0.81 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPP 943 RP + PP PPPP Sbjct: 662 RPPYAPPVRPLPPPPPPP 679 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP-PXXGGGRXPXPP 976 P PP PP PPP P G G P PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPP 412 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP G P PP Sbjct: 399 PMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Frame = +2 Query: 740 PXXPPP-PPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXP-PXHK 913 P PPP PPP + Q P +P P P Sbjct: 147 PQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRP 206 Query: 914 QXXPPXPPPPXXGGGRXPXPP 976 Q PP PP P G P PP Sbjct: 207 QPPPPPPPRPQPTPGYGPPPP 227 Score = 29.5 bits (63), Expect = 7.4 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = +2 Query: 722 GXPXXXPXXPPPP-PPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPX 898 G P P P PP PP Q ++ PP P Sbjct: 168 GPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPP 227 Query: 899 PPXHKQXX-----PPXPPPPXXGGGRXPXPP 976 PP K PP PPP P PP Sbjct: 228 PPPPKPQPTPGYGPPTPPPGPGPAQPAPQPP 258 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP-PXXGGGRXPXPP 976 P PP PP PPP P G G P PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPP 412 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP G P PP Sbjct: 399 PMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPP-PXXGGGRXPXPP 976 P PP PP PPP P G G P PP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPP 528 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P P PP PPPP G P PP Sbjct: 515 PMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Frame = +2 Query: 740 PXXPPP-PPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXP-PXHK 913 P PPP PPP + Q P +P P P Sbjct: 147 PQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRP 206 Query: 914 QXXPPXPPPPXXGGGRXPXPP 976 Q PP PP P G P PP Sbjct: 207 QPPPPPPPRPQPTPGYGPPPP 227 Score = 29.5 bits (63), Expect = 7.4 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = +2 Query: 722 GXPXXXPXXPPPP-PPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPX 898 G P P P PP PP Q ++ PP P Sbjct: 168 GPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPP 227 Query: 899 PPXHKQXX-----PPXPPPPXXGGGRXPXPP 976 PP K PP PPP P PP Sbjct: 228 PPPPKPQPTPGYGPPTPPPGPGPAQPAPQPP 258 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 24.2 bits (50), Expect(3) = 1.2 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 749 PPPPPPXHQ 775 PPPPPP H+ Sbjct: 238 PPPPPPTHK 246 Score = 23.0 bits (47), Expect(3) = 1.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 740 PXXPPPPPP 766 P PPPPPP Sbjct: 234 PYPPPPPPP 242 Score = 21.8 bits (44), Expect(3) = 1.2 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 704 HTXXXGGXPXXXPXXPPPPP 763 H G P PPPPP Sbjct: 199 HGSGHGSGPTPGAYYPPPPP 218 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/84 (25%), Positives = 23/84 (27%), Gaps = 1/84 (1%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPX 907 P P PPPPP H + P P PP Sbjct: 158 PPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPG 217 Query: 908 HKQXXPPXPP-PPXXGGGRXPXPP 976 PP PP PP + P PP Sbjct: 218 PPGTGPPGPPGPPGTTYPQPPPPP 241 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 297 GXPPPPXGGXPXXXXXPXXFFKKKKXXPXKTPPPP 193 G P PP G P P + + P PPPP Sbjct: 214 GPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 248 Score = 25.8 bits (54), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 740 PXXPPPPPPXH 772 P PPPPPP H Sbjct: 56 PPPPPPPPPQH 66 Score = 23.0 bits (47), Expect(2) = 3.9 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGG 955 P PP H P P PP G Sbjct: 61 PPPPQHCNCPPGPPGPPGPPG 81 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/84 (25%), Positives = 23/84 (27%), Gaps = 1/84 (1%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQXNXXXXXXXXXXXXXXXNQXXPPXXXXXXXXXXXXXXXRPXPPX 907 P P PPPPP H + P P PP Sbjct: 160 PPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPG 219 Query: 908 HKQXXPPXPP-PPXXGGGRXPXPP 976 PP PP PP + P PP Sbjct: 220 PPGTGPPGPPGPPGTTYPQPPPPP 243 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = -2 Query: 297 GXPPPPXGGXPXXXXXPXXFFKKKKXXPXKTPPPP 193 G P PP G P P + + P PPPP Sbjct: 216 GPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 250 Score = 25.8 bits (54), Expect(2) = 3.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 740 PXXPPPPPPXH 772 P PPPPPP H Sbjct: 58 PPPPPPPPPQH 68 Score = 23.0 bits (47), Expect(2) = 3.9 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGG 955 P PP H P P PP G Sbjct: 63 PPPPQHCNCPPGPPGPPGPPG 83 >AY058563-1|AAL13792.1| 652|Drosophila melanogaster LD25239p protein. Length = 652 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPPXXGGGRXP 967 RP PP + P P PP GGG P Sbjct: 186 RPVPPPQQNGPPRGPAPPSMGGGPMP 211 >AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p protein. Length = 607 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 511 PPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PP G PP PP++ G G P PP RGG Sbjct: 295 PPPKPRGHYRSGAPPPPPSESHGRIHGRPTTP-PPVRGG 332 >AE014296-1420|AAF50445.2| 652|Drosophila melanogaster CG7185-PA protein. Length = 652 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPPXXGGGRXP 967 RP PP + P P PP GGG P Sbjct: 186 RPVPPPQQNGPPRGPAPPSMGGGPMP 211 >AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC, isoform C protein. Length = 567 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 511 PPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PP G PP PP++ G G P PP RGG Sbjct: 255 PPPKPRGHYRSGAPPPPPSESHGRIHGRPTTP-PPVRGG 292 >AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB, isoform B protein. Length = 607 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 511 PPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PP G PP PP++ G G P PP RGG Sbjct: 295 PPPKPRGHYRSGAPPPPPSESHGRIHGRPTTP-PPVRGG 332 >AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA, isoform A protein. Length = 607 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 511 PPXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 PP G PP PP++ G G P PP RGG Sbjct: 295 PPPKPRGHYRSGAPPPPPSESHGRIHGRPTTP-PPVRGG 332 >AE014134-231|AAF51393.1| 80|Drosophila melanogaster CG5011-PA protein. Length = 80 Score = 26.6 bits (56), Expect(2) = 3.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPP 943 P PP H PP PPP Sbjct: 3 PPPPHHHHNPPPHGPPP 19 Score = 23.0 bits (47), Expect(2) = 3.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 752 PPPPPXHQXN 781 PPPPP H N Sbjct: 2 PPPPPHHHHN 11 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 23.0 bits (47), Expect(3) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 740 PXXPPPPPP 766 P PPPPPP Sbjct: 42 PPPPPPPPP 50 Score = 23.0 bits (47), Expect(3) = 3.6 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P K PP PPPP PP Sbjct: 59 PPAAPAKAYIPPPPPPPPPAPKNTYIPP 86 Score = 21.4 bits (43), Expect(3) = 3.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 749 PPPPPPXHQXN 781 PPPPPP N Sbjct: 44 PPPPPPPAPKN 54 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 23.0 bits (47), Expect(3) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 740 PXXPPPPPP 766 P PPPPPP Sbjct: 42 PPPPPPPPP 50 Score = 23.0 bits (47), Expect(3) = 3.6 Identities = 10/28 (35%), Positives = 10/28 (35%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P K PP PPPP PP Sbjct: 59 PPAAPAKAYIPPPPPPPPPAPKNTYIPP 86 Score = 21.4 bits (43), Expect(3) = 3.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 749 PPPPPPXHQXN 781 PPPPPP N Sbjct: 44 PPPPPPPAPKN 54 >AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p protein. Length = 192 Score = 25.0 bits (52), Expect(2) = 4.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP +Q PP PP G PP Sbjct: 101 PPPPHPQQAPPPSMYPPDPSGYPGGYPP 128 Score = 23.8 bits (49), Expect(2) = 4.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 749 PPPPPPXH 772 PPPPPP H Sbjct: 98 PPPPPPPH 105 >AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-PA protein. Length = 192 Score = 25.0 bits (52), Expect(2) = 4.4 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP +Q PP PP G PP Sbjct: 101 PPPPHPQQAPPPSMYPPDPSGYPGGYPP 128 Score = 23.8 bits (49), Expect(2) = 4.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 749 PPPPPPXH 772 PPPPPP H Sbjct: 98 PPPPPPPH 105 >L14768-1|AAB39774.1| 1429|Drosophila melanogaster expanded protein. Length = 1429 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 728 PXXXPXXPPPPPP 766 P P PPPPPP Sbjct: 1004 PPSLPRQPPPPPP 1016 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 749 PPPPPPXH 772 PPPPPP H Sbjct: 1012 PPPPPPNH 1019 >AY069068-1|AAL39213.1| 1427|Drosophila melanogaster GH08582p protein. Length = 1427 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 728 PXXXPXXPPPPPP 766 P P PPPPPP Sbjct: 1004 PPSLPRQPPPPPP 1016 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 749 PPPPPPXH 772 PPPPPP H Sbjct: 1012 PPPPPPNH 1019 >AE014134-106|AAF51495.1| 1427|Drosophila melanogaster CG4114-PA protein. Length = 1427 Score = 24.6 bits (51), Expect(2) = 4.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 728 PXXXPXXPPPPPP 766 P P PPPPPP Sbjct: 1004 PPSLPRQPPPPPP 1016 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 Query: 749 PPPPPPXH 772 PPPPPP H Sbjct: 1012 PPPPPPNH 1019 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 26.6 bits (56), Expect(2) = 4.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 890 RPXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 +P PP + PP PPP R P P Sbjct: 218 KPLPPVTTRLPPPPPPPRTPPPTRPPTRP 246 Score = 21.8 bits (44), Expect(2) = 4.9 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 Query: 728 PXXXPXXPPPPPPXH 772 P P PP PPP + Sbjct: 198 PTRPPTRPPTPPPTY 212 >BT030179-1|ABN49318.1| 82|Drosophila melanogaster IP17830p protein. Length = 82 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 750 PPPPPQXTXKTXPPXHXXGXAPPPXXTXXH 839 PPPPP + PP + PPP H Sbjct: 47 PPPPPVMVVQQAPPPYYQNPPPPPPPGSSH 76 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 519 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 556 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 162 PPPPAPPTVEPPPPPPPAPPTVEPPPPP 189 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 175 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 172 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPP 452 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPP 452 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 586 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 586 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 172 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 514 PXGXGGXXXXPXPPXPPTKKXGXXXGAXAXPXPPXRGG 627 P G G P PP PP K G P PP G Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPG 172 >Y07653-1|CAA68937.1| 1263|Drosophila melanogaster spalt-related protein. Length = 1263 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 P PPPP GG+ P PP Sbjct: 1156 PNIPPPPFANGGKYPYPP 1173 >BT016151-1|AAV37036.1| 1267|Drosophila melanogaster AT17006p protein. Length = 1267 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 P PPPP GG+ P PP Sbjct: 1160 PNIPPPPFANGGKYPYPP 1177 >BT016144-1|AAV37029.1| 1267|Drosophila melanogaster AT24316p protein. Length = 1267 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 P PPPP GG+ P PP Sbjct: 1160 PNIPPPPFANGGKYPYPP 1177 >AY094813-1|AAM11166.1| 1413|Drosophila melanogaster LD30602p protein. Length = 1413 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 720 GGGPXXXLXXPPPPPQXTXKTXP--PXHXXGXAPPP 821 G GP PPPPPQ + P P PPP Sbjct: 34 GNGPPHYHLPPPPPPQQQQQQPPQQPQQQAPQGPPP 69 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G P PP Sbjct: 436 PPPPPSGNYGPP-PPPPSGNYGPPPPPP 462 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 29.5 bits (63), Expect = 7.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP G P PP Sbjct: 436 PPPPPSGNYGPP-PPPPSGNYGPPPPPP 462 >AE014134-2739|AAF53547.2| 1413|Drosophila melanogaster CG31738-PA, isoform A protein. Length = 1413 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 720 GGGPXXXLXXPPPPPQXTXKTXP--PXHXXGXAPPP 821 G GP PPPPPQ + P P PPP Sbjct: 34 GNGPPHYHLPPPPPPQQQQQQPPQQPQQQAPQGPPP 69 >AE014134-2738|AAF53546.3| 1700|Drosophila melanogaster CG31738-PB, isoform B protein. Length = 1700 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 720 GGGPXXXLXXPPPPPQXTXKTXP--PXHXXGXAPPP 821 G GP PPPPPQ + P P PPP Sbjct: 321 GNGPPHYHLPPPPPPQQQQQQPPQQPQQQAPQGPPP 356 >AE014134-2065|AAN10780.1| 1267|Drosophila melanogaster CG4881-PB, isoform B protein. Length = 1267 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 P PPPP GG+ P PP Sbjct: 1160 PNIPPPPFANGGKYPYPP 1177 >AE014134-2064|AAF53096.1| 1267|Drosophila melanogaster CG4881-PA, isoform A protein. Length = 1267 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 923 PPXPPPPXXGGGRXPXPP 976 P PPPP GG+ P PP Sbjct: 1160 PNIPPPPFANGGKYPYPP 1177 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP PP PPPP P PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 25.4 bits (53), Expect(2) = 8.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQ 775 P P PPPPPP Q Sbjct: 337 PPPPPPPPPPPPPPAQ 352 Score = 22.2 bits (45), Expect(2) = 8.7 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPP G P P Sbjct: 346 PPPPPAQTSAIPSPPPFPTKGAVKPLSP 373 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 25.4 bits (53), Expect(2) = 8.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 728 PXXXPXXPPPPPPXHQ 775 P P PPPPPP Q Sbjct: 337 PPPPPPPPPPPPPPAQ 352 Score = 22.2 bits (45), Expect(2) = 8.7 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXXGGGRXPXPP 976 P PP + P PPP G P P Sbjct: 346 PPPPPAQTSAIPSPPPFPTKGAVKPLSP 373 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 972 GXGXRPPPXXGGGGXGG 922 G G PPP GGGG GG Sbjct: 146 GPGPGPPPHYGGGGGGG 162 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXX-----GGGRXPXPP 976 P P H + PP PPP GGG P PP Sbjct: 171 PPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 203 >AY094861-1|AAM11214.1| 362|Drosophila melanogaster RE22192p protein. Length = 362 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 343 FXGGGPPXXXFFFXXGXPPPPXGG 272 F GGGPP + G PPPP G Sbjct: 171 FNGGGPPPPRPGWNGGGPPPPMPG 194 >AE014297-3653|AAF56353.1| 362|Drosophila melanogaster CG7016-PA protein. Length = 362 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 Query: 343 FXGGGPPXXXFFFXXGXPPPPXGG 272 F GGGPP + G PPPP G Sbjct: 171 FNGGGPPPPRPGWNGGGPPPPMPG 194 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 972 GXGXRPPPXXGGGGXGG 922 G G PPP GGGG GG Sbjct: 1330 GPGPGPPPHYGGGGGGG 1346 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXX-----GGGRXPXPP 976 P P H + PP PPP GGG P PP Sbjct: 1355 PPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 1387 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 972 GXGXRPPPXXGGGGXGG 922 G G PPP GGGG GG Sbjct: 1372 GPGPGPPPHYGGGGGGG 1388 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 5/33 (15%) Frame = +2 Query: 893 PXPPXHKQXXPPXPPPPXX-----GGGRXPXPP 976 P P H + PP PPP GGG P PP Sbjct: 1397 PPPAPHLRGMPPGGPPPTQQPGGAGGGGGPPPP 1429 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.310 0.144 0.473 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,178,241 Number of Sequences: 53049 Number of extensions: 823839 Number of successful extensions: 10717 Number of sequences better than 10.0: 79 Number of HSP's better than 10.0 without gapping: 2414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7866 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4935487923 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits)
- SilkBase 1999-2023 -