BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P10 (968 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0435 + 3428552-3428636,3429242-3429352,3429434-3429738,342... 255 3e-68 11_01_0427 + 3274817-3274901,3275587-3275697,3275979-3276283,327... 252 2e-67 02_05_0686 - 30900748-30902167,30903442-30904742 40 0.003 03_01_0023 + 198414-198968 39 0.005 07_03_0560 + 19479597-19480667 38 0.009 03_01_0515 - 3864796-3865425 38 0.009 12_02_0299 - 17051570-17052474,17053542-17053755 38 0.016 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 38 0.016 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 37 0.028 07_03_1136 + 24218601-24218734,24218769-24219906 37 0.028 06_03_1326 - 29355467-29355817 37 0.028 06_03_0790 - 24636805-24637770 37 0.028 12_02_1174 - 26696869-26698191 36 0.037 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 36 0.037 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 36 0.037 02_04_0400 - 22608519-22608844,22609044-22609122 36 0.037 07_03_0559 + 19475893-19476783 36 0.049 10_08_0214 - 15915156-15915713 36 0.064 01_01_0570 - 4231100-4232560 36 0.064 06_01_0486 - 3455030-3455770 35 0.085 06_01_0178 + 1386981-1387505 35 0.085 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 35 0.085 07_03_1433 + 26513728-26514135,26525534-26526280 35 0.11 07_03_0558 + 19461369-19462448 35 0.11 07_03_0177 - 14770777-14772045 35 0.11 06_02_0271 + 13618149-13618297,13618311-13618560 35 0.11 03_05_0630 + 26260159-26260272,26260520-26260894 35 0.11 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 31 0.12 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 34 0.15 06_03_1506 + 30641428-30642168 34 0.20 06_02_0120 + 12055076-12055175,12055322-12055725 34 0.20 04_03_0098 + 11183039-11183752 34 0.20 03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778,864... 34 0.20 12_01_0841 - 7873458-7874225 33 0.26 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 33 0.26 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 33 0.26 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.26 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 33 0.26 01_01_0082 + 625198-625719 33 0.26 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 33 0.34 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 33 0.34 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 33 0.34 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 33 0.34 01_01_0929 - 7344911-7345978 33 0.34 01_01_0715 - 5542648-5543219,5543352-5543544 33 0.34 01_01_0070 - 542603-542686,542803-543441 33 0.34 08_02_1615 + 28257275-28258428,28258523-28259144 33 0.45 08_01_0059 - 394001-394708 33 0.45 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 33 0.45 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 33 0.45 04_04_0675 + 27183826-27184443 33 0.45 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 33 0.45 01_05_0490 + 22672241-22674679 32 0.59 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 32 0.60 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 32 0.60 07_03_1751 - 29215074-29216270 32 0.60 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 32 0.60 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 32 0.60 07_01_0080 + 587674-588510 32 0.60 06_03_0429 - 20701107-20701534,20701628-20701847 32 0.60 04_04_0679 + 27214577-27215023 32 0.60 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 32 0.60 12_02_0310 - 17358220-17358834 32 0.79 12_01_0776 + 7076218-7076832 32 0.79 10_08_0222 - 15983756-15984313 32 0.79 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 32 0.79 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 32 0.79 07_03_0782 - 21497949-21498563 32 0.79 06_01_0690 + 5033943-5034740 32 0.79 04_04_1687 - 35365766-35366356,35367137-35368135 32 0.79 04_04_1125 + 31085106-31085714 32 0.79 04_04_0066 - 22495396-22495424,22495716-22495758,22495871-224961... 32 0.79 03_02_0765 + 11000724-11002496 32 0.79 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 32 0.79 01_06_0146 + 26969011-26969995,26970878-26970930 32 0.79 01_02_0131 - 11441713-11441728,11441911-11441953,11442324-11442762 32 0.79 01_01_0036 + 278982-279494 32 0.79 10_03_0023 - 7151465-7152111,7152222-7152405 31 1.0 08_02_0620 + 19387935-19388279 31 1.0 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.0 06_03_1146 - 28004896-28005554,28005664-28005844 31 1.0 06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 31 1.0 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.0 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 31 1.0 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.0 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.0 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 31 1.4 11_06_0610 - 25449085-25453284 31 1.4 11_04_0246 - 15311912-15312481 31 1.4 05_07_0217 - 28469229-28469798 31 1.4 04_04_0708 - 27441373-27442611 31 1.4 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 31 1.4 02_05_0269 + 27307837-27308424 31 1.4 02_05_0149 + 26290236-26290880 31 1.4 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 1.4 07_03_1065 + 23711677-23711837,23711859-23712180,23713071-23713277 31 1.8 07_03_0527 - 19085828-19086319 31 1.8 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 31 1.8 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 31 1.8 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 31 1.8 12_02_1219 + 27096477-27096590,27096704-27097078 30 2.4 10_08_0213 - 15912048-15912716 30 2.4 09_06_0081 + 20745627-20748144,20748211-20748308 30 2.4 09_02_0543 + 10427321-10428315,10428440-10429154 30 2.4 07_03_1533 + 27523811-27524710 30 2.4 07_01_0516 - 3850252-3852870 30 2.4 06_01_0747 - 5587261-5587356,5587472-5587855,5588133-5588192,558... 30 2.4 05_05_0101 - 22398814-22399164 30 2.4 04_04_0267 + 24048649-24049140,24049521-24049835 30 2.4 04_03_1022 - 21778315-21779007 30 2.4 04_01_0583 + 7563290-7563904 30 2.4 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 30 2.4 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 30 2.4 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 30 3.2 10_08_0221 - 15980370-15980927 30 3.2 10_08_0217 - 15962192-15962884 30 3.2 10_07_0087 - 12762745-12763236 30 3.2 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 3.2 07_03_0154 + 14509979-14512033 30 3.2 07_01_0662 + 4972953-4973645,4973758-4974046,4974790-4974803,497... 30 3.2 07_01_0479 + 3606663-3607448 30 3.2 05_07_0100 + 27679280-27680320 30 3.2 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 30 3.2 05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094,450... 30 3.2 04_04_0057 + 22410167-22411330 30 3.2 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 30 3.2 01_06_0317 + 28425408-28426079,28426286-28426351 30 3.2 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 29 4.2 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 29 4.2 10_08_0223 - 15986763-15987575 29 4.2 10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 29 4.2 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 29 4.2 06_03_1153 - 28047125-28047751 29 4.2 06_03_0395 - 20354713-20355570 29 4.2 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 29 4.2 04_03_0904 + 20717005-20718087 29 4.2 04_03_0833 + 20147242-20147849,20147937-20148081,20148157-201482... 29 4.2 03_05_0267 - 22538631-22539452 29 4.2 02_05_1277 - 35408097-35409080 29 4.2 02_05_0157 - 26353971-26354336,26354645-26354726,26354838-263549... 29 4.2 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 4.2 01_01_1125 - 8920590-8924372 29 4.2 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 29 5.6 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 29 5.6 12_01_0838 - 7830944-7831444 29 5.6 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 29 5.6 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 5.6 10_08_0218 - 15967064-15967906 29 5.6 09_04_0506 - 18188785-18190599 29 5.6 08_02_1256 + 25645085-25645396 29 5.6 08_01_1038 + 10540185-10540709 29 5.6 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 5.6 07_03_1432 - 26508135-26508881,26509301-26509708 29 5.6 07_03_0890 - 22332768-22333382 29 5.6 07_03_0387 - 17536026-17536636,17536772-17537150 29 5.6 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 29 5.6 06_01_0760 - 5676973-5677830 29 5.6 05_05_0354 - 24347550-24347870 29 5.6 05_04_0324 - 20273797-20274261 29 5.6 05_04_0303 - 20010761-20011756 29 5.6 04_04_1414 - 33394518-33394847 29 5.6 03_06_0599 + 34984869-34985319,34986581-34987563 29 5.6 01_06_0148 - 27007330-27008124 29 5.6 01_02_0007 + 10132380-10133201 29 5.6 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 29 7.4 12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 29 7.4 11_07_0007 - 27262229-27262638,27263252-27263312 29 7.4 11_06_0564 - 25022353-25022546,25022654-25022894,25022936-250230... 29 7.4 11_01_0066 - 536281-537196,537397-537452 29 7.4 10_08_0399 - 17614585-17614809,17614860-17615168 29 7.4 09_03_0145 - 12749288-12751510 29 7.4 09_02_0274 + 6611555-6611615,6612229-6612638 29 7.4 05_06_0078 - 25412770-25413852 29 7.4 03_06_0485 + 34242121-34243188 29 7.4 02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 29 7.4 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 29 7.4 01_06_0956 - 33343503-33344086,33344225-33344384 29 7.4 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 29 7.4 01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 29 7.4 12_02_0687 + 22123216-22123760,22125021-22125330 28 9.7 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 28 9.7 12_01_0442 + 3495333-3496484 28 9.7 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 28 9.7 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 28 9.7 11_01_0133 + 1121392-1122731,1123417-1123858 28 9.7 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 28 9.7 10_07_0161 - 13674631-13675433,13675793-13675862 28 9.7 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 28 9.7 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 28 9.7 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 28 9.7 09_04_0180 + 15367737-15367755,15368874-15369739 28 9.7 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 28 9.7 09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 28 9.7 08_02_1084 - 24232968-24234779 28 9.7 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 28 9.7 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 28 9.7 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 28 9.7 07_03_1160 - 24430240-24431268 28 9.7 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 28 9.7 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 28 9.7 06_01_0240 - 1822086-1822216,1822311-1822367,1822788-1822842,182... 28 9.7 06_01_0145 + 1092764-1093351 28 9.7 05_05_0356 - 24373879-24374469 28 9.7 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 28 9.7 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 28 9.7 05_01_0131 + 888247-888771,889092-889154 28 9.7 04_04_1126 + 31095651-31096115 28 9.7 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 28 9.7 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 28 9.7 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 28 9.7 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 28 9.7 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 28 9.7 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 28 9.7 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 9.7 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 28 9.7 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 28 9.7 >12_01_0435 + 3428552-3428636,3429242-3429352,3429434-3429738, 3429821-3430230,3430323-3430556,3430934-3431378, 3432300-3432390,3433292-3433518,3433786-3433861, 3434009-3434134,3434221-3434384 Length = 757 Score = 255 bits (625), Expect = 3e-68 Identities = 117/207 (56%), Positives = 150/207 (72%), Gaps = 1/207 (0%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F+HP HGS+GF P+KRS RHRGKVK+FPKDD SKP HLT+F+GYKAGMTH+VRE ++PGS Sbjct: 6 FEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREVEKPGS 65 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 K++KKE EAVTIIETPP+V VG+V Y++TP GLR+L +VWA+H+SE RRRFYKNW Sbjct: 66 KLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKS 125 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQM-KLLQQRXKXAHIMEIQ 631 + + G+K I+ M ++ S+VRVIA TQ+ K+ + K AH+MEIQ Sbjct: 126 KKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAHLMEIQ 185 Query: 632 LNGGTIQDXXKWARXHLEKPIPVHSVF 712 +NGGTI D + EK IPV +VF Sbjct: 186 INGGTIADKVDYGYKFFEKEIPVDAVF 212 >11_01_0427 + 3274817-3274901,3275587-3275697,3275979-3276283, 3276406-3276815,3276942-3277200 Length = 389 Score = 252 bits (618), Expect = 2e-67 Identities = 116/207 (56%), Positives = 149/207 (71%), Gaps = 1/207 (0%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F+HP HGS+GF P+KRS RHRGKVK+FPKDD +KP HLT+F+GYKAGMTH+VRE ++PGS Sbjct: 6 FEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVNKPCHLTSFVGYKAGMTHIVREVEKPGS 65 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 K++KKE EAVTIIETPP+V VG+V Y++TP GLR+L +VWA+H+SE RRRFYKNW Sbjct: 66 KLHKKETCEAVTIIETPPIVVVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKS 125 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQM-KLLQQRXKXAHIMEIQ 631 + + G+K I+ M ++ SVVRVI TQ+ K+ + K AH+MEIQ Sbjct: 126 KKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASVVRVIVHTQIRKMKGLKQKKAHLMEIQ 185 Query: 632 LNGGTIQDXXKWARXHLEKPIPVHSVF 712 +NGGTI D + EK IPV +VF Sbjct: 186 INGGTIADKVDYGYKFFEKEIPVDAVF 212 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PA PP P PP GP P PPPP Sbjct: 328 PPPPPKAAPPPPPPKGPPPPPPAKGPPPP--PPPKGPSPPPPPP 369 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P PA+ P PP PP P PPPP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPP 348 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP PP P PPPP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P PA P P PP P P PPP G Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAP-PPPPPKG 343 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + P P P PP P PPPP Sbjct: 316 PPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P P PP G PPPP Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P P P P+ PP P GP P PP G R Sbjct: 341 PKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASR 388 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 SP+ P P P P P P P PP GP P PP G P Sbjct: 310 SPAPPPPPPPK-PAAAAPPPPPPPKAAPPP--PPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 Query: 953 PFPXG 967 P P G Sbjct: 367 PPPPG 371 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPX---PXCPPXXG---PXPXPPPP 907 P P P P PA P PP P PP G P PPPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 6/51 (11%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXL------PAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P S PA PP P P P P PPPP Sbjct: 283 SPSPSLPLPPGRESPSRPQSIAAAAVASPAPPPPPPPKPAAAAP-PPPPPP 332 >03_01_0023 + 198414-198968 Length = 184 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG GS G G G G G G Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGG 82 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG G +G G G G G Sbjct: 42 GGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGG 85 Score = 35.5 bits (78), Expect = 0.064 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG G GG +G +G G G G G G Sbjct: 53 GGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGG 95 Score = 35.1 bits (77), Expect = 0.085 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGEXXVXIXCRGDT 739 GGG G G GG G GG G G G G G G G C DT Sbjct: 49 GGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGRCPIDT 104 >07_03_0560 + 19479597-19480667 Length = 356 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G KGG G G G E G G G G G G Sbjct: 95 GGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGG 138 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G KGG G GG G G G G G G G Sbjct: 212 GGGGFGGGGGKGGGFGAGGGMGGG-AGGGGGLGGGGGGGMGGGG 254 Score = 35.1 bits (77), Expect = 0.085 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG G G G G G G +G Sbjct: 136 GGGGVGGGGGQGGGFGAGGGVGGGSGTG-GGLGGGGGGGFGGDG 178 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G G Sbjct: 238 GGGGLGGGGG-GGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSG 280 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G +GG G GG G G G G G G Sbjct: 267 GGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLG 309 Score = 31.9 bits (69), Expect = 0.79 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGX 781 G GL G +E F GGG G GG G GG G G G G G Sbjct: 179 GGGLGGGGG--KEGGFGAGGGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGA 236 Query: 780 EG 775 G Sbjct: 237 GG 238 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GG G G G G G G G G G Sbjct: 245 GGGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGG 288 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGGG G G GGQ G G G G G G G G+ Sbjct: 134 GGGGGGVGGG-GGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGD 177 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRGRXXXVSVAV 747 G G GGG G G G GGG GG +G G V V V Sbjct: 278 GSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLGGGGFGVGVGVGV 337 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -3 Query: 915 FXPGGG---GXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 F GGG G G G GG G GG G G G G Sbjct: 216 FGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGG 254 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG G GG G G G G G G Sbjct: 271 GGGAGQG-GSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHGG 312 >03_01_0515 - 3864796-3865425 Length = 209 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 SP P P P P P+ PP P PP P PPPP S P Sbjct: 60 SPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Query: 953 P 955 P Sbjct: 120 P 120 Score = 29.1 bits (62), Expect = 5.6 Identities = 22/70 (31%), Positives = 24/70 (34%), Gaps = 4/70 (5%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGP-XPXPPPPGXXRLSLT 931 T +P+ P P AS P PP PP GP P PPPP S Sbjct: 25 TTAAPAPSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPP 84 Query: 932 XXXXPXNPFP 961 P P P Sbjct: 85 PPPLPPPPPP 94 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPX---CPPXXGPXPXPPPP 907 PS P P P P LP FPP P PP P P PPPP Sbjct: 287 PSPPPPPPPAFPFPFPQLPPLP-HFPPLPSFYPSPPPPPPPPPPPPP 332 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P P PP P PPPP Sbjct: 253 PSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPP 293 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P P L PP P P P P PPP L P +P P Sbjct: 237 PPFLPFPLPPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPP 291 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P P P+ P P P P P PPP Sbjct: 311 PPLPSFYPSPPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPP 353 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P +P PP P PP P P PP P Sbjct: 227 PPIPFLTPPPPPFLPFPLPPIPFLTPPSP--PPPAFPFPLPPWP 268 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFP--PXPXCPPXXGP--XPXPPPP 907 P+ P P P P P LP+ +P P P PP P P P PP Sbjct: 295 PAFPFPFPQLPPLPHFPP--LPSFYPSPPPPPPPPPPPPPSFPWPFPP 340 Score = 28.3 bits (60), Expect = 9.7 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 4/66 (6%) Frame = +2 Query: 776 PSXPXXXPXXX--PXPXXPASXLPAXF-PPXPXCPPXXG-PXPXPPPPGXXRLSLTXXXX 943 P+ P P P P P LP F PP P PP P P P P Sbjct: 258 PAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFY 317 Query: 944 PXNPFP 961 P P P Sbjct: 318 PSPPPP 323 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P S P PP P PP P P PPPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPP 128 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P PA PP PP P PPPPG Sbjct: 20 PQPPPMNPYGPPPPQQPAY---GHMPPPQGAPPPFLAPPPPPPPG 61 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + PP P PP P PPPP Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPP 125 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PP P PP PPPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS 925 P Q P P P P P P PP P PP P P PPP +L+ Sbjct: 85 PPQMYYQPPPPPPPYGVNSSQPPPPPP----PPPSPP-PSAPPPPPPPPTQPPPREAQLA 139 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/64 (35%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXP-ASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPX 949 SP P P P P AS P PP P P P P PPPP L P Sbjct: 562 SPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPP 621 Query: 950 NPFP 961 P P Sbjct: 622 PPPP 625 Score = 36.3 bits (80), Expect = 0.037 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPF 958 S P P P P P PP P P P P PPPP S+ P P Sbjct: 583 SQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPP 642 Query: 959 P 961 P Sbjct: 643 P 643 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/59 (33%), Positives = 21/59 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P P P +P PP P P P PPPP SL P P P Sbjct: 600 PSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPP--SLPNRLVPPPPAP 656 Score = 33.5 bits (73), Expect = 0.26 Identities = 25/72 (34%), Positives = 25/72 (34%), Gaps = 9/72 (12%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASX-LPAXFPPXPXCPPXXGPXP--------XPPPPGXXRLS 925 SPS P P P P S PA PP P PP P P PPPP L Sbjct: 536 SPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLP 595 Query: 926 LTXXXXPXNPFP 961 P P P Sbjct: 596 NCLVPSPPPPPP 607 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P LP P P P P PPPP Sbjct: 625 PPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPP 668 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P PA PP P P G P PPP Sbjct: 748 PAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P P PP P P P PPPP Sbjct: 727 PSAPAP-PLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPP 769 Score = 29.1 bits (62), Expect = 5.6 Identities = 21/74 (28%), Positives = 26/74 (35%), Gaps = 1/74 (1%) Frame = +2 Query: 689 PIPVHSVFAQMX*LTALVS-PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPX 865 P+P HSV S P + + +P P P P P S + P Sbjct: 626 PLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRS---SSRTPTGA 682 Query: 866 CPPXXGPXPXPPPP 907 GP P PPPP Sbjct: 683 ATSSKGPPPPPPPP 696 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPX--PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P++ P PP P P PPPP Sbjct: 709 PSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPP 754 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P+ P P P S LP PP P PP P PPP + P P Sbjct: 613 PNRSVPPPPPPPPPLPNHSVLP---PPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPP 669 Query: 956 FP 961 P Sbjct: 670 PP 671 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GP + G GG G G G G G G EG Sbjct: 173 PGGGGGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGG--GGGEG 215 Score = 35.1 bits (77), Expect = 0.085 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 924 EXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 E GGGG G KGG G GG + E G G G G G Sbjct: 260 ECEIGGGGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGGGGGG 306 >06_03_1326 - 29355467-29355817 Length = 116 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGGG G G +GG GG +G G G G G G G+ Sbjct: 39 GGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGYHGGGGGD 83 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGG G G GG+ G GG G G G G G G G+ Sbjct: 10 GGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGK 54 Score = 35.9 bits (79), Expect = 0.049 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G KGG G G G G G G G G G Sbjct: 36 GGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGYHG 78 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G +G G G G G G Sbjct: 25 GGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGG 69 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRGR 771 GK G GG GK G G GGG +GG G G+ Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGK 54 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 G GR GGG K G +G G GGG G G G Sbjct: 28 GSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGYHG 78 >06_03_0790 - 24636805-24637770 Length = 321 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/45 (40%), Positives = 21/45 (46%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGGG G G +GG G GG G G G G G G +G+ Sbjct: 111 GGGGGGGGGGRGG-GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGD 154 Score = 35.1 bits (77), Expect = 0.085 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G GG G G G G G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG G G E G G G G Sbjct: 135 GGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKGRG 175 >12_02_1174 - 26696869-26698191 Length = 440 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P S P P P PP P PPPP Sbjct: 154 PPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPP 194 Score = 33.1 bits (72), Expect = 0.34 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFP-PXPXCPPXXGPXPXPPPP 907 ++ SP SP P P P P P P P PP P P PPPP Sbjct: 106 SSATSPEFKTPPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPP 165 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P S P P P PP P PPPP Sbjct: 193 PPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPP 225 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P+ P P P +P P P PP P P PPPP Sbjct: 236 TPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPP---PSPLPPPP 277 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +V P+ P P P P P P PP PP P P PP Sbjct: 174 VVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPP 230 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 6/42 (14%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXC------PPXXGPXPXPPP 904 P P P P S P PP P PP P P PPP Sbjct: 173 PVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPP 214 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC--PPXXGPXPXPPP 904 P P P P P P P PP P PP P P PPP Sbjct: 143 PVKPQPPPSLPPPPPPP----PPPPPPRPPSVKPPVVQPKPQPPP 183 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/56 (28%), Positives = 17/56 (30%) Frame = +2 Query: 740 VSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 V P+ P P P P P P PP PP P P PP Sbjct: 144 VKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPP 199 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P S P+ PP P P GP P P PP Sbjct: 1158 PPLPPSPPPATPPPPPPLS--PSLPPPPPPPPLPSGPPPQPAPP 1199 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXX-GPXPXPPPP 907 P P P P P P LP+ PP P PP P P PPPP Sbjct: 1170 PPPPPLSPSLPPPPPPPP--LPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPX-PXCPPXXGPXPXPPPP 907 P P P P P P LP+ PP P PP P PPPP Sbjct: 1130 PPLPLDAPPPPPLPEGPPP-LPSDSPPCQPPLPPSPPPATPPPPP 1173 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPX--PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P S PA PP P P P PPPP Sbjct: 1143 PEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSL--PPPPPPP 1186 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPX-CPPXXGPXPXPPPP 907 P P P LP PP P PP P P PPP Sbjct: 1129 PPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPP 1166 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXG---PXPXPPPP 907 PS P P P P P+ P PP P PP P P PPP Sbjct: 1162 PSPPPATPPPPP-PLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPP 1207 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P PA PP P PP P P P P Sbjct: 1176 SPSLPPPPPPP-PLPSGPPPQ-PAP-PPLPIQPPPIPPPPVPSSP 1217 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP PP G P PPPP Sbjct: 267 PPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPP 310 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P A PP P P P PPP G Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVG 301 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG+ G GG G G G G G G Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 >07_03_0559 + 19475893-19476783 Length = 296 Score = 35.9 bits (79), Expect = 0.049 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G KGG G GG G+ G G G G G G Sbjct: 173 GGGGIGGGGGKGGGFGAGGGVGGA-AGGGGGMGSGGGGGFGGGG 215 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG GS G G G G G G Sbjct: 91 GGGGLGGGGCEGGGFG-GGVGGGSGAGGGLGGGGGGGFGGGSGG 133 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G AG G G G G G Sbjct: 121 GGGGGGFGGGSGGGVGGGGGQGGGFGAG-GGVGGGSGTGGGLGG 163 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G KGG G GG G G G G G Sbjct: 207 GGGGFGGGGGKGGGFGAGGVMGGG-AGGGGGLGGGGG 242 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXG-XGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G +GG G GG GS G G G G G G Sbjct: 132 GGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGG 175 Score = 29.9 bits (64), Expect = 3.2 Identities = 23/63 (36%), Positives = 24/63 (38%), Gaps = 2/63 (3%) Frame = -3 Query: 966 PXGXGLX-GXXXXVREXRFXPGGGGXGXGPX-KGGQXGXGGXXAGSXEAGXXGXGXXXGX 793 P G G G R R GGGG G G +GG G GG G G G G G Sbjct: 42 PKGFGRGPGFGHDCRFGRCHGGGGGFGGGGGFRGG--GGGGLGGGGGFGGGGGGGLGGGG 99 Query: 792 XXG 784 G Sbjct: 100 CEG 102 >10_08_0214 - 15915156-15915713 Length = 185 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 + PGGGG G G +GG G GG GS G G Sbjct: 29 YGPGGGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGG 64 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQ-XGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G G G + GGGG G G GG G G AG G G G Sbjct: 58 GYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGGG 117 Query: 783 XEGE 772 G+ Sbjct: 118 GGGQ 121 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ-XGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G G G G G G G G Sbjct: 38 GGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGGGGGGGG 83 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 + GGGG G G GG G GS G G Sbjct: 150 YGSGGGGGGGGGQGGGSGSGSGSGYGSGSGGGNG 183 >01_01_0570 - 4231100-4232560 Length = 486 Score = 35.5 bits (78), Expect = 0.064 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG+ G GG GS G G G G G Sbjct: 200 GGGAGGGVGGGGELGGGGMGGGSGFGGGAGGGFGAGGGVG 239 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G G GG+ G GG G G G G G G G Sbjct: 174 GGAGAGGGVGGGGRFGGGGMGGGGGFGGGAGGGVGGGGELGGGG 217 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG G GG G G G G G G G Sbjct: 123 GGGVGAGFGSGGGVGAGGGLRGGGGVGAGGGGGFGGGAGGGGG 165 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXG---GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G +GG G G G G AG G G G G G Sbjct: 56 GGGVGVGGGEGGGVGVGGGVGGGTGGGAAGGLGGGGGGGGGLGGSG 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 911 GRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRGR 771 G GGG A G AG G GGG GG VG GR Sbjct: 141 GLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVGGGGR 187 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G GG G +G G G G G Sbjct: 88 GGGGGGGGGLGGSGGLGGGGMGG--SGGFGGGGGGGVGGG 125 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG G GG G G G G G G Sbjct: 273 GGGVGGGGG-GGMGGGGGFGGGGGVGGNTGRDFDGGKGNGLNG 314 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 1/63 (1%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXG 784 G G+ G GGGG G GG G G G G G G G G G Sbjct: 72 GGGVGGGTGGGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGGVGAGFG 131 Query: 783 XEG 775 G Sbjct: 132 SGG 134 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG GG G G G G G G Sbjct: 209 GGGELGGGGMGGGSGFGGGAGGGFGAGGGVGGGIGVGGGMG 249 >06_01_0486 - 3455030-3455770 Length = 246 Score = 35.1 bits (77), Expect = 0.085 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP--PPP 907 SP + P P P P P P P P P PP P P P PPP Sbjct: 95 SPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPP 151 Score = 33.1 bits (72), Expect = 0.34 Identities = 21/59 (35%), Positives = 23/59 (38%), Gaps = 4/59 (6%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPX--PXCPPXXGPXPXP--PPP 907 +PR PS P P P P P +P PP P PP P P P PPP Sbjct: 83 TPRPPPTPPYVPSPPPYVPPYIPPPTPP--YVPPYIPPPTPPYVPPPTPPSPPPYVPPP 139 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 P P P P P P S P PP P PP P P PP Sbjct: 114 PYIPPPTPPYVPPPTPP-SPPPYVPPPTPPSPPPYVPPPSPP 154 >06_01_0178 + 1386981-1387505 Length = 174 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G Sbjct: 44 GGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGG 87 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGG G G +GG+ G G G G G G G G G Sbjct: 18 PGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGG 62 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G KGG G GG G G G G G G Sbjct: 50 GGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGG 93 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G KGG G GG G G G G G G Sbjct: 72 GGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGG 115 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G KGG+ G GG G G G G Sbjct: 94 GGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGG 130 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G +GG G GG + G G G G G Sbjct: 97 GGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGGG 137 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 G G GGG A K GK AG GA GGG R G G G Sbjct: 40 GGGGGGGGGGGGGGAGGKGGKGG-AGGHGGAGGGGGGGGGKGRKGGAGGHG 89 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GG G GG G G G G G G Sbjct: 75 GGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGG 118 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G GG G GG G GG G G G G G G Sbjct: 53 GAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGG 96 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 35.1 bits (77), Expect = 0.085 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G G G G G G G Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGG-XXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G +G Sbjct: 151 GGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGGDG 195 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAX---FPPXPXCPPXXGP-XPXPPPPG 910 SPS P P P PA P+ +PP PP P P PP PG Sbjct: 41 SPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPAPTSPSPPAPG 90 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P + +P +PP PP P PP S T P NP P Sbjct: 31 PITYPSPPSLSPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTT----PPNPAP 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P+S P+ P P PP P P PP Sbjct: 35 PSPPSLSPSMPPTYPPPSSTPPSPAPVSP-SPPTTYPPPSTTPP 77 >07_03_0558 + 19461369-19462448 Length = 359 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G G G G G G G G G Sbjct: 103 GGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLG 146 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG G G G G G G Sbjct: 213 GGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHG 256 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXG---XGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G G Sbjct: 138 GGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLG 184 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G Sbjct: 83 GGGGLGGGA-SGGVGGGGGFGGGGGGGLGGGQGGGFGGGAGAGG 125 >07_03_0177 - 14770777-14772045 Length = 422 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G KGG G GG G G G G G G Sbjct: 348 GGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSGIG 387 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G KGG G GG G G G G G G G Sbjct: 235 GGGGLGGGIGKGGGLG-GGIGKGGGLGGGFGKGGGLGGGGGLGG 277 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G KGG G G G G G G G G G G Sbjct: 203 GGGGLGGGIGKGGGLGGGFGKGGGLGGGGGLGGGGGLGGGIGKGG 247 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGG G G KGG G GG G + G G G G G+ Sbjct: 256 GGGLGGGFGKGGGLGGGGGLGGGEDGGLGGGIGKGGGIGGGFGK 299 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGS-XEAGXXGXGXXXGXXXG 784 GGG G G KGG G GG G + G G G G G Sbjct: 110 GGGVGGGFGKGGGFGKGGGFGGGFGKGGGIGGGIGHGAGGG 150 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXE-AGXXGXGXXXGXXXGXEG 775 GGG G G KGG G GG G G G G G G G Sbjct: 214 GGGLGGGFGKGGGLGGGGGLGGGGGLGGGIGKGGGLGGGIGKGG 257 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXE-AGXXGXGXXXGXXXGXEG 775 GGG G G KGG G GG G G G G G G G Sbjct: 290 GGGIGGGFGKGGGLGGGGGLGGGGGLGGGSGLGGGIGKGGGLGG 333 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G KGG G G G G G G G G G G Sbjct: 172 GGGLGGGIGKGGGLGGGFGKSGGLGGGGGLGGGGGLGGGIGKGG 215 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G K GG G GG G G G G G G G Sbjct: 182 GGGLGGGFGKSGGLGGGGGLGGGGGLGGGIGKGGGLGGGFGKGG 225 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G KGG G GG G G G G G G G Sbjct: 338 GGGLGGGFGKGGGIG-GGFGKGGGLGGGGGLGGGGGGGGGGFG 379 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G KGG G G G G G G G G G Sbjct: 246 GGGLGGGIGKGGGLGGGFGKGGGLGGGGGLGGGEDGGLGGG 286 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G G G G KGG G GG G G G G G G G Sbjct: 54 GAGLGGGYGKGG--GFGGGGGGGGGGGFGGGGGFGGGGGGGLG 94 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 F GGG G G GG+ G GG G G G G G G G Sbjct: 263 FGKGGGLGGGGGLGGGEDGGLGGGIGKGGGIGGGFGKGGGLGGGGGLGG 311 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G G KGG G G G G G G G G G Sbjct: 317 GGSGLGGGIGKGGGLG-GSFGKGGGLGGGFGKGGGIGGGFGKGG 359 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G KGG G GG G G G G G G G Sbjct: 328 GGGLGGSFGKGGGLG-GGFGKGGGIGGGFGKGGGLGGGGGLGG 369 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG GG G G G G G G G Sbjct: 306 GGGLGGGGGLGGGSGLGGGIGKGGGLGGSFGKGGGLGGGFGKGG 349 >06_02_0271 + 13618149-13618297,13618311-13618560 Length = 132 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG+ G GG G + G G G G G +G Sbjct: 53 GGGEGGGGEGGGEGGDGGTEGGG-DGGREGSGDGGGEGGGEDG 94 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -3 Query: 906 GGGGXGXGPXK--GGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G + GG G GG G E G G G G G G Sbjct: 97 GGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGG 142 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG G G G G G G Sbjct: 114 GGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSG 157 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/52 (25%), Positives = 20/52 (38%) Frame = +1 Query: 772 LPLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRPKXXFP 927 + + P+ PP PPP + P + +P + PP RP P Sbjct: 70 IAVHPSPPPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPPPPLP 121 Score = 30.7 bits (66), Expect(2) = 0.12 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PA + + PP P P PPPP Sbjct: 77 PPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLP-PSPRPPPP 119 Score = 22.6 bits (46), Expect(2) = 0.12 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 884 PXPXPPPPG 910 P P PPPPG Sbjct: 154 PLPPPPPPG 162 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G +G G G G G G Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSG-GGCGGGGGGGGGSSG 83 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGGG G G GG G GG G G Sbjct: 57 GGGGGGGGGGSGGGCGGGGGGGGGSSGG 84 >06_03_1506 + 30641428-30642168 Length = 246 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG GS G G G G G G Sbjct: 101 GGGGGGYGGGGGGSYGSGG--MGSGYGGGYGSGYDYGGQGGGGG 142 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GGQ G GG G G G Sbjct: 125 GGGYGSGYDYGGQGGGGGHGGGGGGGSGYGNG 156 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GG G GG +G G G G G G Sbjct: 169 GGGVNGGGGSGGGGGGGGGASGYRYGAGYGKGYGYGGGPGGGG 211 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ-XGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G +G G G G G G G Sbjct: 145 GGGGGGSGYGNGGYGSGFGEGYGSGGGVNGGGGSGGGGGGGGGASG 190 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 + PG GG G GP GG G G G G G G G G Sbjct: 92 YGPGYGGGGSGPGYGGGYGSPGYGGGYGSPGYGGGSGYGGGYGGGYG 138 >04_03_0098 + 11183039-11183752 Length = 237 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGG G G +GG G GG AGS AG Sbjct: 208 GGGSGSGSGQGGSAGGGGGGAGSGGAG 234 >03_02_0457 + 8638318-8638336,8640394-8640497,8640613-8640778, 8641403-8641467 Length = 117 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGG 850 PGGGG G GP GG+ G GG Sbjct: 62 PGGGGPGGGPYGGGRGGGGG 81 >12_01_0841 - 7873458-7874225 Length = 255 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG-XXGXGXXXGXXXGXEG 775 + GGG G G KGG G GG G +G G G G G G Sbjct: 93 YGQGGGASGGGYGKGGGGGGGGGQGGGAGSGYGSGYGSGYGQGRGASG 140 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG-XXGXGXXXGXXXGXEGE 772 + GGG G G +GG G GG G +G G G G G G+ Sbjct: 58 YGQGGGASGGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGGASGGGYGK 106 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GG G G G +GG GG G G G G G G Sbjct: 50 GGSGYGEGYGQGGGASGGGYGQGGGGGGGGGQGGGSGSGYG 90 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 + GGG G G +GG G GG G +G G G G G Sbjct: 171 YGQGGGASGGGYGQGGGGGGGGGQGGGNGSG-YGSGYGSGYGQG 213 Score = 28.7 bits (61), Expect = 7.4 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQ---XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 + GGGG G G GG G G G G G G G G G Sbjct: 69 YGQGGGGGGGGGQGGGSGSGYGSGYGQGGGASGGGYGKGGGGGGGGGQGG 118 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G G G G +GG GG G G G G G G Sbjct: 86 GSGYGSGYGQGGGASGGGYGKGGGGGGGGGQGGGAGSGYG 125 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G G G G +GG GG G G G G G G Sbjct: 164 GSGYGSGYGQGGGASGGGYGQGGGGGGGGGQGGGNGSGYG 203 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPX 964 P P P P PAS P P PP P P PP P + P P P Sbjct: 200 PSTLPPPPPPPPLPASSEPVD-PSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPP 258 Query: 965 G 967 G Sbjct: 259 G 259 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAX-FPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P PA+ A P P PP GP P PG L P P P Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPPREIVPGQTLLPPPPPPRPLQPSP 285 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P S P PP P PP P P PP P Sbjct: 70 PPPPPRPPSFAPENALPPSSPP---PPSPPPPPPSSPPPVPPSP 110 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P F P PP P P PPPP Sbjct: 66 PGSLPPPPPRPPSFAPENALPPSSPPPPSPPPP 98 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 830 SXLPAXFPPXPXCPPXXGPXPXPPPP 907 S P PP P PP P P PPPP Sbjct: 346 SDAPKLMPPPPPPPPPPPPPPPPPPP 371 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P PP P P PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPP 376 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P PP P P PPPP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPP 378 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P P P P P P PP P PP P P PP Sbjct: 345 TSDAPKLMPPPPPPPPPPPPPPPPPPPRPPPPP--PPIKKGAPPPAPP 390 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 775 PLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXF 876 P P PPR PPP AP P A + F Sbjct: 364 PPPPPPPPRPPPPPPPIKKGAPPPAPPKATMARF 397 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P P P P PP GP P P PP Sbjct: 168 SPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPP 212 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPP 907 P P P P P P PP P PP GP P P PP Sbjct: 159 PGPKPKPKPSPPKPKPG-PKPKPPKPGPKPKPPKPGPKPKPKPP 201 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P PP GP P PP PG Sbjct: 157 PKPGPKPK-PKPSPPKPKPGPKPKPPKPGPKPKPPKPG 193 >01_01_0082 + 625198-625719 Length = 173 Score = 33.5 bits (73), Expect = 0.26 Identities = 27/82 (32%), Positives = 28/82 (34%), Gaps = 5/82 (6%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP-XPPPP-G 910 L SP T SP P P P P P PP PP P PPPP G Sbjct: 40 LPSPCGTTCTYASPPPPDVLPTPVYYPPPPPVYYPPPSPPPVAYPPPTTPSTNCPPPPYG 99 Query: 911 XXRLSLTXXXXP---XNPFPXG 967 + T P NP P G Sbjct: 100 GGGYNPTPSYNPTPGYNPTPSG 121 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLT 931 PP P PP P P PPPP LS T Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSPT 99 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P A+ P PP P PP P P PPPP Sbjct: 65 PHHHVSAAPPPPQTPPSP--PPPPPPPPPPPPP 95 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P PAS P PP P PP P P P P Sbjct: 90 PPPPPLLPTPPPPPASISPTPAPPLPP-PPAPAPPPTPTP 128 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/83 (26%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = +2 Query: 677 HLEKPIPVHSVFAQMX*LTALVSPRQXIXTXXSPSXPXXXPXXXPX------PXXPASXL 838 H P + Q+ + P T +P+ P P P P P L Sbjct: 37 HHRSSSPTQTTLQQLHSPDSPPPPPLPTPTVTTPTPPPPPPAPRPPRRHHRIPPPPPPLL 96 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P P P PPPP Sbjct: 97 PTPPPPPASISPTPAP-PLPPPP 118 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P PA P P PP P P PPP P P P Sbjct: 72 PPPPPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAP 122 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P PA P F PP P PPPPG Sbjct: 9 PRPAPTPPAPAPAPPQVFLRRSVLPPPPAPHHAPPPPG 46 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P +S PA P PP G P PPPP Sbjct: 22 PAPSPSSSSAPAPASPRSPVPPPPGVPPPPPPP 54 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +1 Query: 775 PLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRPKXXFP 927 P P PP PPP P P+ LP PPP P P Sbjct: 964 PPPPPPPPNVAPPPFTRQ-DIPPPPPSPPPLPITQPPSVPPPPNSPPPLQP 1013 >01_01_0929 - 7344911-7345978 Length = 355 Score = 33.1 bits (72), Expect = 0.34 Identities = 23/59 (38%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP----PXXG---PXPXPPPPGXXRLSL 928 SP+ P P P P P PP P CP P G P P PPPPG R L Sbjct: 14 SPAPPT--PPLPPSPPSKTRRPPP--PPPPFCPHLSVPCVGLPLPPPCPPPPGAIRFPL 68 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P A PP P P P P PPPP Sbjct: 152 PAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPP 195 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 PP P P P P PPPP P P P Sbjct: 146 PPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAP 182 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P PA PA PP P PP G P P G Sbjct: 175 PSPPVPAPA-PAGSPPPPPPPPAGGNFTAPSPAG 207 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/60 (30%), Positives = 22/60 (36%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 L AL++ + SP+ P P P PA PA P P P P PP Sbjct: 13 LAALLALHLALAAAQSPAAAPAQPTPTPVPTAPAKSPPAPATPAPTATPTPPVAPAKAPP 72 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P P PPP Sbjct: 79 PVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPP 119 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + P PP P PP P P PPP Sbjct: 72 PVAPAVAPVTPPPPTPKKAPPPPVTPP-PVTPPPVTPPPVSPPP 114 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P P P PP P PPP Sbjct: 93 PPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 Score = 29.1 bits (62), Expect = 5.6 Identities = 26/94 (27%), Positives = 30/94 (31%), Gaps = 3/94 (3%) Frame = +2 Query: 689 PIPVHSVFAQMX*LTALVSPRQXIXTXXSPSXPXXXPXXXPX--PXXPASXLPAXFPPXP 862 P PV + A+ A +P T P P P P P P P PP P Sbjct: 38 PTPVPTAPAKSPPAPATPAPTA---TPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPPP 94 Query: 863 XCPPXXGP-XPXPPPPGXXRLSLTXXXXPXNPFP 961 PP P PPP + P P P Sbjct: 95 VTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P PA+ P PP P PP P PPPP + + P P P Sbjct: 45 PQSHPQPDAPAAAAPP--PPAPLTPP---PPKSPPPPPHIQTTDLPPPKPLPPAP 94 >08_01_0059 - 394001-394708 Length = 235 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P P P P P PP PPPP Sbjct: 14 PATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PR+ P P P P P S P PP PP P P PPP Sbjct: 21 PRRAPPPPSPPIRPPPPPTPRPYAPPPPSH-PLAPPPPHISPPAPVPPPPSPPP 73 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPX-CPPXXGPXPXPPPPGXXR 919 P P A PA PP P PP P PPPP R Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPR 41 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P P PPP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPP 47 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXG-PXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G P GG G GG G G G G EG Sbjct: 60 GGGGGGGGPPYYGGGGGGGGGGGGQGRGYYDDGGDGRGYQRGMEG 104 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/57 (38%), Positives = 22/57 (38%) Frame = -3 Query: 954 GLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G G R R PGGGG G G GG G GG G G G G G G Sbjct: 34 GAGGGGVGGRGGRGPPGGGG-GRGYEPGGGRGYGGGGGGGGR-GYGGGGGGGGYESG 88 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG G GG G G G G Sbjct: 77 GGGGGGGGYESGGGRGYGGGGRGYESGGGRGPG 109 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G +GG G GG G G G G Sbjct: 6 GGGGRGRGRGRGGGRGGGGGDGRGGGYGGAGGGGVGG 42 >04_04_0675 + 27183826-27184443 Length = 205 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRL 922 P AS + PP P PP P P PPP RL Sbjct: 97 PSPSASPSQSPSPPPPASPPPLPPAPSSPPPKKRRL 132 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G GG G GG AG+ G G G Sbjct: 288 GGGGGNTGGGIGGSTGGGGRGAGAGVGGITGGG 320 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG GG GS G G G G G Sbjct: 280 GGGGKGGG--GGGGGNTGGGIGGSTGGGGRGAGAGVGGITG 318 >01_05_0490 + 22672241-22674679 Length = 812 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPA-SXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P + + +P P PP P P PPPP Sbjct: 662 PAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPPPP 706 Score = 25.8 bits (54), Expect(2) = 0.59 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 884 PXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P PPPP R S P P P Sbjct: 639 PQPPPPPPPTTRRSRKPPQPPSRPAP 664 Score = 25.0 bits (52), Expect(2) = 0.59 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 854 PXPXCPPXXGPXPXPPPP 907 P P PP P P PPPP Sbjct: 599 PAP-APPRRPPPPPPPPP 615 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P A+ A PP P PP G P PPPPG Sbjct: 597 PRPPPAPSATANTASA-LPPPPPRPP--GAPPPPPPPG 631 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P A+ A PP P PP G P PPPPG Sbjct: 902 PRPPPAPSATANTASALSPPPPR-PP--GAPPPPPPPG 936 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P + P PP P P GP P PPPPG Sbjct: 921 PPPRPPGAPPP---PPPPGKP--GGPPPPPPPPG 949 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P PP P P G P PPPP Sbjct: 920 PPPPRPPGAPPPPPPPGKPGGPPPPPPP 947 >07_03_1751 - 29215074-29216270 Length = 398 Score = 32.3 bits (70), Expect = 0.60 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGG---GXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXX 790 G G G F GGG G G G KGG G GG G AG G G G Sbjct: 330 GGGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKGG--GFGGGVGGGHGAGGGGAGGGGGFG 387 Query: 789 XGXEG 775 G G Sbjct: 388 GGAGG 392 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G G G G KGG G GG G AG G G G G Sbjct: 288 GAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFG 330 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G G GG G GG G G G G G G G Sbjct: 175 GGAGGGLGGGSGGGGGLGGGAGGGAGVG-GGAGGGAGGGGGLGG 217 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG G GG G+ G G G G Sbjct: 225 GGGGLGGGAG-GGHGGGGGLGGGAGGGAGVGGGAGGGAGAG 264 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG G G G G + G G G G G Sbjct: 307 GGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGGG 348 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 G G G G KGG G G G G G G G G G G Sbjct: 312 GAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGGGGGAGAGG 355 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G GG G GG G GG G+ G G G G Sbjct: 172 GAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGGG 212 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPP 907 P P P P P LP PP P C GP P PPPP Sbjct: 4 PPKPGDQPSPGRSPN-PNLNLPCPLPPIPSCGGGGGGAGPTPPPPPP 49 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 32.3 bits (70), Expect = 0.60 Identities = 22/72 (30%), Positives = 25/72 (34%), Gaps = 2/72 (2%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAX-FPPXPXCPPXXGPXPX-PPPPGXXR 919 P + + +P P P P S PA P P P GP P PPPP Sbjct: 562 PIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMPG 621 Query: 920 LSLTXXXXPXNP 955 S T P P Sbjct: 622 SSKTRPPPPLKP 633 >07_01_0080 + 587674-588510 Length = 278 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS 925 P P P+S P PP P PP P P PPPP R S Sbjct: 94 PPPPPPSSGSP---PPPP--PPPPPPPPPPPPPLFTRRS 127 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P PP G P PPPP Sbjct: 92 PPPPPPPPSSGSPPPPPPP 110 >06_03_0429 - 20701107-20701534,20701628-20701847 Length = 215 Score = 32.3 bits (70), Expect = 0.60 Identities = 19/52 (36%), Positives = 22/52 (42%) Frame = +2 Query: 749 RQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 R I +PS P P P PA+ + A PP P PP P P P P Sbjct: 130 RLMINVDSAPS-PAPAPAASPIAKPPAA-VTAATPPPPPPPPSPSPSPSPAP 179 >04_04_0679 + 27214577-27215023 Length = 148 Score = 32.3 bits (70), Expect = 0.60 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPX-KGGQXGXGGXXAGSXEAGXXGXG 808 F GGGG G G +GG G GG G AG G G Sbjct: 70 FGGGGGGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHG 106 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGEXXVXI 757 GGGG G G +GGQ G + G G G G G V + Sbjct: 23 GGGGGGGGGGRGGQGRGDLGVVGERQGGGRGAGERGGRHDAPRGRGGVAV 72 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGGG G +GG+ G GG G G G G G GE Sbjct: 5 GGGGGG---RRGGRGGGGGREGGGGGGGGGGRGGQGRGDLGVVGE 46 >12_02_0310 - 17358220-17358834 Length = 204 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGDGGGEDGRDGGREGSGDGGGEGGG 104 >12_01_0776 + 7076218-7076832 Length = 204 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGEGGGEDGRDGGREGSGDGGGEGRG 104 >10_08_0222 - 15983756-15984313 Length = 185 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG G G G +G +AG G G G Sbjct: 33 GGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSGGAYASGGGGG 74 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G GG G +GS +AG G Sbjct: 113 GGGGGSGGGQNGGSGSGSGSGSGSGQAGGYG 143 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 31.9 bits (69), Expect = 0.79 Identities = 19/60 (31%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 734 ALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXP--XCPPXXGPXPXPPPP 907 A+V+P + +P P P P PA +P PP P PP P P PP Sbjct: 57 AVVAPSPPLPPL-TPPPAIVPPALPPPPPLPAIVVPPALPPTPAIAVPPALPPIPAIVPP 115 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/74 (29%), Positives = 28/74 (37%), Gaps = 2/74 (2%) Frame = +2 Query: 692 IPVHSVFAQMX*LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC- 868 + V + AQ + V P + T P+ P P P P + A PP P Sbjct: 14 VVVQAAMAQRPGMPPAVVPPS-LPTTTPPAPTVVAP---PLPTTPPPAVVAPSPPLPPLT 69 Query: 869 -PPXXGPXPXPPPP 907 PP P PPPP Sbjct: 70 PPPAIVPPALPPPP 83 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/50 (32%), Positives = 18/50 (36%) Frame = +2 Query: 758 IXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 + T P+ P P PA PA PP P P P PP P Sbjct: 50 LPTTPPPAVVAPSPPLPPLTPPPAIVPPA-LPPPPPLPAIVVPPALPPTP 98 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P PPPP Sbjct: 216 PKGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P P P P PPPP Sbjct: 136 PGQEPPPPHVPKAAPPPPPPPPP 158 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P +P PP P PP P P PPP Sbjct: 136 PGQEPPPPHVPKAAPPPPPPPPPHAP-PGPPP 166 >07_03_0782 - 21497949-21498563 Length = 204 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGEGGGEDGRDGGREGSGDGGGEGRG 104 >06_01_0690 + 5033943-5034740 Length = 265 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 + GGGG G G GG G G G +GS G G G G G Sbjct: 66 YASGGGGGGGGGGGGGNGGSGYGSGSGSGYGQAGGYGPYGGYAQGGGG 113 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 G G G + GGGG G G GGQ G G +GS G G G Sbjct: 134 GYGQAGGYGPYGGGAYAQGGGGGGGG--GGGQNGGSGYGSGSGYGQAGGYGPYGG 186 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G +G +AG G Sbjct: 112 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYG 142 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G +G +AG G Sbjct: 193 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYG 223 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 PP PP P P PPPP RL P + P Sbjct: 4 PPAATAPPPPPPPPPPPPPPIDRLVWLACAAPLSRIP 40 >04_04_1125 + 31085106-31085714 Length = 202 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P P PP P PP P P P P Sbjct: 35 PTTKPPPPPCQPPPPTPTPATPTT-PPTPWTPPPATPTPPTPTP 77 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 4/51 (7%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPA--SXLPAXFPPXPXCP--PXXGPXPXPPP 904 T +P P P P P P + PA PP P P P P P P P Sbjct: 55 TPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPAPAP 105 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P+ P P P P P P P P P P P P T P P Sbjct: 49 PTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPAPAPSTP 108 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 4/52 (7%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASX----LPAXFPPXPXCPPXXGPXPXPPPP 907 T P P P P P P + P P P P P P PPP Sbjct: 36 TTKPPPPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPP 87 >04_04_0066 - 22495396-22495424,22495716-22495758,22495871-22496130, 22496162-22496531 Length = 233 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGDGGGEDGRDGGREGSGDGGGEGGG 104 >03_02_0765 + 11000724-11002496 Length = 590 Score = 31.9 bits (69), Expect = 0.79 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G AG+ G G G G G Sbjct: 255 GGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGGTGGGGGLG 295 Score = 31.9 bits (69), Expect = 0.79 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G G GG G G G EAG G G G G G Sbjct: 449 GGGGGLGGGAGGGGGLDGGAGGGAEAG-GGFGGGAGAGTGGGG 490 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P+ A PP P PP P P PPP + +L P P Sbjct: 273 PSFTRSAHSPPTPHPPPSSPPPPMSPPPPAVKENLKHKPEPLKP 316 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 31.9 bits (69), Expect = 0.79 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 PS P P P PA P P PP P P PP PG Sbjct: 86 PSPPLPHDNRTPQPRAAPPPAPAPDQPAPPSPPPSLP-PSPPAPG 129 >01_02_0131 - 11441713-11441728,11441911-11441953,11442324-11442762 Length = 165 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGDGGGEDGGDGGREGSGDGGGEGGG 104 >01_01_0036 + 278982-279494 Length = 170 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G G GS + G G G Sbjct: 73 GGGGGGGGEGGGEDGRDGGREGSGDGGGEGRG 104 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P P P+S +P P P P P PPPP Sbjct: 206 TPSPPSILPPLTPQP-PPSSLIPPVLP-----LPLLNPPPPPPPP 244 >08_02_0620 + 19387935-19388279 Length = 114 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXE 778 GGGG G GG+ G GG G E G G G G E Sbjct: 34 GGGGEGGSEGDGGEGGGGG---GDVERGDGGGGRWRAGGRGCE 73 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P PP P P PPPP Sbjct: 425 PPPPPLPPPPPPPPPPPPP 443 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P PP P PP P P PPPP Sbjct: 426 PPPPLPPPPPPPP-PPPPPLPPNM-PPPLPPPP 456 >06_03_1146 - 28004896-28005554,28005664-28005844 Length = 279 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASX-LPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXP 946 SPS P P P+S PA P P P P PPPPG + T P Sbjct: 188 SPSVSPMAPAPAPTTSTPSSPPAPAAMAPSPSTTPGGVAQP-PPPPGTDGANATTPAAP 245 >06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 Length = 327 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G GG +G E G G G Sbjct: 280 GGGGLGGGGSSGGEGGGGG--SGDEEGCGDGSGGELG 314 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 1/51 (1%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXC-PPXXGPXPXPPPPGXXRLSLTXXXXP 946 P P P S PA PP P PP P PPPP R S + P Sbjct: 47 PNATPADTTPTSPPPAS-PPLPSATPPLAASPPPPPPPPPPRNSPSPPKPP 96 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 773 SPSXPXXXPXXX-PXPXXPASX-LPAXFPPXPXCPPXXGPXPXPPP 904 S S P P P PAS LP+ PP PP P P PPP Sbjct: 43 SSSNPNATPADTTPTSPPPASPPLPSATPPLAASPPP--PPPPPPP 86 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +2 Query: 809 PXPXXP-ASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +S P P P PP P P PPPP Sbjct: 21 PKPFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPP 54 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPP-PGXXRLSLTXXXXPXNP 955 P P S +P+ PP PP P P PPP P +L L+ P P Sbjct: 39 PPPPPSPVPSPAPP----PPPHRPSPSPPPNPLSSKLWLSSKLSPPPP 82 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P PP P P PPPP Sbjct: 337 SPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P S P P PP P P PPPP +L+ P P P Sbjct: 330 PDTKQVTSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/73 (27%), Positives = 22/73 (30%), Gaps = 2/73 (2%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP--PXXGPXPXPPPPGXX 916 SPR + P P P P P + P PP P P P P P P Sbjct: 339 SPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPPAV 398 Query: 917 RLSLTXXXXPXNP 955 S P P Sbjct: 399 PTSRRRLLKPLPP 411 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P PP P PPPPG Sbjct: 122 PPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPPG 155 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G +GG G GG G G G G Sbjct: 151 GGGGGGGGYQGGGGGYGGNNGGYGNRGGGGGG 182 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G Sbjct: 140 GGGGYGGGGYSGGGGGGGGYQGGG--GGYGGNNGGYGNRGGGGG 181 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GG G GG G G G G G G G Sbjct: 129 GGGGYGG----GGYSGGGGYGGGGYSGGGGGGGGYQGGGGGYGG 168 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 779 SXPXXXPXXXPXPXX--PASXLPAXFPPXP-XCPPXXGPXPXPPPP 907 S P P P P P P PP P PP P PPPP Sbjct: 1167 SPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1212 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +2 Query: 779 SXPXXXPXXXPXPXX--PASXLPAXFPPXP-XCPPXXGPXPXPPPP 907 S P P P P P P PP P PP P PPPP Sbjct: 1199 SPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1244 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 785 PXXXPXXXPXPXX--PASXLPAXFPPXPX-CPPXXGPXPXPPPP 907 P P P P P P PP P PP P PPPP Sbjct: 1137 PPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPP 1180 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXF--PPXPXCPPXXGPXP 892 T PS P P P P P PA P P P GP P Sbjct: 418 TPGKPSEPPEKPPLIPVPVGPPEKSPAYEEPPAAPSTPTSHGPPP 462 Score = 28.7 bits (61), Expect = 7.4 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 SP P P P + + PP P P P PPPP L P Sbjct: 1144 SPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPP-PVKSPPPPAPVILPPPPVKSPPP 1202 Query: 953 PFP 961 P P Sbjct: 1203 PAP 1205 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 3/48 (6%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPP 907 SP P P P P P S PP P P PPPP Sbjct: 467 SPEEPPEEPTPSPTPSSPESPAKMAPPPAPAIKGVTSPPAEYGAPPPP 514 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/63 (28%), Positives = 20/63 (31%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 SP P P P + + PP P P P PPPP L P Sbjct: 1176 SPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP-PVKSPPPPAPVILPPPPVKSPPP 1234 Query: 953 PFP 961 P P Sbjct: 1235 PAP 1237 >11_04_0246 - 15311912-15312481 Length = 189 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G GS + G G G Sbjct: 73 GGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >05_07_0217 - 28469229-28469798 Length = 189 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G GS + G G G Sbjct: 73 GGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >04_04_0708 - 27441373-27442611 Length = 412 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+S L A P PP P P PPPP Sbjct: 222 PSSVLDADLTLSPCSPPLLPPPPPPPPP 249 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G GG G G G Sbjct: 21 GGGGGGGGGGVGGDRGGGGSGGGGPGMGRRG 51 >02_05_0269 + 27307837-27308424 Length = 195 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G GS + G G G Sbjct: 73 GGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >02_05_0149 + 26290236-26290880 Length = 214 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGG G G G GG G GG G G G G G G G Sbjct: 84 PGGKGSGFGFGYGGSRGEGGGGGG---GGGGGSGRAYGFGGGYGG 125 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G GG G G G G G G G Sbjct: 81 GGGGYGGG-GRGG--GGGGGYGGGGGGGRGGGGGGGGRGGGGRG 121 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -3 Query: 909 PGGGGXG-XGPXKGGQXGXGGXXAGSXEAG 823 PGGGG G P GG G GG G G Sbjct: 388 PGGGGPGAPPPYHGGGGGGGGGGGGGGYTG 417 >07_03_1065 + 23711677-23711837,23711859-23712180,23713071-23713277 Length = 229 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 G GG G GG+ G GG + AG G G G Sbjct: 80 GSGGNGGNGGSGGKAGSGGSGGRAGSAGSGGNGGRPG 116 >07_03_0527 - 19085828-19086319 Length = 163 Score = 30.7 bits (66), Expect = 1.8 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXE--AGXXGXGXXXGXXXGXEGEXXVXIXCRG 745 GGGG G G +GG G GG S E G G G G GE + G Sbjct: 35 GGGGLGEGGVRGGGGGLGGGRRRSVETPVGQVGAG-RAAVSGGVVGEEAAEVRMEG 89 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P PA+ P P P P PPPP P P P G Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPG 375 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P P P PP GP P PPPPG Sbjct: 332 APPPPAPSPSAAGAGSGPPPPPPPAAPAAPR-PPGPGPGP-PPPPG 375 >03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 Length = 442 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 911 GRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRGR 771 G GGG AP G +G G GGG GG G RGR Sbjct: 6 GGGGGGEMLAPLMEGPDPESGDGEGGGGGGGGGGGGGGGGR-GARGR 51 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P PP P P PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -3 Query: 906 GGGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G + GG G GG G G G G Sbjct: 114 GGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGG 147 >10_08_0213 - 15912048-15912716 Length = 222 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G GG GS G G G Sbjct: 36 GGGGGGGGGSGGGGGYGGSGYGSGSGYGEGGGAGAG 71 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ---XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G AG G G G G G Sbjct: 41 GGGGSGGGGGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGGGGEGG 87 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 + GGG G G GG G GG G G G G G G Sbjct: 176 YGQGGGAYGGGYASGGGGGGGGGQGGGSGYG-SGSGYGYGSGGG 218 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +2 Query: 734 ALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 AL SP + P+ P P P P P S LP+ P PP P PP Sbjct: 493 ALRSPAPHLRVRHMPAPPVPTP---PAPAPPVSTLPSP-APSVHTPPVTAPPATAPP 545 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXP----XCPPXXGPXPXPPP 904 P P PA P PP P PP GP PP Sbjct: 350 PAPTPPAPATPVPMPPTPTRLVPTPPAPGPPADVPP 385 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 10/56 (17%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAX----FPPXPXCP-PXXGPXPXP-----PPPG 910 +P P P P P P S P PP P P P P P P PPPG Sbjct: 14 APPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPG 69 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P PA PP P P GP P P Sbjct: 37 PPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAP 76 >07_03_1533 + 27523811-27524710 Length = 299 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXE 829 GGGG G G GG G GG G + Sbjct: 99 GGGGGGGGDDSGGDDGGGGGGGGDGD 124 >07_01_0516 - 3850252-3852870 Length = 872 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 P P + LP PP P PP GP P PP Sbjct: 17 PQPPPTSRPLP---PPPPPPPPAHGPSPPPP 44 >06_01_0747 - 5587261-5587356,5587472-5587855,5588133-5588192, 5588428-5588484,5588663-5588800,5588901-5588966, 5589234-5589452,5589522-5589737,5589813-5589884, 5589952-5590205,5590356-5590525,5590840-5591029, 5592211-5592331,5592838-5592921,5593003-5593365, 5594530-5594724,5594938-5595933,5596329-5596370 Length = 1240 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 809 PXPXXPASXLPAXFP-PXPXCPPXXGPXPXPPPP 907 P PA P FP P P P P PPPP Sbjct: 6 PPASHPAKSPPGGFPTPTAVAPRRRAPPPPPPPP 39 >05_05_0101 - 22398814-22399164 Length = 116 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEA 826 GGGG G G +GG G GG S EA Sbjct: 28 GGGGLGEGGVRGGGAGLGGGRHRSVEA 54 >04_04_0267 + 24048649-24049140,24049521-24049835 Length = 268 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLT 931 PP P C P G P P G RL LT Sbjct: 15 PPPPRCSPAAGASPPPSAGGIRRLVLT 41 >04_03_1022 - 21778315-21779007 Length = 230 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 836 LPAXFPPXPXCP-PXXGPXPXPPPP 907 +P +PP P P P P P PPPP Sbjct: 112 VPPYYPPPPVTPTPYYYPSPAPPPP 136 >04_01_0583 + 7563290-7563904 Length = 204 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G GS + G G G Sbjct: 75 GGGGGGEG---GGEDGRDGGREGSGDGGGEGGG 104 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 5/58 (8%) Frame = +2 Query: 749 RQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC-----PPXXGPXPXPPPP 907 RQ + S P P P P PP P PP P P PPPP Sbjct: 403 RQKLQNDVYVSRPQSPPPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPPP 460 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 872 PXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P PPPP RL LT P P Sbjct: 2 PPPPPPPPPPPPSPPRLPLTAHRLPLPP 29 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG GG G G G G Sbjct: 20 GGGGGGGGRGNGGGGFGGGGGGGGGNHGYYGRG 52 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 + GGGG G G GG+ GG G G G Sbjct: 12 YTSGGGGGGGGGGGGGRGNGGGGFGGGGGGGGGNHG 47 >10_08_0221 - 15980370-15980927 Length = 185 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -3 Query: 945 GXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGS 835 G R R+ GGG G G GG G G +GS Sbjct: 16 GLANATRVARYASAGGGGGGGGGGGGSNGGSGWGSGS 52 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G +G +AG G Sbjct: 70 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYG 100 >10_08_0217 - 15962192-15962884 Length = 230 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/61 (31%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = -3 Query: 945 GXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGS----XEAGXXGXGXXXGXXXGXE 778 G R R+ GGG G G GG G +GS +AG G G G Sbjct: 18 GLTNATRVARYVSAGGGGGGGGGGGGSGNGSGWGSGSGSGYGQAGGSGGAYASGGGGGGG 77 Query: 777 G 775 G Sbjct: 78 G 78 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G +G +AG G G +G Sbjct: 73 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGSHGGAYAQGGGQG 116 >10_07_0087 - 12762745-12763236 Length = 163 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPPGXXRLS 925 A PP P PP P P PP G RLS Sbjct: 87 AAIPPKPMAPPKSSPAP-PPAVGHHRLS 113 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/59 (32%), Positives = 20/59 (33%), Gaps = 3/59 (5%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLP--AXFPPX-PXCPPXXGPXPXPPPPG 910 SP P P P P A P A +PP PP P P P PPG Sbjct: 686 SPEPPSYVPSPPQYAPQPPSYVPSPPEYAPEPPVYAPYPPGITPSPPEYAPEPPPGPPG 744 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 PAS P PP P P PPPP + + P P Sbjct: 38 PASPERGPLPLPAAAPPPPPPPPPPPPPPQVQAATVATPVPATP 81 >07_01_0662 + 4972953-4973645,4973758-4974046,4974790-4974803, 4974848-4974856 Length = 334 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +2 Query: 758 IXTXXSPSXPXXX-PXXXPXPXXPASXLPAXFPPX-PXCPPXXGPXPXPPPPG 910 I + P+ P P P P + PA P P PP P PPPPG Sbjct: 157 IASDDDPAAPHYKTPSRGPSPVPTPALAPASPPRHRPASPPSYLARPPPPPPG 209 >07_01_0479 + 3606663-3607448 Length = 261 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P +P FP P PP GP PPP Sbjct: 176 PPMRPPQMPIPFQRPPGVPPAFPGGP--PPPPGPFMRGPPP 214 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P +P F P PP P PPPPG Sbjct: 164 PQVVRPPPGQMPPPMRPPQ-MPIPFQRPPGVPPAFPGGP-PPPPG 206 >05_07_0100 + 27679280-27680320 Length = 346 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P +P P PP P P PPPP Sbjct: 143 PSPSPVPPPPYFAMPIH-PSAVRKPPSPSPSPSPPPP 178 >05_03_0662 + 16732965-16733037,16733310-16733413,16734468-16734861, 16736291-16736901,16739238-16739289,16739771-16739826, 16739962-16740190,16740980-16741212,16741480-16741740 Length = 670 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G GG G GG AG G G G Sbjct: 153 GGGGGGSAGASGGSGG-GGGGAGGATGGGAGSG 184 >05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094, 4501219-4501296,4501333-4501557,4502842-4502910, 4502946-4503200 Length = 351 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 F GGGG G G +GG G G G G G G G Sbjct: 9 FGRGGGGRGDGGGRGGGGGRGFGRVGD-SGGRGGRGGRGG 47 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P A P P P P P PPPP Sbjct: 181 PPPPPPPPPAAAAASPSPERSPRCQPSPPPPPP 213 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P + P PP P PP P P PPPP Sbjct: 39 PPPARHRAPSPPRPPPPP--PPPTQPAPPPPPP 69 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P + A PP P PP P PPPP R Sbjct: 40 PPARHRAPSPPRPPPPPPPPTQPAPPPPPPAR 71 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P P P PP P P PPPP Sbjct: 110 PQPRSPEPETPPAPAPLPPPPPP 132 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXX 943 T +P P P P P P P P P P P P P S T Sbjct: 566 TAPAPPSPPEPPSPQHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHA 625 Query: 944 PXNP 955 P P Sbjct: 626 PPAP 629 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GG+ G GG G G G G G EG Sbjct: 6 GGGGGRFGGGGGGRFGGGGGRGGRFGGGGRG-GRGGGGGFRDEG 48 >10_08_0223 - 15986763-15987575 Length = 270 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXG 814 GGGG G GP G G G +G+ +AG G Sbjct: 197 GGGGHGGGPAASPSYGVGAGAGSGAGDAGSDG 228 >10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 Length = 184 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEA-GXXGXGXXXGXXXGXEG 775 R R+ GGG G G GG G G +GS G G G G Sbjct: 22 RVARYASAGGGGGGGGGGGGSNGGSGWGSGSGSGYGQASGGGAYASGGGGAG 73 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G +G +A G G G G Sbjct: 33 GGGGGGGGGSNGGSGWGSGSGSGYGQASGGGAYASGGGGAGGGG 76 >09_02_0601 + 11112201-11112386,11112471-11114080,11114345-11114579, 11115233-11115358 Length = 718 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P+ P P P P P+S P PP PP P P PP Sbjct: 407 TAAAPAPPS--PPEPPSPRHPSSPPPLRSPPRQPTPP---PSPSQQPP 449 >06_03_1153 - 28047125-28047751 Length = 208 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPP 904 PP CPP P P PPP Sbjct: 11 PPAIFCPPPLSPPPPPPP 28 >06_03_0395 - 20354713-20355570 Length = 285 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRL 922 P PA+ LP P P CP P PP R+ Sbjct: 227 PAAVDPAAPLPTPSPSPPPCPSPPPAATLPDPPEAARI 264 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 PFP 961 P P Sbjct: 629 PPP 631 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/63 (28%), Positives = 22/63 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P+ P P P PA + P P PP P P P PP + P Sbjct: 115 TPTPPKPTPPTYKPQPKPT---PAPYTPTPT-PPTYKPQPKPTPPPTYKPQPKPTPTPYT 170 Query: 953 PFP 961 P P Sbjct: 171 PTP 173 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P P + P P P P P PPP + T P P P Sbjct: 265 PKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKPQP 319 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPX--CPPXXGPXPXPPPP 907 +P+ P P P P P PP PP P P P PP Sbjct: 212 TPTPPSYKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNPP 258 >04_03_0833 + 20147242-20147849,20147937-20148081,20148157-20148210, 20148297-20148388,20148957-20149093,20149210-20149464, 20149598-20149771,20149863-20149960 Length = 520 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXE 829 GGGG G GG G GG AGS E Sbjct: 48 GGGGAGKKGRGGGGGGGGGVAAGSSE 73 >03_05_0267 - 22538631-22539452 Length = 273 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ GG G G G G Sbjct: 128 GGGGLGGGGSSGGEGSGGGSSDGEGCGDGSGGGELGG 164 >02_05_1277 - 35408097-35409080 Length = 327 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Frame = +2 Query: 839 PAXFPPXPXCPPXXG-PXPXPPPP 907 PA PP P PP P P PPPP Sbjct: 60 PAPPPPPPAQPPVLAAPAPAPPPP 83 >02_05_0157 - 26353971-26354336,26354645-26354726,26354838-26354933, 26355365-26356068 Length = 415 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G +GG G G AG AG G G G G +G Sbjct: 79 GGGGVAGGGARGGD-GGGVAGAGGGVAGGDG-GGVAGAGGGCDG 120 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXP-XCPPXXGPXPXPPP 904 P P P P P P + P+ PP P P P P P P Sbjct: 112 PPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAP 155 >01_01_1125 - 8920590-8924372 Length = 1260 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 827 ASXLPAXFPPXPXCPPXXGPXPXPPPP 907 AS A PP P P G P PPPP Sbjct: 157 ASHAAAAPPPPPSAMPLAGGEPRPPPP 183 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPT 628 Query: 953 P 955 P Sbjct: 629 P 629 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P SL P Sbjct: 400 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSLAKQHAPPA 459 Query: 953 P 955 P Sbjct: 460 P 460 >12_01_0838 - 7830944-7831444 Length = 166 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXA-GSXEAGXXGXGXXXGXXXGXEGE 772 + GGG G G GG G GG + GS G G G G +G+ Sbjct: 61 YGKGGGQSGGGQGSGGGGGGGGGGSNGSGSGSGYGYGYGQG-NGGAQGQ 108 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P+S + PP P P PPPP Sbjct: 84 PTPPPPSSTASSSLPPPTPLLPKHQQAPPPPPP 116 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPP 907 A +PP PP P P PPPP Sbjct: 17 AEWPPELRLPPPPPPHPPPPPP 38 >10_08_0218 - 15967064-15967906 Length = 280 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G GG G G GG G +G +AG G G G G Sbjct: 115 GQGGGGGGGVNGGSRYGSGSGSGYGQAGSYGPGGAYAQGGGQGG 158 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GG G G G G G G G +AG G G G Sbjct: 242 GGSGSGSGSGSGQAGGYGPYGGGYAQAGGQGGGGGGG 278 >09_04_0506 - 18188785-18190599 Length = 604 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 901 GGXXXXPXXRXAXGXRREXXXEXRGXXXGXGGXXGXXXWGRGGG 770 GG P G G G GG G WGRGGG Sbjct: 294 GGAAGGPGGAQVGGNYGGGRGGGGGGPGGGGGGGGGGNWGRGGG 337 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/46 (34%), Positives = 18/46 (39%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 PGG G G GG+ G GG G G G G G G+ Sbjct: 300 PGGAQVG-GNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGGMGGRGQ 344 >08_02_1256 + 25645085-25645396 Length = 103 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPF 958 PP P PP P P PPP S P + F Sbjct: 62 PPPPPPPPLPSPPPPPPPQQQEEQSPPPLLDPADEF 97 >08_01_1038 + 10540185-10540709 Length = 174 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXE 829 GGGG G G +GG G GG S E Sbjct: 35 GGGGLGKGGVRGGGGGLGGGRRRSVE 60 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/47 (29%), Positives = 17/47 (36%) Frame = +1 Query: 772 LPLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRP 912 +PL P PP PPP P + +P G PP P Sbjct: 1154 MPLPPPPPPPLPPPPPVAPFHPPGPHFSGPSVPPHHGNNYHQPPSVP 1200 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P+S P+ P P PP P P PP Sbjct: 35 PSPPSLSPSTPPTYPPPSSTPPSLAPVSP-SPPTTYLPPSPTPP 77 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/42 (30%), Positives = 14/42 (33%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 P P P P P +P P PP P P PP Sbjct: 77 PPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 >07_03_0387 - 17536026-17536636,17536772-17537150 Length = 329 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P LP PP P P PP P R+S P P P Sbjct: 165 PTPALPRSGTVLGAAPPLPLPLPLPPAPVFPRVSTVLGVAPPPPLP 210 >06_03_1450 + 30246702-30247346,30248603-30248689,30248789-30248920, 30249016-30249162,30250375-30250440,30250519-30250629, 30251551-30251584,30251667-30251743,30251829-30251906 Length = 458 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/50 (32%), Positives = 19/50 (38%) Frame = +2 Query: 758 IXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 + T S S P P PA+ +PP P PP P P P P Sbjct: 22 LATYPSASAPPYTPYPATDYAAPAAY--PTYPPPPADPPQYAPPPAAPQP 69 >06_01_0760 - 5676973-5677830 Length = 285 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G +G +AG G Sbjct: 73 GGGGGGGGGQNGGSGYGSGSGSGYGQAGGYG 103 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGGG G G GG G +G +AG G Sbjct: 115 GGGGGGGGGQNGGSGYGSGFGSGYGQAGGYG 145 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = -3 Query: 945 GXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G R R+ GGG G G GG G +GS G G G Sbjct: 18 GLSNAARVARYASAGGGGGGGGGGGGSGNGSGWGSGSGSGYGQSSGSGGAYASGGGG 74 >05_05_0354 - 24347550-24347870 Length = 106 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGG G G GG+ G G AG+ AG Sbjct: 37 GGGGGGGKGGGGRGGAGRPIAGAAAAG 63 >05_04_0324 - 20273797-20274261 Length = 154 Score = 29.1 bits (62), Expect = 5.6 Identities = 23/73 (31%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 173 FPKDDPSKPVHLTAFIGYKAGMTHVVRE--PDRPGSKINKKEIVEAVTIIETPPMVCVGV 346 FP D+P K VH+ G + +T ++ E P + +N EA + P CVGV Sbjct: 60 FPPDNPQKFVHVHRVFG-ASNVTKLLNELHPYQREDAVNSL-AYEADMRLRDPVYGCVGV 117 Query: 347 VGYIETPHGLRAL 385 + ++ H LR L Sbjct: 118 ISVLQ--HQLRQL 128 >05_04_0303 - 20010761-20011756 Length = 331 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G G G AGS G G G Sbjct: 68 GGGGGGGGVGAGEMNGGASSAAGSSGGGGGGGG 100 >04_04_1414 - 33394518-33394847 Length = 109 Score = 29.1 bits (62), Expect = 5.6 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGG G G GG GG G G G G G G Sbjct: 67 PGGGTVGVGAVCGGS-ACGGPACGGGGGGGGGGGGCGGGGGG 107 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 860 PXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P PP P P PPPP R + + P FP Sbjct: 396 PAPPPPPQPPPPPPPPPHQRETPSPSPPPQPQFP 429 >01_06_0148 - 27007330-27008124 Length = 264 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG P K GG G +AG G G G Sbjct: 190 PGGGAPSPHPPKDNDDANGGGSVGKGDAGRHGWSYYSKGGGGGSG 234 >01_02_0007 + 10132380-10133201 Length = 273 Score = 29.1 bits (62), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP-PPPG 910 P P P P P LP P P PP P P P PPG Sbjct: 191 PDPNNPQPLPQPDPNAPPQPLPQ---PDPNSPPQPLPQPDPNTPPG 233 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P+ P P P P P LP P P PP P P P P L P P Sbjct: 157 PNAPSL-PLPQPDPNAPPLPLPQ---PDPNAPPQ--PLPQPDPNNPQPLPQPDPNAPPQP 210 Query: 956 FP 961 P Sbjct: 211 LP 212 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P+ LP P P PP P P P P Sbjct: 144 PNPNNPQPLPQPDPNAPSLPLP---QPDPNAPPLPLPQPDPNAP 184 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P+ P P P P PPPP Sbjct: 71 PPPQPQPEPQPAAPSQPPPPQEQPSPPPPASSNTTQQPPPP 111 >12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 Length = 598 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 860 PXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P PP P P PPPPG L P P P Sbjct: 256 PPSPPH--PRPQPPPPGSSDLPTDVAILPSPPHP 287 >11_07_0007 - 27262229-27262638,27263252-27263312 Length = 156 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GG GG G+ G G G G Sbjct: 65 GGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAGG 105 >11_06_0564 - 25022353-25022546,25022654-25022894,25022936-25023041, 25023341-25023565,25023704-25023793,25025001-25025120, 25025210-25025356,25026282-25026490 Length = 443 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGG 850 G GG G GP GG+ G GG Sbjct: 5 GDGGGGGGPATGGRAGRGG 23 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/71 (28%), Positives = 24/71 (33%), Gaps = 2/71 (2%) Frame = +1 Query: 706 CVCPDXMIDCXGVXTATDTXXXLPLXPTXPPRXXPP--PXXXXLXAPXXXPAXAXLPXFX 879 C+ P DC +D P PPR PP P + P PA P Sbjct: 177 CIGPVLACDCEPEYFDSDPAPPTPPTIARPPRPLPPASPPPPSIATPPPSPASPPPP--- 233 Query: 880 GAXXXPPPXRP 912 + PPP P Sbjct: 234 -STATPPPPSP 243 Score = 28.7 bits (61), Expect = 7.4 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +2 Query: 809 PXPXXPASXLP---AXFPPXPXCPPXXG---PXPXPPPPGXXRLSLTXXXXP 946 P P PAS P A PP P PP P P P P R S T P Sbjct: 207 PRPLPPASPPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASPTPPPIP 258 >10_08_0399 - 17614585-17614809,17614860-17615168 Length = 177 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 GGG G G +GG G GG A + G G Sbjct: 78 GGGGGAGAREGGGGGGGGAVAAASLPGERG 107 >09_03_0145 - 12749288-12751510 Length = 740 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPG----XXRLSLTXXXXPXNPFPXG 967 PP P P P PPPPG L P PFP G Sbjct: 19 PPFKPKPTNPSPPPPPPPPGIQPPPPALPGMPHGRPPPPFPGG 61 >09_02_0274 + 6611555-6611615,6612229-6612638 Length = 156 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GG GG G+ G G G G Sbjct: 65 GGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAGG 105 >05_06_0078 - 25412770-25413852 Length = 360 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G G GG+ GG AG G G G G +G Sbjct: 281 GGAGGGGGDAAGGE---GGGAAGGGRDGITGGGGGGGSGAPRDG 321 >03_06_0485 + 34242121-34243188 Length = 355 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP G GG AG G G Sbjct: 307 GGGNGAGPGGNGDGATGGSGAGVAPGGGGSGG 338 >02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 Length = 400 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXE 778 GG G G G +GG GG AG G G G + Sbjct: 275 GGAGAGAGGARGGAGAGGGHGGAGAGAGGGRGGAGAGAGGGAQ 317 >02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 Length = 296 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +2 Query: 851 PPXPXCPPXXGPX-PXPPPPGXXRLSLTXXXXP 946 PP P PP P P PPPP +LT P Sbjct: 10 PPAPPSPPPALPCDPMPPPPRHDDTTLTLSLAP 42 >01_06_0956 - 33343503-33344086,33344225-33344384 Length = 247 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP 898 +P+ P P P P PA P P P P P P Sbjct: 123 APATPSPPPLLPPSPRHKRRTAPAPMPLPPAQAPVWSPAPAP 164 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAG 838 PGG G G G GG G GG G Sbjct: 108 PGGRGIGRGQDDGGSKGGGGRGRG 131 >01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 Length = 855 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPP 907 A PP P P P P PPPP Sbjct: 51 AAAPPLPPRSPSPSPSPPPPPP 72 >12_02_0687 + 22123216-22123760,22125021-22125330 Length = 284 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG G GG G E G G G Sbjct: 30 GGGGGGGG-YDGGGDGEGG-GGGDGEGGGGGGG 60 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGGG G GG+ G GG GS G Sbjct: 33 GGGGGEGGGGGGGEGGGGGSGYGSGYGG 60 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 8/55 (14%) Frame = -3 Query: 915 FXPGGGGXGXGPXKG--------GQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 + GGGG G G +G GQ G GG G G G G G G Sbjct: 184 YGQGGGGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGGSSSGSGYGSGYGGGAGG 238 >12_01_0442 + 3495333-3496484 Length = 383 Score = 28.3 bits (60), Expect = 9.7 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 11/59 (18%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASX-----------LPAXFPPXPXCPPXXGPXPXPPPP 907 T +P+ P P P P+S LP PP P P P PPPP Sbjct: 166 TTAAPASPPDSPIWTPGHKPPSSSPDIYLVRRTPKLPVTRPPRTKQAPPTAPAPAPPPP 224 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 797 PXXXPXPXXPASXLP-AXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P PA P A PP P P P PP P R Sbjct: 134 PPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPPQPDKRR 175 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGGG G G +GG G G G G Sbjct: 80 GGGGGGVGDVEGGGGGGGAGGGGGGGGG 107 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G GG GG A G G G G Sbjct: 185 GGGGGWTGGGNGGGGSGGGGGARGSSGGGGGGGWAGG 221 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G GG S G G G Sbjct: 187 GGGWTGGGNGGGGSGGGGGARGSSGGGGGGGWAGGGG 223 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHLPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >09_06_0172 + 21329904-21331512,21331595-21331740,21332333-21332556, 21333689-21334448 Length = 912 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G P GG G G E G G Sbjct: 219 GGGGGGYAPGYGGMGVGDGGSGGGYEPAYGGMG 251 >09_04_0180 + 15367737-15367755,15368874-15369739 Length = 294 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 SPR P P P P P PP P P P P PPP Sbjct: 143 SPRPRPPDPEPKPDPEPDPELEPEPEPEPDPEPEPEPPTP--KPIPTPIPSPPP 194 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 482 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 541 Query: 953 P 955 P Sbjct: 542 P 542 >09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 Length = 883 Score = 28.3 bits (60), Expect = 9.7 Identities = 22/80 (27%), Positives = 28/80 (35%), Gaps = 3/80 (3%) Frame = +2 Query: 680 LEKPIPVHSVFA-QMX*LTALVSPRQXIXTXXSPSX--PXXXPXXXPXPXXPASXLPAXF 850 L P+P+ S Q L V P + +P P P P A+ +P Sbjct: 240 LSVPMPLASATVEQAHHLLCHVRPLLLLHCTLAPHLCVPRVLSPPAPMPSALATHVPTPP 299 Query: 851 PPXPXCPPXXGPXPXPPPPG 910 P P P P P PPG Sbjct: 300 APAPPVPTPLAPTPADVPPG 319 >08_02_1084 - 24232968-24234779 Length = 603 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 Query: 832 RGXXXGXGGXXGXXXWGRGGG 770 RG G G G WGRGGG Sbjct: 309 RGGGPGGGAGGGGGNWGRGGG 329 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P P P P P S P PP P P PPPP Sbjct: 41 TTPTPLTPNPNPSPT-LPPPPMSTPPVVAPPMHSFAPSFRPLGAPPPP 87 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 547 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 606 Query: 953 P 955 P Sbjct: 607 P 607 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 547 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 606 Query: 953 P 955 P Sbjct: 607 P 607 >07_03_1160 - 24430240-24431268 Length = 342 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P P PP P PP P P P Sbjct: 244 PQPNPDMPPKPDQPPQPCPDG-PPKPDQPPQPNPNGPPKP 282 >06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 Length = 216 Score = 28.3 bits (60), Expect = 9.7 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 4/61 (6%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXP----XCPPXXGPXPXPPP 904 +V P + P P P P PA LPA PP P PP P PP Sbjct: 38 VVGPSTPVAADDVPPPPYCV--YPPPPTKPA--LPAPLPPTPASPGDSPPSIAPAGNPPT 93 Query: 905 P 907 P Sbjct: 94 P 94 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >06_01_0240 - 1822086-1822216,1822311-1822367,1822788-1822842, 1824585-1824674,1824848-1824995,1825095-1825351 Length = 245 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEA 826 P GGG G G +GG G GG + +A Sbjct: 54 PRGGGGGRGGRRGGGRGRGGDGSDRIDA 81 >06_01_0145 + 1092764-1093351 Length = 195 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 930 VREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 VR R GG G GP GG G GG G G G G Sbjct: 91 VRIPRGGKGGAGGNAGP--GGVGGKGGPGGDGGPGGIGGRGGDGG 133 >05_05_0356 - 24373879-24374469 Length = 196 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 F GGG G G GG GG GS G G G G G Sbjct: 98 FSGGGGSRGGGVSSGGSSRGGGSSIGS---GGGSRGSGGGSSSGSRG 141 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P S P P P PPPP Sbjct: 123 PSGPDPITSDPPPPPPPLSEFPVLREVPSGPDPITSDPPPPPPP 166 >04_04_1126 + 31095651-31096115 Length = 154 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P S P PP P PP P PPPP Sbjct: 29 PAAACSYCPTPKPPPPP-PPAPSGVPCPPPP 58 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PP P P PPPP Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >04_04_0053 + 22389227-22389613,22390528-22390981,22391618-22391673, 22391757-22391887,22391976-22392072,22393329-22393484 Length = 426 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP P PPPP Sbjct: 30 PDAHPHPHHPMAQARWVVLPYPPPPPPMVAAPPPPPP 66 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 PP P P P PP P + P PFP G Sbjct: 35 PPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFPKG 73 >02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551, 2703632-2703883,2703969-2704798,2704895-2706202, 2706293-2706490 Length = 990 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 537 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 596 Query: 953 P 955 P Sbjct: 597 P 597 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLP---AXFPPXPXCPPXXGPXPXPPP 904 P P P P PA LP P P P GP P PP Sbjct: 538 PQFPRPPPPNMPQLQPPAHMLPHAQGSRAPLPQLPSMSGPPPVNPP 583 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 753 NXYXXVPPPRPHXXXPXXPPXPXXXPRXSXXXSRL 857 N + PPP H P PP P P SR+ Sbjct: 407 NPFVQPPPPPTHTHGPPPPPPPPPPPPVGYWESRV 441 >01_06_0075 - 26201231-26201422,26201697-26201778,26201868-26201978, 26202059-26202310,26202396-26204629,26204720-26204917 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 28.3 bits (60), Expect = 9.7 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 +P P P P P P P P P P P P P S T P Sbjct: 569 APPSPPKPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSPTKQHAPPA 628 Query: 953 P 955 P Sbjct: 629 P 629 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,659,051 Number of Sequences: 37544 Number of extensions: 593739 Number of successful extensions: 6357 Number of sequences better than 10.0: 216 Number of HSP's better than 10.0 without gapping: 2416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4882 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2811537600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -