BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P11 (1016 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 1e-13 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 7e-10 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 59 5e-09 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-09 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 44 6e-09 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 44 6e-09 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 44 6e-09 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 44 6e-09 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 44 6e-09 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 44 6e-09 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 44 6e-09 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 44 6e-09 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 44 6e-09 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 44 6e-09 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 44 6e-09 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 44 6e-09 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 44 6e-09 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 44 6e-09 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 44 6e-09 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 44 6e-09 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 44 6e-09 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 44 6e-09 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 44 6e-09 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 44 6e-09 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 44 6e-09 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 44 6e-09 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 44 6e-09 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 44 6e-09 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 44 6e-09 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 44 6e-09 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 44 6e-09 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 44 6e-09 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 44 6e-09 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 44 6e-09 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 44 6e-09 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 44 6e-09 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 44 6e-09 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 44 6e-09 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 44 6e-09 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 44 6e-09 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 44 6e-09 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 44 6e-09 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 44 6e-09 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 44 6e-09 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 44 6e-09 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 44 6e-09 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 44 6e-09 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 44 6e-09 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 44 6e-09 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 44 6e-09 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 44 6e-09 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 44 6e-09 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 44 6e-09 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 44 6e-09 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 6e-09 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 44 6e-09 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 44 6e-09 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 44 6e-09 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 44 6e-09 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 44 6e-09 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 44 6e-09 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 44 6e-09 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 44 6e-09 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 44 6e-09 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 44 6e-09 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 44 6e-09 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 44 6e-09 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 44 6e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-09 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 44 7e-09 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 44 7e-09 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 44 7e-09 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 44 7e-09 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 44 7e-09 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 44 7e-09 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 44 7e-09 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 44 7e-09 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 44 7e-09 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 44 7e-09 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 44 7e-09 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 44 7e-09 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 44 7e-09 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 44 7e-09 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 44 7e-09 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 44 7e-09 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 44 7e-09 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 44 7e-09 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 44 7e-09 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 44 7e-09 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 44 7e-09 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 44 7e-09 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 44 7e-09 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 44 7e-09 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 44 7e-09 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 44 7e-09 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 44 7e-09 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 7e-09 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 7e-09 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 44 7e-09 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 44 7e-09 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-09 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 77.0 bits (181), Expect = 2e-14 Identities = 39/64 (60%), Positives = 40/64 (62%) Frame = -1 Query: 719 RXVGGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPS 540 R GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPS Sbjct: 21 RGSGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPS 80 Query: 539 AASQ 528 AASQ Sbjct: 81 AASQ 84 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 76.2 bits (179), Expect = 4e-14 Identities = 38/61 (62%), Positives = 39/61 (63%) Frame = -1 Query: 710 GGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPSAAS 531 GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPSAAS Sbjct: 759 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 818 Query: 530 Q 528 Q Sbjct: 819 Q 819 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 76.2 bits (179), Expect = 4e-14 Identities = 38/61 (62%), Positives = 39/61 (63%) Frame = -1 Query: 710 GGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPSAAS 531 GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPSAAS Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 60 Query: 530 Q 528 Q Sbjct: 61 Q 61 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 76.2 bits (179), Expect = 4e-14 Identities = 38/61 (62%), Positives = 39/61 (63%) Frame = -1 Query: 710 GGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPSAAS 531 GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPSAAS Sbjct: 406 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 465 Query: 530 Q 528 Q Sbjct: 466 Q 466 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 76.2 bits (179), Expect = 4e-14 Identities = 38/61 (62%), Positives = 39/61 (63%) Frame = -1 Query: 710 GGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPSAAS 531 GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPSAAS Sbjct: 23 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAS 82 Query: 530 Q 528 Q Sbjct: 83 Q 83 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 74.5 bits (175), Expect = 1e-13 Identities = 37/61 (60%), Positives = 38/61 (62%) Frame = -1 Query: 710 GGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERPSAAS 531 GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERPSAA Sbjct: 1 GGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERPSAAK 60 Query: 530 Q 528 Q Sbjct: 61 Q 61 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 74.1 bits (174), Expect = 2e-13 Identities = 37/64 (57%), Positives = 40/64 (62%) Frame = -1 Query: 722 VRXVGGGSLXKXAATXPFYGSWPLXGLWLTXSFLRYPLILWITVXXXXXXXXXXXXXERP 543 +R GGG+ K AT PFYGSWP GL LT SFLRYPLILWITV ERP Sbjct: 551 LRGKGGGAYGKTPATRPFYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 Query: 542 SAAS 531 SAA+ Sbjct: 611 SAAT 614 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 70.5 bits (165), Expect = 2e-12 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 711 RGGEPXEXGSNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 RG EP + SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 17 RGAEPMKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 63.7 bits (148), Expect = 2e-10 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFEXAD 568 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE D Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 62.1 bits (144), Expect = 7e-10 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFEXADT 565 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE ++ Sbjct: 102 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYTNS 141 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 68 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 61.7 bits (143), Expect = 9e-10 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAFE Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 60.5 bits (140), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM +PA+SPDSVDNRITAFE Sbjct: 10 SNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 60.5 bits (140), Expect = 2e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAF P AHM FPA+SPDSVDNRITAF+ Sbjct: 26 SNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 59.7 bits (138), Expect = 4e-09 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 684 SNXAFLRXLAFGGPLAHMXFPAVSPDSVDNRITAFE 577 SN AFLR LAFG P AHM F A+SPD VDNRITAFE Sbjct: 26 SNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 59.3 bits (137), Expect = 5e-09 Identities = 29/74 (39%), Positives = 30/74 (40%) Frame = +2 Query: 791 PPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXAPPPXG 970 PP P P +P PP PPP PP P P P P PPP PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP-------PPPPPPPPPPPPP 418 Query: 971 XRXPXPPXAXPPPP 1012 P PP PPPP Sbjct: 419 APPPPPPPPPPPPP 432 Score = 57.6 bits (133), Expect = 1e-08 Identities = 31/78 (39%), Positives = 31/78 (39%) Frame = +2 Query: 776 PXXPXPPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXA 955 P P PP P P P PP PPP PP P P P P PPP A Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP------PPPPPPPA 419 Query: 956 PPPXGXRXPXPPXAXPPP 1009 PPP P PP PPP Sbjct: 420 PPP-----PPPPPPPPPP 432 Score = 56.0 bits (129), Expect = 5e-08 Identities = 25/66 (37%), Positives = 25/66 (37%) Frame = +2 Query: 815 PXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXAPPPXGXRXPXPPX 994 P P PP P P PP P P P P PPP PPP P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 995 AXPPPP 1012 PPPP Sbjct: 425 PPPPPP 430 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +2 Query: 776 PXXPXPPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXA 955 P P PP P P P PP P P PP P P P P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 956 PPPXGXRXPXPP 991 PPP R P Sbjct: 429 PPPPALRLACAP 440 Score = 51.6 bits (118), Expect = 1e-06 Identities = 27/74 (36%), Positives = 27/74 (36%) Frame = +2 Query: 776 PXXPXPPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXA 955 P P PP P P P PP PPP P P P P P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 956 PPPXGXRXPXPPXA 997 PPP P PP A Sbjct: 425 PPP-----PPPPPA 433 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/72 (34%), Positives = 25/72 (34%) Frame = +2 Query: 776 PXXPXPPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXPXXPPPXA 955 P P PP P P P PP PP PP P P P P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 956 PPPXGXRXPXPP 991 PPP PP Sbjct: 430 PPPALRLACAPP 441 Score = 35.9 bits (79), Expect = 0.052 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 776 PXXPXPPVHPXELPXXTPXKPPXXPPPLXPPXXXXPKXXXPXXXPXXXRGXXP 934 P P PP P P P PP PPP PP P P R P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 32.7 bits (71), Expect = 0.49 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +1 Query: 754 TDLXYXXPPXPPXPCPPXRTPXXXPXKTPXXAPPPLXPPXP 876 TD+ PP P PP P P P P P PP P Sbjct: 355 TDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 >SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 43.6 bits (98), Expect(2) = 5e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 9 ALMNRPTRGERRFAYWAL 26 Score = 35.5 bits (78), Expect(2) = 5e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 67 PLPRSLTRYARSFNCGE 83 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 2612 ALMNRPTRGERRFAYWAL 2629 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 2670 PLPRSLTRYARSFDCGE 2686 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 1425 ALMNRPTRGERRFAYWAL 1442 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 1483 PLPRSLTRYARSFDCGE 1499 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 549 ALMNRPTRGERRFAYWAL 566 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 607 PLPRSLTRYARSFDCGE 623 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 487 ALMNRPTRGERRFAYWAL 504 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 545 PLPRSLTRYARSFDCGE 561 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 1331 ALMNRPTRGERRFAYWAL 1348 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 1389 PLPRSLTRYARSFDCGE 1405 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 1155 ALMNRPTRGERRFAYWAL 1172 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 1213 PLPRSLTRYARSFDCGE 1229 >SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1329 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 1022 ALMNRPTRGERRFAYWAL 1039 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 1080 PLPRSLTRYARSFDCGE 1096 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 44 ALMNRPTRGERRFAYWAL 61 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 102 PLPRSLTRYARSFDCGE 118 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 395 ALMNRPTRGERRFAYWAL 412 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 453 PLPRSLTRYARSFDCGE 469 >SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 1000 ALMNRPTRGERRFAYWAL 1017 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 1058 PLPRSLTRYARSFDCGE 1074 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 933 ALMNRPTRGERRFAYWAL 950 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 991 PLPRSLTRYARSFDCGE 1007 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 560 ALMNRPTRGERRFAYWAL 577 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 618 PLPRSLTRYARSFDCGE 634 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 803 ALMNRPTRGERRFAYWAL 820 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 861 PLPRSLTRYARSFDCGE 877 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 299 ALMNRPTRGERRFAYWAL 316 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 357 PLPRSLTRYARSFDCGE 373 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 745 ALMNRPTRGERRFAYWAL 762 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 803 PLPRSLTRYARSFDCGE 819 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 223 ALMNRPTRGERRFAYWAL 240 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 281 PLPRSLTRYARSFDCGE 297 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 438 ALMNRPTRGERRFAYWAL 455 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 496 PLPRSLTRYARSFDCGE 512 >SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) Length = 684 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 118 ALMNRPTRGERRFAYWAL 135 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 176 PLPRSLTRYARSFDCGE 192 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 586 ALMNRPTRGERRFAYWAL 603 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 644 PLPRSLTRYARSFDCGE 660 >SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) Length = 678 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 145 ALMNRPTRGERRFAYWAL 162 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 203 PLPRSLTRYARSFDCGE 219 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 578 ALMNRPTRGERRFAYWAL 595 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 636 PLPRSLTRYARSFDCGE 652 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 577 ALMNRPTRGERRFAYWAL 594 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 635 PLPRSLTRYARSFDCGE 651 >SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 359 ALMNRPTRGERRFAYWAL 376 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 417 PLPRSLTRYARSFDCGE 433 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 200 ALMNRPTRGERRFAYWAL 217 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 258 PLPRSLTRYARSFDCGE 274 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 445 ALMNRPTRGERRFAYWAL 462 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 503 PLPRSLTRYARSFDCGE 519 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 470 ALMNRPTRGERRFAYWAL 487 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 528 PLPRSLTRYARSFDCGE 544 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 494 ALMNRPTRGERRFAYWAL 511 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 552 PLPRSLTRYARSFDCGE 568 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 488 ALMNRPTRGERRFAYWAL 505 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 546 PLPRSLTRYARSFDCGE 562 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 472 ALMNRPTRGERRFAYWAL 489 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 530 PLPRSLTRYARSFDCGE 546 >SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) Length = 568 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 472 ALMNRPTRGERRFAYWAL 489 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 530 PLPRSLTRYARSFDCGE 546 >SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) Length = 561 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 465 ALMNRPTRGERRFAYWAL 482 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 523 PLPRSLTRYARSFDCGE 539 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 462 ALMNRPTRGERRFAYWAL 479 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 520 PLPRSLTRYARSFDCGE 536 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 302 ALMNRPTRGERRFAYWAL 319 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 360 PLPRSLTRYARSFDCGE 376 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 389 ALMNRPTRGERRFAYWAL 406 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 447 PLPRSLTRYARSFDCGE 463 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 424 ALMNRPTRGERRFAYWAL 441 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 482 PLPRSLTRYARSFDCGE 498 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 9 ALMNRPTRGERRFAYWAL 26 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 67 PLPRSLTRYARSFDCGE 83 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 316 ALMNRPTRGERRFAYWAL 333 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 374 PLPRSLTRYARSFDCGE 390 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 392 ALMNRPTRGERRFAYWAL 409 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 450 PLPRSLTRYARSFDCGE 466 >SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) Length = 473 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 29 ALMNRPTRGERRFAYWAL 46 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 87 PLPRSLTRYARSFDCGE 103 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 372 ALMNRPTRGERRFAYWAL 389 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 430 PLPRSLTRYARSFDCGE 446 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 9 ALMNRPTRGERRFAYWAL 26 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 67 PLPRSLTRYARSFDCGE 83 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 234 ALMNRPTRGERRFAYWAL 251 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 292 PLPRSLTRYARSFDCGE 308 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 146 ALMNRPTRGERRFAYWAL 163 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 204 PLPRSLTRYARSFDCGE 220 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 320 ALMNRPTRGERRFAYWAL 337 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 378 PLPRSLTRYARSFDCGE 394 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 301 ALMNRPTRGERRFAYWAL 318 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 359 PLPRSLTRYARSFDCGE 375 Score = 29.9 bits (64), Expect = 3.4 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 6/56 (10%) Frame = +2 Query: 785 PXPPVHPXELPXXTPXKPP------XXPPPLXPPXXXXPKXXXPXXXPXXXRGXXP 934 P PP +P P KPP PPPL PP + P P + P Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGKPVVP 299 >SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) Length = 374 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 278 ALMNRPTRGERRFAYWAL 295 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 336 PLPRSLTRYARSFDCGE 352 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 275 ALMNRPTRGERRFAYWAL 292 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 333 PLPRSLTRYARSFDCGE 349 >SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) Length = 369 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 273 ALMNRPTRGERRFAYWAL 290 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 331 PLPRSLTRYARSFDCGE 347 >SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 370 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 274 ALMNRPTRGERRFAYWAL 291 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 332 PLPRSLTRYARSFDCGE 348 >SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) Length = 370 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 274 ALMNRPTRGERRFAYWAL 291 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 332 PLPRSLTRYARSFDCGE 348 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 153 ALMNRPTRGERRFAYWAL 170 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 211 PLPRSLTRYARSFDCGE 227 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 245 ALMNRPTRGERRFAYWAL 262 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 303 PLPRSLTRYARSFDCGE 319 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 240 ALMNRPTRGERRFAYWAL 257 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 298 PLPRSLTRYARSFDCGE 314 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) Length = 334 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 238 ALMNRPTRGERRFAYWAL 255 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 296 PLPRSLTRYARSFDCGE 312 >SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 234 ALMNRPTRGERRFAYWAL 251 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 292 PLPRSLTRYARSFDCGE 308 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 228 ALMNRPTRGERRFAYWAL 245 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 286 PLPRSLTRYARSFDCGE 302 >SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 210 ALMNRPTRGERRFAYWAL 227 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 268 PLPRSLTRYARSFDCGE 284 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 204 ALMNRPTRGERRFAYWAL 221 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 262 PLPRSLTRYARSFDCGE 278 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 197 ALMNRPTRGERRFAYWAL 214 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 255 PLPRSLTRYARSFDCGE 271 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 191 ALMNRPTRGERRFAYWAL 208 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 249 PLPRSLTRYARSFDCGE 265 >SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) Length = 288 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 192 ALMNRPTRGERRFAYWAL 209 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 250 PLPRSLTRYARSFDCGE 266 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 188 ALMNRPTRGERRFAYWAL 205 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 246 PLPRSLTRYARSFDCGE 262 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 190 ALMNRPTRGERRFAYWAL 207 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 248 PLPRSLTRYARSFDCGE 264 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 186 ALMNRPTRGERRFAYWAL 203 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 244 PLPRSLTRYARSFDCGE 260 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 128 ALMNRPTRGERRFAYWAL 145 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 186 PLPRSLTRYARSFDCGE 202 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 176 ALMNRPTRGERRFAYWAL 193 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 234 PLPRSLTRYARSFDCGE 250 >SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) Length = 270 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 174 ALMNRPTRGERRFAYWAL 191 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 232 PLPRSLTRYARSFDCGE 248 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 159 ALMNRPTRGERRFAYWAL 176 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 217 PLPRSLTRYARSFDCGE 233 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 143 ALMNRPTRGERRFAYWAL 160 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 201 PLPRSLTRYARSFDCGE 217 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 141 ALMNRPTRGERRFAYWAL 158 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 199 PLPRSLTRYARSFDCGE 215 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 142 ALMNRPTRGERRFAYWAL 159 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 200 PLPRSLTRYARSFDCGE 216 >SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) Length = 236 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 80 ALMNRPTRGERRFAYWAL 97 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 138 PLPRSLTRYARSFDCGE 154 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 135 ALMNRPTRGERRFAYWAL 152 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 193 PLPRSLTRYARSFDCGE 209 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 131 ALMNRPTRGERRFAYWAL 148 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 189 PLPRSLTRYARSFDCGE 205 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 132 ALMNRPTRGERRFAYWAL 149 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 190 PLPRSLTRYARSFDCGE 206 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 123 ALMNRPTRGERRFAYWAL 140 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 181 PLPRSLTRYARSFDCGE 197 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 121 ALMNRPTRGERRFAYWAL 138 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 179 PLPRSLTRYARSFDCGE 195 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 120 ALMNRPTRGERRFAYWAL 137 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 178 PLPRSLTRYARSFDCGE 194 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 120 ALMNRPTRGERRFAYWAL 137 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 178 PLPRSLTRYARSFDCGE 194 >SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 119 ALMNRPTRGERRFAYWAL 136 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 177 PLPRSLTRYARSFDCGE 193 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 117 ALMNRPTRGERRFAYWAL 134 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 175 PLPRSLTRYARSFDCGE 191 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 117 ALMNRPTRGERRFAYWAL 134 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 175 PLPRSLTRYARSFDCGE 191 >SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 116 ALMNRPTRGERRFAYWAL 133 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 174 PLPRSLTRYARSFDCGE 190 >SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 118 ALMNRPTRGERRFAYWAL 135 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 176 PLPRSLTRYARSFDCGE 192 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 115 ALMNRPTRGERRFAYWAL 132 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 173 PLPRSLTRYARSFDCGE 189 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 111 ALMNRPTRGERRFAYWAL 128 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 169 PLPRSLTRYARSFDCGE 185 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 109 ALMNRPTRGERRFAYWAL 126 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 167 PLPRSLTRYARSFDCGE 183 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 108 ALMNRPTRGERRFAYWAL 125 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 166 PLPRSLTRYARSFDCGE 182 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 109 ALMNRPTRGERRFAYWAL 126 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 167 PLPRSLTRYARSFDCGE 183 >SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 109 ALMNRPTRGERRFAYWAL 126 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 167 PLPRSLTRYARSFDCGE 183 >SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 107 ALMNRPTRGERRFAYWAL 124 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 165 PLPRSLTRYARSFDCGE 181 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 104 ALMNRPTRGERRFAYWAL 121 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 162 PLPRSLTRYARSFDCGE 178 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 106 ALMNRPTRGERRFAYWAL 123 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 164 PLPRSLTRYARSFDCGE 180 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 102 ALMNRPTRGERRFAYWAL 119 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 160 PLPRSLTRYARSFDCGE 176 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 101 ALMNRPTRGERRFAYWAL 118 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 159 PLPRSLTRYARSFDCGE 175 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 102 ALMNRPTRGERRFAYWAL 119 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 160 PLPRSLTRYARSFDCGE 176 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 101 ALMNRPTRGERRFAYWAL 118 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 159 PLPRSLTRYARSFDCGE 175 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 103 ALMNRPTRGERRFAYWAL 120 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 161 PLPRSLTRYARSFDCGE 177 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 101 ALMNRPTRGERRFAYWAL 118 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 159 PLPRSLTRYARSFDCGE 175 >SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) Length = 199 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 103 ALMNRPTRGERRFAYWAL 120 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 161 PLPRSLTRYARSFDCGE 177 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 43.6 bits (98), Expect(2) = 6e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 101 ALMNRPTRGERRFAYWAL 118 Score = 35.1 bits (77), Expect(2) = 6e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 159 PLPRSLTRYARSFDCGE 175 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 99 ALMNRPTRGERRFAYWAL 116 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 157 PLPRSLTRYARSFDCGE 173 >SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 99 ALMNRPTRGERRFAYWAL 116 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 157 PLPRSLTRYARSFDCGE 173 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 95 ALMNRPTRGERRFAYWAL 112 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 153 PLPRSLTRYARSFDCGE 169 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 97 ALMNRPTRGERRFAYWAL 114 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 155 PLPRSLTRYARSFDCGE 171 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 95 ALMNRPTRGERRFAYWAL 112 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 153 PLPRSLTRYARSFDCGE 169 >SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) Length = 191 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 95 ALMNRPTRGERRFAYWAL 112 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 153 PLPRSLTRYARSFDCGE 169 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 92 ALMNRPTRGERRFAYWAL 109 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 150 PLPRSLTRYARSFDCGE 166 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 94 ALMNRPTRGERRFAYWAL 111 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 152 PLPRSLTRYARSFDCGE 168 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 93 ALMNRPTRGERRFAYWAL 110 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 151 PLPRSLTRYARSFDCGE 167 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 93 ALMNRPTRGERRFAYWAL 110 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 151 PLPRSLTRYARSFDCGE 167 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 91 ALMNRPTRGERRFAYWAL 108 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 149 PLPRSLTRYARSFDCGE 165 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 91 ALMNRPTRGERRFAYWAL 108 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 149 PLPRSLTRYARSFDCGE 165 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 90 ALMNRPTRGERRFAYWAL 107 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 148 PLPRSLTRYARSFDCGE 164 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 86 ALMNRPTRGERRFAYWAL 103 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 144 PLPRSLTRYARSFDCGE 160 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 88 ALMNRPTRGERRFAYWAL 105 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 146 PLPRSLTRYARSFDCGE 162 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 87 ALMNRPTRGERRFAYWAL 104 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 145 PLPRSLTRYARSFDCGE 161 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 9 ALMNRPTRGERRFAYWAL 26 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 67 PLPRSLTRYARSFDCGE 83 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 83 ALMNRPTRGERRFAYWAL 100 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 141 PLPRSLTRYARSFDCGE 157 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 83 ALMNRPTRGERRFAYWAL 100 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 141 PLPRSLTRYARSFDCGE 157 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 84 ALMNRPTRGERRFAYWAL 101 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 142 PLPRSLTRYARSFDCGE 158 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 83 ALMNRPTRGERRFAYWAL 100 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 141 PLPRSLTRYARSFDCGE 157 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 82 ALMNRPTRGERRFAYWAL 99 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 140 PLPRSLTRYARSFDCGE 156 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 82 ALMNRPTRGERRFAYWAL 99 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 140 PLPRSLTRYARSFDCGE 156 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 81 ALMNRPTRGERRFAYWAL 98 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 139 PLPRSLTRYARSFDCGE 155 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 81 ALMNRPTRGERRFAYWAL 98 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 139 PLPRSLTRYARSFDCGE 155 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 80 ALMNRPTRGERRFAYWAL 97 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 138 PLPRSLTRYARSFDCGE 154 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 81 ALMNRPTRGERRFAYWAL 98 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 139 PLPRSLTRYARSFDCGE 155 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 82 ALMNRPTRGERRFAYWAL 99 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 140 PLPRSLTRYARSFDCGE 156 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 82 ALMNRPTRGERRFAYWAL 99 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 140 PLPRSLTRYARSFDCGE 156 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 79 ALMNRPTRGERRFAYWAL 96 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 137 PLPRSLTRYARSFDCGE 153 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 79 ALMNRPTRGERRFAYWAL 96 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 137 PLPRSLTRYARSFDCGE 153 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 79 ALMNRPTRGERRFAYWAL 96 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 137 PLPRSLTRYARSFDCGE 153 >SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 77 ALMNRPTRGERRFAYWAL 94 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 135 PLPRSLTRYARSFDCGE 151 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 79 ALMNRPTRGERRFAYWAL 96 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 137 PLPRSLTRYARSFDCGE 153 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 79 ALMNRPTRGERRFAYWAL 96 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 137 PLPRSLTRYARSFDCGE 153 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 75 ALMNRPTRGERRFAYWAL 92 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 133 PLPRSLTRYARSFDCGE 149 >SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 75 ALMNRPTRGERRFAYWAL 92 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 133 PLPRSLTRYARSFDCGE 149 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 75 ALMNRPTRGERRFAYWAL 92 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 133 PLPRSLTRYARSFDCGE 149 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 72 ALMNRPTRGERRFAYWAL 89 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 130 PLPRSLTRYARSFDCGE 146 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 71 ALMNRPTRGERRFAYWAL 88 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 129 PLPRSLTRYARSFDCGE 145 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 72 ALMNRPTRGERRFAYWAL 89 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 130 PLPRSLTRYARSFDCGE 146 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 71 ALMNRPTRGERRFAYWAL 88 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 129 PLPRSLTRYARSFDCGE 145 >SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 71 ALMNRPTRGERRFAYWAL 88 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 129 PLPRSLTRYARSFDCGE 145 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 71 ALMNRPTRGERRFAYWAL 88 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 129 PLPRSLTRYARSFDCGE 145 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 70 ALMNRPTRGERRFAYWAL 87 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 128 PLPRSLTRYARSFDCGE 144 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 70 ALMNRPTRGERRFAYWAL 87 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 128 PLPRSLTRYARSFDCGE 144 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 68 ALMNRPTRGERRFAYWAL 85 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 126 PLPRSLTRYARSFDCGE 142 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 66 ALMNRPTRGERRFAYWAL 83 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 124 PLPRSLTRYARSFDCGE 140 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 65 ALMNRPTRGERRFAYWAL 82 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 123 PLPRSLTRYARSFDCGE 139 >SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 67 ALMNRPTRGERRFAYWAL 84 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 125 PLPRSLTRYARSFDCGE 141 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 62 ALMNRPTRGERRFAYWAL 79 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 120 PLPRSLTRYARSFDCGE 136 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 62 ALMNRPTRGERRFAYWAL 79 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 120 PLPRSLTRYARSFDCGE 136 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 62 ALMNRPTRGERRFAYWAL 79 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 120 PLPRSLTRYARSFDCGE 136 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 64 ALMNRPTRGERRFAYWAL 81 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 122 PLPRSLTRYARSFDCGE 138 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 62 ALMNRPTRGERRFAYWAL 79 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 120 PLPRSLTRYARSFDCGE 136 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 59 ALMNRPTRGERRFAYWAL 76 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 117 PLPRSLTRYARSFDCGE 133 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 61 ALMNRPTRGERRFAYWAL 78 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 119 PLPRSLTRYARSFDCGE 135 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 61 ALMNRPTRGERRFAYWAL 78 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 119 PLPRSLTRYARSFDCGE 135 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 60 ALMNRPTRGERRFAYWAL 77 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 118 PLPRSLTRYARSFDCGE 134 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 60 ALMNRPTRGERRFAYWAL 77 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 118 PLPRSLTRYARSFDCGE 134 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 56 ALMNRPTRGERRFAYWAL 73 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 114 PLPRSLTRYARSFDCGE 130 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 57 ALMNRPTRGERRFAYWAL 74 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 115 PLPRSLTRYARSFDCGE 131 >SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 57 ALMNRPTRGERRFAYWAL 74 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 115 PLPRSLTRYARSFDCGE 131 >SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 58 ALMNRPTRGERRFAYWAL 75 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 116 PLPRSLTRYARSFDCGE 132 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 54 ALMNRPTRGERRFAYWAL 71 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 112 PLPRSLTRYARSFDCGE 128 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 53 ALMNRPTRGERRFAYWAL 70 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 111 PLPRSLTRYARSFDCGE 127 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 54 ALMNRPTRGERRFAYWAL 71 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 112 PLPRSLTRYARSFDCGE 128 >SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 53 ALMNRPTRGERRFAYWAL 70 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 111 PLPRSLTRYARSFDCGE 127 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 52 ALMNRPTRGERRFAYWAL 69 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 110 PLPRSLTRYARSFDCGE 126 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 51 ALMNRPTRGERRFAYWAL 68 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 109 PLPRSLTRYARSFDCGE 125 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 50 ALMNRPTRGERRFAYWAL 67 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 108 PLPRSLTRYARSFDCGE 124 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 50 ALMNRPTRGERRFAYWAL 67 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 108 PLPRSLTRYARSFDCGE 124 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 50 ALMNRPTRGERRFAYWAL 67 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 108 PLPRSLTRYARSFDCGE 124 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 51 ALMNRPTRGERRFAYWAL 68 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 109 PLPRSLTRYARSFDCGE 125 >SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) Length = 147 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 51 ALMNRPTRGERRFAYWAL 68 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 109 PLPRSLTRYARSFDCGE 125 >SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 50 ALMNRPTRGERRFAYWAL 67 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 108 PLPRSLTRYARSFDCGE 124 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 48 ALMNRPTRGERRFAYWAL 65 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 106 PLPRSLTRYARSFDCGE 122 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 49 ALMNRPTRGERRFAYWAL 66 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 107 PLPRSLTRYARSFDCGE 123 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 47 ALMNRPTRGERRFAYWAL 64 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 105 PLPRSLTRYARSFDCGE 121 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 26 ALMNRPTRGERRFAYWAL 43 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 84 PLPRSLTRYARSFDCGE 100 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 49 ALMNRPTRGERRFAYWAL 66 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 107 PLPRSLTRYARSFDCGE 123 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 45 ALMNRPTRGERRFAYWAL 62 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 103 PLPRSLTRYARSFDCGE 119 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 43.6 bits (98), Expect(2) = 7e-09 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +3 Query: 456 ALMNRPTRGERRFAYWAL 509 ALMNRPTRGERRFAYWAL Sbjct: 46 ALMNRPTRGERRFAYWAL 63 Score = 35.1 bits (77), Expect(2) = 7e-09 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 513 PLPRSLTRCARSFGCGE 563 PLPRSLTR ARSF CGE Sbjct: 104 PLPRSLTRYARSFDCGE 120 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,867,246 Number of Sequences: 59808 Number of extensions: 385595 Number of successful extensions: 7587 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1974 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4448 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3023635215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -