BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P11 (1016 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 3.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.7 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.4 bits (48), Expect = 3.3 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +2 Query: 785 PXPPVHPXELPXXTPXKPPXXPPPLXPP 868 P P P +P P PPP PP Sbjct: 25 PSPHQSPQAPQRGSPPNPSQGPPPGGPP 52 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/32 (31%), Positives = 11/32 (34%) Frame = +1 Query: 775 PPXPPXPCPPXRTPXXXPXKTPXXAPPPLXPP 870 P P P + P P PPP PP Sbjct: 21 PGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPP 52 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 7.7 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -2 Query: 568 YRSPQPNDRAQRVSERGSGKSAQYANRLSPRVG 470 Y PQP + Q ++ + +Q AN+ P G Sbjct: 997 YTPPQPANAQQGQAQAQAKPQSQEANKPKPATG 1029 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,236 Number of Sequences: 438 Number of extensions: 4532 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 33862920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -