BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P10 (968 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 281 5e-76 SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 235 4e-62 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 39 0.007 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 38 0.012 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 34 0.20 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 34 0.20 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 33 0.26 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 33 0.26 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.26 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.35 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 33 0.46 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 32 0.61 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 32 0.61 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.80 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 31 1.1 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.9 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.9 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.9 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.9 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 30 2.5 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 3.2 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 3.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 3.2 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 3.2 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 30 3.2 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 3.2 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 4.3 SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 4.3 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 29 5.7 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 5.7 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 29 7.5 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 29 7.5 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 29 7.5 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 29 7.5 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 28 9.9 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 28 9.9 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 9.9 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 28 9.9 SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 28 9.9 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 281 bits (690), Expect = 5e-76 Identities = 127/208 (61%), Positives = 155/208 (74%), Gaps = 1/208 (0%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F+ P HGS+GF P+KR +RHRGKVK+FPKDD + P HLTAFIG+KAGMTH++RE ++PGS Sbjct: 5 FEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILREVEKPGS 64 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 K+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE C+RRFYKNW Sbjct: 65 KLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRFYKNWCNS 124 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQL 634 W D+ G+KSIE+DF M ++C V+RVI TQ KLL+ R K AHIMEIQ+ Sbjct: 125 KKKAFTKASKRWADDDGKKSIEEDFNTMKKYCKVIRVICHTQQKLLKMRQKKAHIMEIQV 184 Query: 635 NGG-TIQDXXKWARXHLEKPIPVHSVFA 715 NGG + + W R LE P PV VF+ Sbjct: 185 NGGKDVAEKVDWCRERLENPAPVRKVFS 212 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 235 bits (575), Expect = 4e-62 Identities = 104/169 (61%), Positives = 127/169 (75%) Frame = +2 Query: 74 PACRTENFQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVR 253 P F+ P HGS+GF P+KR +RHRGKVK+FPKDD + P HLTAFIG+KAGMTH++R Sbjct: 46 PKMSHRKFEAPRHGSLGFLPRKRCKRHRGKVKSFPKDDNTLPPHLTAFIGFKAGMTHILR 105 Query: 254 EPDRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRF 433 E ++PGSK+NKKE VEAVTIIETPPM+ VGVVGYIETP G+R L T+WAEH+SE C+RRF Sbjct: 106 EVEKPGSKLNKKEKVEAVTIIETPPMMVVGVVGYIETPRGMRVLKTIWAEHLSEECKRRF 165 Query: 434 YKNWYXXXXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQ 580 YKNW W D+ G+KSIE+DF M ++C V+RVI TQ Sbjct: 166 YKNWCNSKKKAFTKASKRWADDDGKKSIEEDFNTMKKYCKVIRVICHTQ 214 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.0 bits (99), Expect = 2e-04 Identities = 23/60 (38%), Positives = 27/60 (45%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 + ++V+PR I T S P P P P S P PP P PP P P PPPP Sbjct: 344 VVSVVNPRA-IVTDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P P P P PP P PP P P PPPP Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P P P P PP P PP P P PPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P+ P PP P PP P P PPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.9 bits (94), Expect = 8e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P PP P P PPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSL 928 P P P P P P P PP P PP P P PPPP L L Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRL 436 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P PP P P PPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P PP P P PPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P P P P PP P PP P P PPPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPP-PPPPPPPPPPPPPPPPPPP 418 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P S P PP P PP P P PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P PP P P PPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPP-PPQPPPPPPPPPPPPPPPP 410 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P PP P PP P P PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P P P PP P PP P P P PP Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +1 Query: 754 TDTXXXLPLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRP 912 TD + + P PP PPP P P+ P PPP P Sbjct: 355 TDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P P P PP P PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P PP G P PPPP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P ++ P PP PP P P PPPPG Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPP-PPPPPPG 326 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 37.9 bits (84), Expect = 0.012 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC-PPXXGPXPXPPPPGXXRLSLTXXXXPXN 952 P+ P P P P P + P PP P PP P P PPPP P Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPP--PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Query: 953 PFP 961 P+P Sbjct: 186 PYP 188 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP-PPGXXRLSLTXXXXPXN 952 P P P P P P A +PP P PP P P PP PP + P Sbjct: 151 PPNPPYPPPLYPPPPNPPPP-NAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 953 PFP 961 P+P Sbjct: 210 PYP 212 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/52 (38%), Positives = 22/52 (42%), Gaps = 4/52 (7%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAX--FPPXPXCP--PXXGPXPXPPPP 907 T SP+ P P P P P P +PP P P P P P PPPP Sbjct: 86 TNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNP-PYPPPP 136 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXP-ASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P P A P PP P PP P P PPP Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYP--PPPNAPNPPYPPP 225 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLP-AXFPPXPXCP--PXXGPXPXPPPP 907 P+ P P P P P P +PP P P P P P PPPP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP-PYPPPP 215 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLP----AXFPPXPXCPPXXGP-XPXPPPP 907 P P P P P P + P +PP P P P P PPPP Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 31.9 bits (69), Expect = 0.80 Identities = 19/63 (30%), Positives = 23/63 (36%), Gaps = 2/63 (3%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGP-XPXPPPPG-XXRLSLTXXXXP 946 +P P P P P P P P PP P P PPPP ++L P Sbjct: 192 NPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQFAIALCLGHGP 251 Query: 947 XNP 955 +P Sbjct: 252 RSP 254 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/66 (30%), Positives = 23/66 (34%), Gaps = 4/66 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLP----AXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXX 943 P+ P P P P P P A +PP P P P P PP P Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP--YPPPPNPPYPPPLYPPPPNPPP 169 Query: 944 PXNPFP 961 P P+P Sbjct: 170 PNAPYP 175 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +1 Query: 784 PTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRPKXXFPD 930 P PP PPP P P A P PPP P P+ Sbjct: 97 PPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPN 145 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P + P P P PP P P PPPP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPP 112 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P P P PP P P PP Sbjct: 178 PYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P PP P PP P PPPP Sbjct: 166 NPPPPNAPYPPPPYPPPPNPPYPP--PPNPPYPPPPN-APNPPPP 207 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 +P P P P P PA+ P PP P P GP P PP Sbjct: 116 APETPSQAPSPPPPPTSPATRAPP--PPPPIAPATGGPPPPPP 156 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPP 907 P P P P PA+ +PA P PP GP P PPPP Sbjct: 156 PIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPP 202 Score = 35.1 bits (77), Expect = 0.086 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLP--AXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXP 946 P P P PA +P A PP P P P P PPPP L L P Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 +P Q P+ P P P PA+ P PP P P GP P PP Sbjct: 119 TPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPP--PPPPIAPATGGPPPPPP 169 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P S P PP P P P PPPP Sbjct: 87 PLVPAGVEAPTPTPMVAQSVAPTP-PPPPRAPETPSQAPSPPPP 129 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P + A PP P P P PPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 775 PLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRPKXXFP 927 P PT P PPP A P + G PPP P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVP 177 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 T +P+ P P P P PP P PP PPPPG Sbjct: 175 TVPAPAVPLAAASPPPPSGGPPPPPP---PPPPPPPPPILELAAPPPPG 220 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXP---ASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P AS P P P PP P P PPPP Sbjct: 166 PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPP---PPPPPPPP 209 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPX---PXCPPXXGPXPXPPPP 907 P P P P P + PA PP P PP P P PPPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXG-PXPXPPP 904 +P P P P P P + P PP P PP P P PPP Sbjct: 64 APPPPAAAPAAPPPPAAPPAAPPPP-PPLPAPPPPPAQPAPQPPP 107 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 P P P P P PP P P P P PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P S LP P PP P P PPPP Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P PA PP P P P P PPPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 35.5 bits (78), Expect = 0.065 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P PA+ P P P PP P P PPPPG Sbjct: 777 PPPPPPPTKPAT--PRVPPNIPSRPPGARPTPPPPPPG 812 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 35.1 bits (77), Expect = 0.086 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 492 PPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPG 525 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 475 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 485 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 462 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 495 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 535 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 512 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 545 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P P PPPG Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPG 555 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P +P P P PP P P PPPG + P P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLP 612 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P PP P P PPPG Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPG 465 Score = 32.7 bits (71), Expect = 0.46 Identities = 22/68 (32%), Positives = 24/68 (35%), Gaps = 7/68 (10%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPA-----SXLPAXFPPXPXCPPXXGPXPXPPPPG--XXRLSLTXX 937 S P P P P P +P P P PP P P PPPG RL + Sbjct: 557 SHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGA 616 Query: 938 XXPXNPFP 961 P P P Sbjct: 617 YHPRLPPP 624 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P +P P P PP P P PPPG Sbjct: 424 PGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPG 455 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P P PP P PPPG Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPG 505 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P +P P PP P P PPPG Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPG 515 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/61 (32%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXP---AS--XLPAXFPPXPXCPPXXGPXPXPPPP 907 +P + +P P P P P P AS +P P P PP P P PPP Sbjct: 526 APHPRVPPPGAPH-PRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP 584 Query: 908 G 910 G Sbjct: 585 G 585 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P +P+ P PP P P PPPG Sbjct: 382 PPPGATHPRVPSPGASHPRVPPPGAPHPRVPPPG 415 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXX--PASXLPAXFPPXPXCPPXXGPXPXPPP 904 SP P P P P P P P PP P PP GP P PPP Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP-PPTNGPPPPPPP 410 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P + P PP PP P PPPP Sbjct: 353 NPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 30.7 bits (66), Expect = 1.9 Identities = 21/78 (26%), Positives = 29/78 (37%), Gaps = 5/78 (6%) Frame = +2 Query: 689 PIPVHSVFAQMX*LTALVSPRQXIXTXXSP--SXPXXXPXXXPXPXXPASXLPAXFPPX- 859 P ++VFA++ T + + T + P P P P + P PP Sbjct: 313 PTTHYTVFARVASYTDWIKRMTVVGTSGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTN 372 Query: 860 --PXCPPXXGPXPXPPPP 907 P PP P PPPP Sbjct: 373 KPPPPPPPTNGPPPPPPP 390 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 2/47 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXX--PASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P P PP P P P P PP G Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNG 393 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P P PP GP PPPP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS 925 P+ P P P P P + PP P P P PP G L+ Sbjct: 168 PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGGGSLA 217 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS 925 P P P PP P PP P P PPPP L+ Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHLA 500 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P PP P PP P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSL 928 P P PP P PP P P PPPP L L Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTPLHL 499 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPX----PXCPPXXGPXPXPPPPGXXRLSL 928 P P P P P +P PP P PP P PPPP ++L Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPGDEMAL 597 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 S P P P P S P PP P PP P PPPPG Sbjct: 551 SEEPPPPPPGVDIPPPLPPSEDPKPPPPPPE-PPEECP---PPPPG 592 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P A LP PP PP P P PPPP Sbjct: 952 APPPPPPPGGSAPPPGGGAPPLPP--PPGGSAPPPPPPPPPPPPP 994 Score = 32.3 bits (70), Expect = 0.61 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 5/80 (6%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC-----PPXXGPXPXPPPP 907 SP Q SPS P P P P PP PP G P PPPP Sbjct: 899 SPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Query: 908 GXXRLSLTXXXXPXNPFPXG 967 P P P G Sbjct: 959 PGGSAPPPGGGAPPLPPPPG 978 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG G G G G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGG G G GG G G G G G G G G Sbjct: 345 PGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHG 386 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGG G G GG G G G G G G G G Sbjct: 360 PGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYG 401 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGG G G GG G G G G G G G G Sbjct: 350 PGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHG 391 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGG G G GG G G G G G G G G Sbjct: 355 PGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHG 396 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 PGGG G G GG G G G G G G Sbjct: 340 PGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G G G G G G G Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHG 376 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG G G G G G G Sbjct: 371 GGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDG 403 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP--PXXGPXPXPPP 904 SP Q T P P P P P P+ P PP P P P P PPP Sbjct: 197 SPSQI--TQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P+ P P P P P PP PP P P P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P P PP P P P P PPPP L P P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXP-ASXLPAXFPPXPXCPPXXGP 886 SPS P P P P P A+ LP PP P PP P Sbjct: 223 SPSPPRPPPPPPPSPPRPLAAKLPEP-PPIPNMPPTLPP 260 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PP P PP P PPPP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPP-XXGPXPXPPPP 907 P P P S L PP P PP G P PPPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPP 715 Score = 31.9 bits (69), Expect = 0.80 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 809 PXPXXPASXLPAXFP-PXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P L P P P PP G PPPP + P P P G Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPG 749 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P + LP PP P P G P PP P L P P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P P PP P P PPPP Sbjct: 204 APKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/55 (36%), Positives = 24/55 (43%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P+Q T +P P P P PA+ P PP P P P P PPPP Sbjct: 204 APKQQKATPVNPPEPDYLE---PTPPPPAAPAP---PPPPAAAP---PPPPPPPP 249 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/52 (36%), Positives = 20/52 (38%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSL 928 SP P P P P PP P PP G P PPP G L+L Sbjct: 181 SPGSPTEDTPWTSVPPPPPPG-PGGIPPPP--PPIRGGVPPPPPMGGGSLAL 229 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 32.7 bits (71), Expect = 0.46 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P PA PP P PP P P PPPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +2 Query: 740 VSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC-PPXXGPXPXPP--PP 907 +SP T P P P P P P PP P PP P P PP PP Sbjct: 158 ISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 216 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC-PPXXGPXPXPP--PP 907 +++P P P P P P P PP P PP P P PP PP Sbjct: 144 VMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 32.3 bits (70), Expect = 0.61 Identities = 21/62 (33%), Positives = 23/62 (37%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGX 781 G G V E GGGG G GG+ G GG +G G G G G G Sbjct: 105 GFEYEGRRLKVAEASKDSGGGGRRGGGYGGGRGGGGGYRSG---GGYRGGGGYRGGGGGY 161 Query: 780 EG 775 G Sbjct: 162 RG 163 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G + GG G GG G G G G G G G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G + G G G G G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GG G GG G G G G G G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGG-GGGGGGGDGGGYGDGDGG 813 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ-XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G G G G G G G G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 G G G G +GG G GG G G G G G G G Sbjct: 140 GNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRG 182 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 31.9 bits (69), Expect = 0.80 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPP 874 L + + R + T P+ P P P PAS +PA PP P PP Sbjct: 61 LVSETAARSRVETTDGPAAVIPPP---PPPPPPASNVPAPPPPPPVMPP 106 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PA+ +P PP P P P P PPPP Sbjct: 77 PAAVIPP--PPPPPPPASNVPAPPPPPP 102 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 4/35 (11%) Frame = +2 Query: 815 PXXPASXLPAXF----PPXPXCPPXXGPXPXPPPP 907 P P LP PP P PP P P PPPP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +2 Query: 773 SPSXPXXX-PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P P PP P PP P PPPP Sbjct: 666 NPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P PP P P PPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPP 1178 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 836 LPAXFPPXPXCPPXXGPXPXPPPP 907 +P PP P PP P PPPP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P P P P PPPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPP 1180 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P P P P PPPP Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 P PP P P P P PPPP Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPP 1183 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPP-PGXXRLSLTXXXXPXNP 955 PP P PP GP P PPP G SL P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXX-GPXPXPPPPG 910 P P P P PP PP G P PPPPG Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 854 PXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P PP G P PPPP R + P P P Sbjct: 363 PPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/56 (28%), Positives = 19/56 (33%) Frame = +2 Query: 740 VSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 V+P+ +P P P P PA F P PP PPPP Sbjct: 757 VTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPP 812 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PA LP P P PP P P P P Sbjct: 749 PAPPLPPKVTPKPPAPPQFAPVPPPCAP 776 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/58 (25%), Positives = 22/58 (37%) Frame = +1 Query: 739 GVXTATDTXXXLPLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRP 912 G+ + ++ P P PP+ P P AP P A +P + PP P Sbjct: 736 GIPSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPC-APIPPMPCSAPLPPAPAP 792 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P PP P P PPPP Sbjct: 867 PPPPPPPPPPPPPPPPPPP 885 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPP 904 P PP P PP P P PPP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/62 (30%), Positives = 22/62 (35%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 PS P P P P P + LP P P P P PP P ++ P P Sbjct: 195 PSPPI--PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPS-KAIATPNPPMPETP 251 Query: 956 FP 961 P Sbjct: 252 LP 253 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P++ PP P PP P PP P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMP 209 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P +P PP P PP P P PPP G Sbjct: 59 PTVPIPPTLPPPP--PPPPPPLPPPPPSG 85 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 G G G R P GGG G G GG G G G + G G Sbjct: 191 GRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGG 239 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G +GG G GG G G G G G G Sbjct: 196 GGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYG 238 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P PP P P G P PPPP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P LP P P P G P PPPPG Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGA-PPPPPPG 706 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P +P PP P PP P P PPP G Sbjct: 283 PTVPIPPTLPPPP--PPPPPPLPPPPPSG 309 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 Query: 775 PLXPTXPPRXXPPPXXXXLXAPXXXPAXAXLPXFXGAXXXPPPXRPK 915 P P PPR PPP P P +P PPP +PK Sbjct: 1066 PSEPAPPPRQPPPPSTSQPVPPPRQP--DPIPTNPAHPTEPPPRQPK 1110 Score = 29.1 bits (62), Expect = 5.7 Identities = 19/56 (33%), Positives = 21/56 (37%), Gaps = 4/56 (7%) Frame = +2 Query: 752 QXIXTXXSPSXPXXXPXXXPX-PXXPASXLPAXFPPXPXCPPXXGPXP---XPPPP 907 Q + S P P P P P S +P PP PP P P PPPP Sbjct: 1025 QPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIP-PPRKPSPPPSEPAPPPRQPPPP 1079 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P + P P P P GP P PPPP Sbjct: 331 PSDSPSTTTPTTPQPPT-PTTPKTHPQLGPPPPPPPP 366 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P +P P P P P P P PG Sbjct: 40 PGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPG 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P PPP Sbjct: 53 PPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P P P P P P P PG Sbjct: 60 PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPG 101 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P PPP Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P P P P P P P PG Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPG 91 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P PPP Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P P P P P P P P PG Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPG 111 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +2 Query: 827 ASXLPAXFPPXPXC---PPXXGPXPXPPPPG 910 A + A PP P C PP P P PPPPG Sbjct: 65 AKSMAAATPP-PLCAPPPPPPPPPPPPPPPG 94 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 PP P P G P PPPPG L++ P P Sbjct: 386 PPPPWSKPG-GILPGPPPPGPPMLNMAPSIPPWQTTP 421 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G + G G G Sbjct: 314 GGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.9 bits (64), Expect = 3.2 Identities = 23/73 (31%), Positives = 28/73 (38%), Gaps = 3/73 (4%) Frame = +2 Query: 695 PVHSVFAQMX*LTALVS--PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXC 868 P SVFA + V+ P + +PS P P P P P+ F P Sbjct: 497 PPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPP----PSVFAPSSGV 552 Query: 869 P-PXXGPXPXPPP 904 P P P P PPP Sbjct: 553 PTPVTAPPPAPPP 565 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G G AG G G G G G Sbjct: 35 GGGGVGGGGGNGGGAG-NGVGAGGCGCGGGNDGGNGGGGAGNGG 77 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 G GG G G GG G G AG G G G + + Sbjct: 74 GNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGSDDD 118 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/31 (48%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +2 Query: 827 ASXLPAXFPPXPXC---PPXXGPXPXPPPPG 910 A + A PP P C PP P P PPPPG Sbjct: 266 AKSMAAATPP-PLCAPPPPPPPPPPPPPPPG 295 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = +2 Query: 848 FPPXPXCPPXXG--PXPXPPPPG 910 FPP P PP G P PPPPG Sbjct: 662 FPPPPPPPPGGGVPGPPKPPPPG 684 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ----XGXGGXXAGSXEAGXXG 814 GGGG G G GGQ G GG G E G G Sbjct: 58 GGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGGQG 92 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P + PP P P P P PPPP Sbjct: 286 PMTPPPAVVTAPPPAPPLPNFTSPSPPPPPP 316 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPP 907 PA P P PP P PPPP Sbjct: 884 PAVLPGLPGTPPITSPSSLPPPP 906 >SB_23052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 74 PACRTENFQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPV 202 P C T+ QHP S+ F KK + ++G K++ K P+KPV Sbjct: 191 PVCDTDGQQHPNLCSLHFQGKKLA--YKGFCKSYCK-SPTKPV 230 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G G GG+ G GG G + G G Sbjct: 208 GGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKG 239 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGP-XPXPPPPG 910 P P P PP P P GP P PP PG Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPG 130 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P +PA F P PP GP PPPP Sbjct: 365 PIIPIPPPAMPAMFNPHVP-PPMIGPVTVPPPP 396 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/50 (36%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXGXXXG 784 R + GGGG G G +GG G GG G G G G G G Sbjct: 92 RAGGYRSGGGGYG-GSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA +P P P PP G PP Sbjct: 134 PVTPPPGPETPPPPDTPAPPVPPTEAP-PTAPPTGGSCVSKPP 175 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 740 VSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 VS R + P P P PA PP P P P PPPP Sbjct: 266 VSRRYTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP G+ GG G G G G G G G Sbjct: 242 GGGMGQGPRGWGRGSGGGW--GQGPGGGWGRGQGRGMGRGPGG 282 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 28.7 bits (61), Expect = 7.5 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 5/79 (6%) Frame = +2 Query: 740 VSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXP---XCP--PXXGPXPXPPP 904 V Q S P P P P + LP PP P P P P PPP Sbjct: 667 VKENQIELVEFSSKPPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPP 726 Query: 905 PGXXRLSLTXXXXPXNPFP 961 P L P + P Sbjct: 727 PEEVSLPPPDESPPSSKHP 745 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPGXXRLSLT 931 PP P PP P P PPP LT Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRPLT 80 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 749 RQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 R + P P P P S A PP P G P PPPPG Sbjct: 325 RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGG-PPPPPPG 377 Score = 28.3 bits (60), Expect = 9.9 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP--XPPPPGXXRLSLTXXXXPX 949 P P P P S P P PP P P PPPP R + P Sbjct: 329 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 388 Query: 950 NPFP 961 P P Sbjct: 389 PPPP 392 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 749 RQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 R + P P P P S A PP P G P PPPPG Sbjct: 237 RDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGG-PPPPPPG 289 Score = 28.3 bits (60), Expect = 9.9 Identities = 19/64 (29%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP--XPPPPGXXRLSLTXXXXPX 949 P P P P S P P PP P P PPPP R + P Sbjct: 241 PLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPP 300 Query: 950 NPFP 961 P P Sbjct: 301 PPPP 304 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 854 PXPXCPPXXGPXPXPPPP 907 P P PP P P PPPP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G +GG G GG AG +G G G Sbjct: 136 GGGAAGGGGQEGG--GQGGAQAGGSTSGSSSGGATSG 170 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXX---PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 S P P P P P P PP P GP P PP G R Sbjct: 205 SQMPPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPPGAGGMR 256 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/57 (28%), Positives = 19/57 (33%), Gaps = 2/57 (3%) Frame = +2 Query: 743 SPRQXIXTXXSPSXPXXXPXXX--PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P T SP+ P P P P+ P P P P P P P P Sbjct: 30 TPTTHTPTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTPTP 86 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P PP P PP P P P PG Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPG 1381 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P PP PP GP P PP Sbjct: 2160 SPSGPS--PLGAPPSVPPPMGAPPSGPPPMGAPP-SGPPPMGTPP 2201 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -3 Query: 900 GGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXGXXXG 784 GG G G KGG G GG G G G G G G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = -3 Query: 945 GXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXE 778 G V + R GGG G G GG GG G + G G G G G + Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGD--GGGDGGGDGGGDGGGDGGGDD 486 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP P P G P PPPP Sbjct: 757 PPPPPAVPGEGARPPPPPP 775 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 G G G G +GG G G G G + G G G G G G Sbjct: 43 GSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGG 86 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/48 (31%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPP 907 +P P P P + P PP PP P P PPPP Sbjct: 279 TPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPF 958 P P P S P F PP P PPP + P PF Sbjct: 281 PPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPPF 330 >SB_12281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 869 PPXXGPXPXPPPPGXXRLS 925 PP P P PPPPG LS Sbjct: 247 PPYLPPAPPPPPPGTNLLS 265 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/60 (26%), Positives = 18/60 (30%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P P P PP P P PP R + P +P Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRYPPSP 324 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG 814 F GGGG G G GG G GG G A G Sbjct: 1758 FGGGGGGGGMGGG-GGMAGGGGGMGGGGMAAGGG 1790 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,199,129 Number of Sequences: 59808 Number of extensions: 579437 Number of successful extensions: 3293 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 1377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2411 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2860128240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -