BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P10 (968 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011339-1|AAR96131.1| 465|Drosophila melanogaster RH62603p pro... 329 4e-90 AF016835-1|AAC26144.1| 416|Drosophila melanogaster ribosomal pr... 329 4e-90 AE014297-1262|AAF54610.2| 416|Drosophila melanogaster CG4863-PA... 329 4e-90 AE014297-1265|AAF54609.1| 403|Drosophila melanogaster CG4863-PE... 318 1e-86 AE014297-1264|AAN13496.1| 403|Drosophila melanogaster CG4863-PB... 318 1e-86 AE014297-1263|AAF54612.2| 161|Drosophila melanogaster CG4863-PD... 223 2e-58 AE014297-1266|AAF54611.1| 125|Drosophila melanogaster CG4863-PC... 205 8e-53 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 38 0.027 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 38 0.027 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 38 0.027 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 38 0.027 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 38 0.027 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 38 0.027 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 38 0.027 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 37 0.036 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 37 0.036 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 37 0.036 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 37 0.036 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 37 0.036 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 37 0.036 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 37 0.036 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 37 0.036 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 37 0.048 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 37 0.048 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 37 0.048 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 37 0.048 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 36 0.063 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 36 0.063 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 36 0.063 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 36 0.063 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 36 0.063 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 36 0.084 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 36 0.084 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 36 0.084 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 36 0.11 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 36 0.11 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 36 0.11 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 36 0.11 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 36 0.11 BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p pro... 36 0.11 BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p pro... 36 0.11 AY071379-1|AAL49001.1| 288|Drosophila melanogaster RE40518p pro... 36 0.11 AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB... 36 0.11 AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA... 36 0.11 AE014297-3967|AAF56600.1| 288|Drosophila melanogaster CG5468-PA... 36 0.11 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 36 0.11 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 36 0.11 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 35 0.15 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 35 0.15 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 35 0.15 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 35 0.15 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 35 0.15 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 35 0.15 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 35 0.15 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 35 0.15 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 35 0.15 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 35 0.19 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 35 0.19 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 35 0.19 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 35 0.19 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 35 0.19 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 34 0.26 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 34 0.34 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 34 0.34 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 34 0.34 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 34 0.34 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 33 0.45 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 33 0.45 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 33 0.59 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 33 0.59 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 33 0.59 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 33 0.59 AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p pro... 33 0.59 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 33 0.59 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 33 0.59 AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA... 33 0.59 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 33 0.59 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 33 0.59 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 33 0.59 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 33 0.59 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 33 0.78 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 33 0.78 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 33 0.78 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 33 0.78 AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH0604... 33 0.78 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 33 0.78 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 33 0.78 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 33 0.78 AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA... 33 0.78 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 32 1.0 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 32 1.0 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 32 1.0 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 32 1.0 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 32 1.0 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 32 1.0 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 32 1.0 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 32 1.0 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 32 1.0 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 32 1.0 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 32 1.4 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 32 1.4 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 32 1.4 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 32 1.4 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 32 1.4 AY051830-1|AAK93254.1| 960|Drosophila melanogaster LD33689p pro... 32 1.4 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 32 1.4 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 32 1.4 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 32 1.4 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 32 1.4 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 32 1.4 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 32 1.4 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 32 1.4 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 32 1.4 AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-P... 32 1.4 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 32 1.4 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 32 1.4 AE013599-2168|AAF58070.2| 960|Drosophila melanogaster CG8405-PA... 32 1.4 AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA... 32 1.4 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 32 1.4 AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p pro... 31 1.8 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 31 1.8 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 31 1.8 AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA... 31 1.8 AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB... 31 1.8 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 31 2.4 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 31 2.4 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 31 2.4 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 31 2.4 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 31 2.4 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 31 2.4 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 31 2.4 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 31 2.4 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 31 2.4 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 31 2.4 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 31 3.1 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 31 3.1 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 31 3.1 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 31 3.1 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 31 3.1 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 31 3.1 AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p pro... 31 3.1 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 31 3.1 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 31 3.1 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 31 3.1 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 31 3.1 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 31 3.1 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 31 3.1 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 31 3.1 AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC... 31 3.1 AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB... 31 3.1 AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA... 31 3.1 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 30 4.2 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 30 4.2 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 30 4.2 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 30 4.2 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 30 4.2 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 30 4.2 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 30 4.2 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 30 4.2 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 30 4.2 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 30 4.2 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 30 4.2 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 30 4.2 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 30 4.2 AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC... 30 4.2 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 30 4.2 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 30 4.2 M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. 30 5.5 M15762-1|AAA70424.1| 50|Drosophila melanogaster unknown protei... 30 5.5 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 30 5.5 AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB... 30 5.5 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 30 5.5 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 29 7.3 AY437926-1|AAR24077.1| 924|Drosophila melanogaster AMO protein. 29 7.3 AY283154-1|AAQ18122.1| 924|Drosophila melanogaster polycystin-2... 29 7.3 AY095027-1|AAM11355.1| 1379|Drosophila melanogaster LD11664p pro... 29 7.3 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 29 7.3 AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p pro... 29 7.3 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 29 7.3 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 29 7.3 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 29 7.3 AE014298-1408|AAF46552.2| 1884|Drosophila melanogaster CG32685-P... 29 7.3 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 29 7.3 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 29 7.3 AE014134-2193|AAF53183.2| 924|Drosophila melanogaster CG6504-PA... 29 7.3 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 29 7.3 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 29 9.6 AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p pro... 29 9.6 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 29 9.6 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 29 9.6 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 29 9.6 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 29 9.6 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 29 9.6 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 29 9.6 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 29 9.6 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 29 9.6 >BT011339-1|AAR96131.1| 465|Drosophila melanogaster RH62603p protein. Length = 465 Score = 329 bits (808), Expect = 4e-90 Identities = 146/208 (70%), Positives = 168/208 (80%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F P HGSM FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGS Sbjct: 17 FSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGS 76 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 KINKKE+VEAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 77 KINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKS 136 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQL 634 W D+LG+KSIE DF M+R+C V+RVIA +Q++L++QR K AH+MEIQL Sbjct: 137 KKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQL 196 Query: 635 NGGTIQDXXKWARXHLEKPIPVHSVFAQ 718 NGG+I+D KWAR HLEKPI V +VF Q Sbjct: 197 NGGSIEDKVKWAREHLEKPIQVSNVFGQ 224 >AF016835-1|AAC26144.1| 416|Drosophila melanogaster ribosomal protein L3 protein. Length = 416 Score = 329 bits (808), Expect = 4e-90 Identities = 146/208 (70%), Positives = 168/208 (80%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F P HGSM FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGS Sbjct: 6 FSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGS 65 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 KINKKE+VEAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 66 KINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKS 125 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQL 634 W D+LG+KSIE DF M+R+C V+RVIA +Q++L++QR K AH+MEIQL Sbjct: 126 KKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQL 185 Query: 635 NGGTIQDXXKWARXHLEKPIPVHSVFAQ 718 NGG+I+D KWAR HLEKPI V +VF Q Sbjct: 186 NGGSIEDKVKWAREHLEKPIQVSNVFGQ 213 >AE014297-1262|AAF54610.2| 416|Drosophila melanogaster CG4863-PA, isoform A protein. Length = 416 Score = 329 bits (808), Expect = 4e-90 Identities = 146/208 (70%), Positives = 168/208 (80%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F P HGSM FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGS Sbjct: 6 FSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGS 65 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXX 454 KINKKE+VEAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 66 KINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKS 125 Query: 455 XXXXXXXXXXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQL 634 W D+LG+KSIE DF M+R+C V+RVIA +Q++L++QR K AH+MEIQL Sbjct: 126 KKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQL 185 Query: 635 NGGTIQDXXKWARXHLEKPIPVHSVFAQ 718 NGG+I+D KWAR HLEKPI V +VF Q Sbjct: 186 NGGSIEDKVKWAREHLEKPIQVSNVFGQ 213 >AE014297-1265|AAF54609.1| 403|Drosophila melanogaster CG4863-PE, isoform E protein. Length = 403 Score = 318 bits (780), Expect = 1e-86 Identities = 141/200 (70%), Positives = 163/200 (81%) Frame = +2 Query: 119 MGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIV 298 M FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGSKINKKE+V Sbjct: 1 MAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVV 60 Query: 299 EAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXXXXXXXXXX 478 EAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 61 EAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKA 120 Query: 479 XXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQLNGGTIQDX 658 W D+LG+KSIE DF M+R+C V+RVIA +Q++L++QR K AH+MEIQLNGG+I+D Sbjct: 121 SKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQLNGGSIEDK 180 Query: 659 XKWARXHLEKPIPVHSVFAQ 718 KWAR HLEKPI V +VF Q Sbjct: 181 VKWAREHLEKPIQVSNVFGQ 200 >AE014297-1264|AAN13496.1| 403|Drosophila melanogaster CG4863-PB, isoform B protein. Length = 403 Score = 318 bits (780), Expect = 1e-86 Identities = 141/200 (70%), Positives = 163/200 (81%) Frame = +2 Query: 119 MGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIV 298 M FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGSKINKKE+V Sbjct: 1 MAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVV 60 Query: 299 EAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWYXXXXXXXXXX 478 EAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 61 EAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKA 120 Query: 479 XXXWQDELGRKSIEKDFXXMIRHCSVVRVIAXTQMKLLQQRXKXAHIMEIQLNGGTIQDX 658 W D+LG+KSIE DF M+R+C V+RVIA +Q++L++QR K AH+MEIQLNGG+I+D Sbjct: 121 SKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIKQRQKKAHVMEIQLNGGSIEDK 180 Query: 659 XKWARXHLEKPIPVHSVFAQ 718 KWAR HLEKPI V +VF Q Sbjct: 181 VKWAREHLEKPIQVSNVFGQ 200 >AE014297-1263|AAF54612.2| 161|Drosophila melanogaster CG4863-PD, isoform D protein. Length = 161 Score = 223 bits (546), Expect = 2e-58 Identities = 97/118 (82%), Positives = 105/118 (88%) Frame = +2 Query: 95 FQHPAHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGS 274 F P HGSM FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGS Sbjct: 6 FSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGS 65 Query: 275 KINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKNWY 448 KINKKE+VEAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKNWY Sbjct: 66 KINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWY 123 >AE014297-1266|AAF54611.1| 125|Drosophila melanogaster CG4863-PC, isoform C protein. Length = 125 Score = 205 bits (500), Expect = 8e-53 Identities = 90/108 (83%), Positives = 98/108 (90%) Frame = +2 Query: 119 MGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREPDRPGSKINKKEIV 298 M FYPKKRS RHRGKVKAFPKDD SKPVHLT FIGYKAGMTH+VRE DRPGSKINKKE+V Sbjct: 1 MAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVV 60 Query: 299 EAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEXCRRRFYKN 442 EAVT++ETPPM+ VG VGYIETP GLRAL+ VWA+H+SE CRRRFYKN Sbjct: 61 EAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKN 108 >M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB, isoform B protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA, isoform A protein. Length = 1638 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD, isoform D protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC, isoform C protein. Length = 1634 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 SP+ P P P P S PA P P GP PPPPG Sbjct: 5 SPANSPMPPPQAPSPMAPPSQSPAPSPHSPYPHQQPGPLQGPPPPG 50 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 95 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 135 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 169 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 210 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 192 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 231 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 122 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 168 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 256 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 298 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 234 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 277 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 139 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 181 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 37.1 bits (82), Expect = 0.036 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P PP P PP P PPPP Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXL-PAXFPPXPXCPPXXGPXPXPPP 904 P P P P P + A PP P PP P PPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 37.1 bits (82), Expect = 0.036 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P PP P PP P PPPP Sbjct: 323 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 367 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXL-PAXFPPXPXCPPXXGPXPXPPP 904 P P P P P + A PP P PP P PPP Sbjct: 301 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 341 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 37.1 bits (82), Expect = 0.036 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P PP P PP P PPPP Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXL-PAXFPPXPXCPPXXGPXPXPPP 904 P P P P P + A PP P PP P PPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 37.1 bits (82), Expect = 0.036 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P P PP P PP P PPPP Sbjct: 356 APPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPP 400 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXL-PAXFPPXPXCPPXXGPXPXPPP 904 P P P P P + A PP P PP P PPP Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPP 374 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 37.1 bits (82), Expect = 0.036 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G G G G G G G Sbjct: 81 GGGGVGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSG 121 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GG G G GP GG G GG +G G G G G G G Sbjct: 155 GGSGIGGGPGFGGGIGGGGGHSGG--GGGIGGGPGFGGGIGGSG 196 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G GP GG G G A S G G G G G Sbjct: 178 GGGGIGGGPGFGGGIGGSGSSASS-SVGVIGGGHGGGGHGG 217 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGP--XKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G G G G G G G G G G Sbjct: 108 GGGGFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSG 154 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG G G G G G G Sbjct: 242 GGGGGGFGPGIGGGSG-GGHFGGGLSHKHKGHGGGGGFKGGYGG 284 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -3 Query: 915 FXPGGG-GXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 F PGGG G G GP GG G GG G G G G G Sbjct: 220 FGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGG 263 Score = 29.5 bits (63), Expect = 7.3 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = -3 Query: 903 GGGXGXGP--XKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G GG G G G G G G G Sbjct: 125 GGGIGDGPGFGSGGYSGGGGGIGGG--GGHSGGGSGIGGGPGFGG 167 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 36.7 bits (81), Expect = 0.048 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGEXXVXI 757 GGGG G G GG+ G GG G G G G G G +G V I Sbjct: 72 GGGGGGRGAF-GGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGGKTVTI 120 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG GG G G G G G G Sbjct: 39 GGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFG 82 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 G+ GR GGG G+ G G GGG GG G +G Sbjct: 64 GRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKG 114 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ GG G G G G G G G Sbjct: 34 GGGGGGGGGFGGGRGRGGGGDRGG--RGGFGGGRGGGGRGGGGG 75 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P Q + +P P P P P P P+ P P P P P PPP Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 35.9 bits (79), Expect = 0.084 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P GP P PPPP Sbjct: 193 PPDQPKPRPTPSRPQPPPPP--PPRPQPTPGYGPPPPPPPP 231 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +PS P P P P P PP P P G P PPPG Sbjct: 202 TPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPG 247 Score = 33.5 bits (73), Expect = 0.45 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P PA P+ PP P P P P P PG Sbjct: 147 PQTPPPRPPPQPTPSAPA---PSYGPPQPQPPAPQPPSPPSPQPG 188 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFP---PXPXCPPXXGPXPXPPPP 907 P P P P PA PA P P P PP P PPPP Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.7 bits (71), Expect = 0.78 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 3/75 (4%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPPGXX 916 P+ SP P P P P+ P P PP P P PPPP Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Query: 917 RLSLTXXXXPXNPFP 961 + T P P P Sbjct: 232 KPQPTPGYGPPTPPP 246 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = +2 Query: 776 PSXPXXXPXXXPX--PXXPASXLPAXFPPXPXCPPXXGPXPXP-----PPPGXXRLSLTX 934 P P P P P P PA PP P P P P P PPPG ++ T Sbjct: 230 PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPT- 288 Query: 935 XXXPXNPFP 961 P P P Sbjct: 289 QPQPTAPVP 297 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP--XPPPP 907 +P P P P P P + + P P PP P P P PP Sbjct: 334 APPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPP 380 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAX-FPPXPXCPPXXGPXP--XPPPP 907 P P P P P P + P + P P PP P P P PP Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPP 349 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P PP P P GP PP PG Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPG 249 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P+ P PP P PP P PPP P P Sbjct: 101 PRPPPQPTPSAPAPPPPSYGPPQTPPPRP--PPQPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Query: 956 FP 961 P Sbjct: 159 TP 160 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLP-AXFPPXPXCPPXXGPXPXPPP 904 P P P P P A PP P P P P PPP Sbjct: 91 PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP 131 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PA P + P PP P P P P Sbjct: 122 PQTPPPRPPPQPTPSAPAP--PPSYGPPQTPPPRPPPQPTPSAP 163 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXP-XCPPXXGPXPXPPP 904 P+ P P P P P P P PP GP PPP Sbjct: 84 PTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Score = 29.1 bits (62), Expect = 9.6 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 2/77 (2%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPX--PPPPG 910 L P + T P P P P PA + P P PP P P P PP Sbjct: 277 LPPPGENEVTPTQPQPTAPVPEYGPPP--PAPPAGPTYQPRPPAPPAPAPGPTYQPRPPA 334 Query: 911 XXRLSLTXXXXPXNPFP 961 + P P P Sbjct: 335 PPAPAPGPTYQPRPPSP 351 Score = 29.1 bits (62), Expect = 9.6 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 6/66 (9%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPA------XFPPXPXCPPXXGPXPXPPPPGXXRLSLTXX 937 P+ P P P PA PA PP P PP P PP P T Sbjct: 317 PAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQ 376 Query: 938 XXPXNP 955 P P Sbjct: 377 PRPPAP 382 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 36.7 bits (81), Expect = 0.048 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P Q + +P P P P P P P+ P P P P P PPP Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPP 156 Score = 35.9 bits (79), Expect = 0.084 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P PP P P GP P PPPP Sbjct: 193 PPDQPKPRPTPSRPQPPPPP--PPRPQPTPGYGPPPPPPPP 231 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +PS P P P P P PP P P G P PPPG Sbjct: 202 TPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPG 247 Score = 33.5 bits (73), Expect = 0.45 Identities = 17/45 (37%), Positives = 18/45 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P PA P+ PP P P P P P PG Sbjct: 147 PQTPPPRPPPQPTPSAPA---PSYGPPQPQPPAPQPPSPPSPQPG 188 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFP---PXPXCPPXXGPXPXPPPP 907 P P P P PA PA P P P PP P PPPP Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 32.7 bits (71), Expect = 0.78 Identities = 21/75 (28%), Positives = 24/75 (32%), Gaps = 3/75 (4%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPPGXX 916 P+ SP P P P P+ P P PP P P PPPP Sbjct: 172 PQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Query: 917 RLSLTXXXXPXNPFP 961 + T P P P Sbjct: 232 KPQPTPGYGPPTPPP 246 Score = 32.3 bits (70), Expect = 1.0 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 7/69 (10%) Frame = +2 Query: 776 PSXPXXXPXXXPX--PXXPASXLPAXFPPXPXCPPXXGPXPXP-----PPPGXXRLSLTX 934 P P P P P P PA PP P P P P P PPPG ++ T Sbjct: 230 PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPT- 288 Query: 935 XXXPXNPFP 961 P P P Sbjct: 289 QPQPTAPVP 297 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/47 (31%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP--XPPPP 907 +P P P P P P + + P P PP P P P PP Sbjct: 334 APPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPP 380 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/47 (34%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAX-FPPXPXCPPXXGPXP--XPPPP 907 P P P P P P + P + P P PP P P P PP Sbjct: 303 PPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPP 349 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P P P P PP P P GP PP PG Sbjct: 208 PPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPG 249 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P+ P PP P PP P PPP P P Sbjct: 101 PRPPPQPTPSAPAPPPPSYGPPQTPPPRP--PPQPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Query: 956 FP 961 P Sbjct: 159 TP 160 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLP-AXFPPXPXCPPXXGPXPXPPP 904 P P P P P A PP P P P P PPP Sbjct: 91 PSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP 131 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P PA P + P PP P P P P Sbjct: 122 PQTPPPRPPPQPTPSAPAP--PPSYGPPQTPPPRPPPQPTPSAP 163 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXP-XCPPXXGPXPXPPP 904 P+ P P P P P P P PP GP PPP Sbjct: 84 PTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPP 127 Score = 29.1 bits (62), Expect = 9.6 Identities = 21/77 (27%), Positives = 24/77 (31%), Gaps = 2/77 (2%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPX--PPPPG 910 L P + T P P P P PA + P P PP P P P PP Sbjct: 277 LPPPGENEVTPTQPQPTAPVPEYGPPP--PAPPAGPTYQPRPPAPPAPAPGPTYQPRPPA 334 Query: 911 XXRLSLTXXXXPXNPFP 961 + P P P Sbjct: 335 PPAPAPGPTYQPRPPSP 351 Score = 29.1 bits (62), Expect = 9.6 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 6/66 (9%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPA------XFPPXPXCPPXXGPXPXPPPPGXXRLSLTXX 937 P+ P P P PA PA PP P PP P PP P T Sbjct: 317 PAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQ 376 Query: 938 XXPXNP 955 P P Sbjct: 377 PRPPAP 382 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 36.7 bits (81), Expect = 0.048 Identities = 20/50 (40%), Positives = 22/50 (44%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGEXXVXI 757 GGGG G G GG+ G GG G G G G G G +G V I Sbjct: 65 GGGGGGRGAF-GGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKGGKTVTI 113 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 F P GGG G G GG G GG G G G G G G Sbjct: 6 FSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRG 52 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG GG G G G G G G Sbjct: 32 GGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFG 75 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = -1 Query: 926 GKXXXGRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 G+ GR GGG G+ G G GGG GG G +G Sbjct: 57 GRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKG 107 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ GG G G G G G G G Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGG--RGGFGGGRGGGGRGGGGG 68 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + A PP P PP G P PPPP Sbjct: 490 PPPPPPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 529 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P PP P P P PPPPG Sbjct: 474 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPG 519 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP-PXXGPXPXPPP 904 L A V+P P P P P P + PP P P G P PPP Sbjct: 484 LHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 Query: 905 P 907 P Sbjct: 544 P 544 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P + P PP P P P PPPP L P P P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + A PP P PP G P PPPP Sbjct: 500 PPPPPPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 539 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P PP P P P PPPPG Sbjct: 484 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPG 529 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP-PXXGPXPXPPP 904 L A V+P P P P P P + PP P P G P PPP Sbjct: 494 LHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 553 Query: 905 P 907 P Sbjct: 554 P 554 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P + P PP P P P PPPP L P P P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 525 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + A PP P PP G P PPPP Sbjct: 490 PPPPPPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 529 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P PP P P P PPPPG Sbjct: 474 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPG 519 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP-PXXGPXPXPPP 904 L A V+P P P P P P + PP P P G P PPP Sbjct: 484 LHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 543 Query: 905 P 907 P Sbjct: 544 P 544 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P + P PP P P P PPPP L P P P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + A PP P PP G P PPPP Sbjct: 648 PPPPPPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 687 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P PP P P P PPPPG Sbjct: 632 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPG 677 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP-PXXGPXPXPPP 904 L A V+P P P P P P + PP P P G P PPP Sbjct: 642 LHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 701 Query: 905 P 907 P Sbjct: 702 P 702 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P + P PP P P P PPPP L P P P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 673 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 36.3 bits (80), Expect = 0.063 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P + A PP P PP G P PPPP Sbjct: 595 PPPPPPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 634 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 +P P P P P PP P P P PPPPG Sbjct: 579 APPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPG 624 Score = 30.3 bits (65), Expect = 4.2 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = +2 Query: 728 LTALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCP-PXXGPXPXPPP 904 L A V+P P P P P P + PP P P G P PPP Sbjct: 589 LHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPP 648 Query: 905 P 907 P Sbjct: 649 P 649 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P + P PP P P P PPPP L P P P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 620 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 797 PXXXPXPXX-PASXLPAXFPPXPXC--PPXXGPXPXPPPPG 910 P P P P P PP P C PP P P PPPPG Sbjct: 36 PYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPG 76 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P P P PP P P PPP Sbjct: 40 PNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPP 79 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P PA PP P PP G P PPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPP--PPINGAAPPPPPP 300 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 T P P P P P P + PP P P P PPP Sbjct: 269 TTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPX-PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P Q + + P P P P P + PP P P G PPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 35.9 bits (79), Expect = 0.084 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 PS P P P PA PP P PP G P PPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPP--PPINGAAPPPPPP 300 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 T P P P P P P + PP P P P PPP Sbjct: 269 TTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/55 (29%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 746 PRQXIXTXXSPSXPXXXPXXXPX-PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P Q + + P P P P P + PP P P G PPPP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXG-----PXPXPPPPG 910 P P P PA P PP P PP P P PPPPG Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPG 528 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + A PP P PP G P PPPP Sbjct: 503 PPPPPPPPPPLANYGAP-PPPPPPPPGSGSAPPPPPP 538 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P + P PP P P P P PPPP Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPP 507 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXP-----XPPPP 907 P P P LPA P P PP P P PPPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPP 522 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P L P P PP G PPPP Sbjct: 500 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 536 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P P P A PP P PP G P PP PG R Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMR 576 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPP----XXGPXPXPPPPG 910 P P P P P PP P PP GP P PPPPG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG 562 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P A PP P P G P PPPP Sbjct: 500 APSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXG-----PXPXPPPPG 910 P P P PA P PP P PP P P PPPPG Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPG 623 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + A PP P PP G P PPPP Sbjct: 598 PPPPPPPPPPMANYGAP-PPPPPPPPGSGSAPPPPPP 633 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P + P PP P P P P PPPP Sbjct: 575 PHAVAPPPPPPPPPLPAFVAPPPPPPPP 602 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXP-----XPPPP 907 P P P LPA P P PP P P PPPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPP 617 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP G PPPP Sbjct: 595 PPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 631 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 5/43 (11%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXG-----PXPXPPPPG 910 P P P PA P PP P PP P P PPPPG Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPG 756 Score = 34.7 bits (76), Expect = 0.19 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + A PP P PP G P PPPP Sbjct: 731 PPPPPPPPPPMANYGAP-PPPPPPPPGSGSAPPPPPP 766 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P + P PP P P P P PPPP Sbjct: 708 PHAVAPPPPPPPPPLPAFVAPPPPPPPP 735 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXP-----XPPPP 907 P P P LPA P P PP P P PPPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPP 750 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP G PPPP Sbjct: 728 PPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 764 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P P P A PP P PP G P PP PG R Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMR 576 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPP----XXGPXPXPPPPG 910 P P P P P PP P PP GP P PPPPG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG 562 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P A PP P P G P PPPP Sbjct: 500 APSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p protein. Length = 285 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 34 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 77 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 47 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 87 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G G G G G G G Sbjct: 42 GGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLG 82 >BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p protein. Length = 279 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 28 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 71 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 41 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 81 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G G G G G G G Sbjct: 36 GGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLG 76 >AY071379-1|AAL49001.1| 288|Drosophila melanogaster RE40518p protein. Length = 288 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 34 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGSIGG 77 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G G GS G G G Sbjct: 42 GGGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGSIGGG 78 >AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB, isoform B protein. Length = 279 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 28 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 71 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 41 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 81 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G G G G G G G Sbjct: 36 GGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLG 76 >AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA, isoform A protein. Length = 285 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 34 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 77 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 47 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 87 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G G G G G G G Sbjct: 42 GGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLG 82 >AE014297-3967|AAF56600.1| 288|Drosophila melanogaster CG5468-PA protein. Length = 288 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G G GG G G GS G G G G G Sbjct: 34 FAPGSGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGSIGG 77 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G G GS G G G Sbjct: 42 GGGSIGGGSIGGGSIGGGSIGGGSIGGGSIGGSIGGG 78 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P P P A PP P PP G P PP PG R Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMR 576 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPP----XXGPXPXPPPPG 910 P P P P P PP P PP GP P PPPPG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG 562 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P A PP P P G P PPPP Sbjct: 500 APSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXR 919 P P P P P A PP P PP G P PP PG R Sbjct: 529 PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMR 576 Score = 34.3 bits (75), Expect = 0.26 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPP----XXGPXPXPPPPG 910 P P P P P PP P PP GP P PPPPG Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPG 562 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +PS P P P A PP P P G P PPPP Sbjct: 500 APSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G G G G G G G G G Sbjct: 307 GGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGG 350 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PGGGG G GG G GG G G G G G G +G Sbjct: 327 PGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQG 372 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 433 GGGGFGAG---GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 473 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXG 784 G G G R PG G G GGQ G GG G G G G G G Sbjct: 274 GGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYG 333 Query: 783 XEG 775 +G Sbjct: 334 GQG 336 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G +GG G G G G G G G Sbjct: 373 GGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGG 409 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEA-GXXGXGXXXGXXXG 784 PGGGG G G GG G GG G+ A G G G G G Sbjct: 363 PGGGGFG-GQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGG 404 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GG G G G GG G GG G G G G G Sbjct: 203 GGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGG 239 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 PGG G G GGQ G GG G G G G Sbjct: 256 PGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGG 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G +GG G G G G G G Sbjct: 403 GGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGG 435 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG AG +G G G G G G Sbjct: 174 GGGGGG-GSGYGGGSGFGGGGAGGG-SGGGGGGAGGGGGYGSGG 215 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G G GG G GG G+ A G G G G Sbjct: 297 PGGGGFG-GQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGG 340 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 911 GRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 GR GGG AP G G G GGG RGG G G Sbjct: 347 GRGGGGAPGAPGAPGSPGGGGFG-GQGGGGGFGGGGGRGGAPGAPG 391 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PG G G GGQ G GG G+ G G G G G +G Sbjct: 387 PGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 432 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PG G G GGQ G GG G G G G G G +G Sbjct: 357 PGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQG 402 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PG G G GGQ G GG AG G G G G Sbjct: 417 PGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGG 458 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GG G G G GG G GG G G G G G Sbjct: 185 GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 225 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGG G G GGQ G GG AG G G G Sbjct: 223 PGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGG 264 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G GG G G G +G Sbjct: 262 PGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQG 306 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGGG G GG G G G G G G G Sbjct: 393 PGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGG 434 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEA-GXXGXGXXXGXXXGXEG 775 PGGGG G G GG G GG G+ A G G G G G Sbjct: 423 PGGGGFG-GQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGG 467 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG GP G G GG +G G G G G G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGG 203 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGG-QXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 PGGGG G G GG G GG +G +G G G G GE Sbjct: 797 PGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGE 843 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ---XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG +G G G G G G G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 33.5 bits (73), Expect = 0.45 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G +G +G G G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWG 812 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 909 PGGGGXGXGPXKGG--QXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGGG G G GG GG G +G G G G G Sbjct: 779 PGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGG 822 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P + P PP P PP P P PPPP Sbjct: 1271 PTPPKPVAA-PVPPPPLPLTPPAAPPPPPPPPP 1302 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 PGGG G G +GG+ G GG G G G G Sbjct: 335 PGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGG-QXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 PGGGG G G GG G GG +G +G G G G GE Sbjct: 797 PGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGE 843 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ---XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG +G G G G G G G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 33.5 bits (73), Expect = 0.45 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G +G +G G G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWG 812 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 909 PGGGGXGXGPXKGG--QXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGGG G G GG GG G +G G G G G Sbjct: 779 PGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGG 822 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P + P PP P PP P P PPPP Sbjct: 1331 PTPPKPVAA-PVPPPPLPLTPPAAPPPPPPPPP 1362 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 35.1 bits (77), Expect = 0.15 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 PGGG G G +GG+ G GG G G G G Sbjct: 335 PGGGRGGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGG-QXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 PGGGG G G GG G GG +G +G G G G GE Sbjct: 797 PGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGGE 843 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ---XGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G GP GG G GG +G G G G G G G Sbjct: 771 GGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 33.5 bits (73), Expect = 0.45 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG G GP GG G +G +G G G G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWG 812 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -3 Query: 909 PGGGGXGXGPXKGG--QXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGGG G G GG GG G +G G G G G Sbjct: 779 PGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGG 822 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 35.1 bits (77), Expect = 0.15 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG G G G G G G G G G Sbjct: 379 GGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGG 422 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PGGGG G GG G GG G G G G G G +G Sbjct: 399 PGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQG 444 Score = 33.5 bits (73), Expect = 0.45 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 505 GGGGFGAG---GGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 545 Score = 32.3 bits (70), Expect = 1.0 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXG 784 G G G R PG G G GGQ G GG G G G G G G Sbjct: 346 GGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYG 405 Query: 783 XEG 775 +G Sbjct: 406 GQG 408 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G +GG G G G G G G G Sbjct: 445 GGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGG 481 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP G G GG AG G G G Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLG 94 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEA-GXXGXGXXXGXXXG 784 PGGGG G G GG G GG G+ A G G G G G Sbjct: 435 PGGGGFG-GQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGG 476 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GG G G G GG G GG G G G G G Sbjct: 275 GGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGG 311 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 PGG G G GGQ G GG G G G G Sbjct: 328 PGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGG 361 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G +GG G G G G G G Sbjct: 475 GGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGG 507 Score = 31.1 bits (67), Expect = 2.4 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG G GG AG +G G G G G G Sbjct: 246 GGGGGG-GSGYGGGSGFGGGGAGGG-SGGGGGGAGGGGGYGSGG 287 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G G GG G GG G+ A G G G G Sbjct: 369 PGGGGFG-GQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGG 412 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 911 GRXGGGXXXAPXKXGKXAXAGXXXGAXRXXXXGGGXXRGGXVGXRG 774 GR GGG AP G G G GGG RGG G G Sbjct: 419 GRGGGGAPGAPGAPGSPGGGGFG-GQGGGGGFGGGGGRGGAPGAPG 463 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PG G G GGQ G GG G+ G G G G G +G Sbjct: 459 PGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 504 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXG-XGXXXGXXXGXEG 775 PG G G GGQ G GG G G G G G G +G Sbjct: 429 PGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQG 474 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PG G G GGQ G GG AG G G G G Sbjct: 489 PGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGG 530 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GG G G G GG G GG G G G G G Sbjct: 257 GGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 297 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGG G G GGQ G GG AG G G G Sbjct: 295 PGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGG 336 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G GG G G G +G Sbjct: 334 PGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQG 378 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 PGGGG G GG G G G G G G G Sbjct: 465 PGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGG 506 Score = 29.9 bits (64), Expect = 5.5 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEA-GXXGXGXXXGXXXGXEG 775 PGGGG G G GG G GG G+ A G G G G G Sbjct: 495 PGGGGFG-GQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGG 539 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGG GP G G GG +G G G G G G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGG 275 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 F P GGG G G GG G GG G G G G G G Sbjct: 6 FSPRGGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRG 52 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = -3 Query: 906 GGGGXGXGPXKGG---QXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G +GG + G GG G G G G G Sbjct: 32 GGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRG 71 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G +GG G GG G G G G G G Sbjct: 55 GGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAGGFKG 94 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG+ GG G G G G G Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGG 67 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA P PP P PP P P PPP Sbjct: 139 PPPPPAPPTLVPPPP-PAP--PTIKPPPPPAPPTVEPPPPPPP 178 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA PP P PP P P PPP Sbjct: 150 PPPPPAPPTIKPPPP-PAPPTVEPPPPPPPAPPTVEPPPPPPP 191 Score = 34.3 bits (75), Expect = 0.26 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P PA P PP P PP P P P PP Sbjct: 126 SPRFDPPPPHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPPAPP 168 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 LV P P P P P P P + P PP P P P PPP Sbjct: 148 LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPP 202 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPPGXXRLSLTXXXXP 946 P+ P P P P P P PP P PP P PPP L P Sbjct: 165 PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 224 Query: 947 XNP 955 P Sbjct: 225 APP 227 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP---PPGXXRLSLTX 934 T P P P P P + P P P P P P PP PP + T Sbjct: 136 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 195 Query: 935 XXXPXNPFP 961 P P P Sbjct: 196 VEPPPPPAP 204 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP---PPP 907 P+ P P P P P P PP PP P P PPP Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP 133 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXF-PPXPXCPPXXGPXPXPPPP 907 T P P P P PA PA PP P P P P P PP Sbjct: 182 TVEPPPPPPPAPTKVEPPPPPA---PAEVEPPPPPAPTELEPPPPPAPP 227 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA P PP P PP P P PPP Sbjct: 402 PPPPPAPPTLVPPPP-PAP--PTIKPPPPPAPPTVEPPPPPPP 441 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA PP P PP P P PPP Sbjct: 413 PPPPPAPPTIKPPPP-PAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 34.3 bits (75), Expect = 0.26 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P PA P PP P PP P P P PP Sbjct: 389 SPRFDPPPPHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPPAPP 431 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 LV P P P P P P P + P PP P P P PPP Sbjct: 411 LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPPGXXRLSLTXXXXP 946 P+ P P P P P P PP P PP P PPP L P Sbjct: 428 PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Query: 947 XNP 955 P Sbjct: 488 APP 490 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP---PPGXXRLSLTX 934 T P P P P P + P P P P P P PP PP + T Sbjct: 399 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 458 Query: 935 XXXPXNPFP 961 P P P Sbjct: 459 VEPPPPPAP 467 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP---PPP 907 P+ P P P P P P PP PP P P PPP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP 396 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXF-PPXPXCPPXXGPXPXPPPP 907 T P P P P PA PA PP P P P P P PP Sbjct: 445 TVEPPPPPPPAPTKVEPPPPPA---PAEVEPPPPPAPTELEPPPPPAPP 490 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA P PP P PP P P PPP Sbjct: 402 PPPPPAPPTLVPPPP-PAP--PTIKPPPPPAPPTVEPPPPPPP 441 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PA PP P PP P P PPP Sbjct: 413 PPPPPAPPTIKPPPP-PAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 34.3 bits (75), Expect = 0.26 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P PA P PP P PP P P P PP Sbjct: 389 SPRFDPPPPHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPPAPP 431 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 737 LVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 LV P P P P P P P + P PP P P P PPP Sbjct: 411 LVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXC---PPXXGPXPXPPPPGXXRLSLTXXXXP 946 P+ P P P P P P PP P PP P PPP L P Sbjct: 428 PAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Query: 947 XNP 955 P Sbjct: 488 APP 490 Score = 30.7 bits (66), Expect = 3.1 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 3/69 (4%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP---PPGXXRLSLTX 934 T P P P P P + P P P P P P PP PP + T Sbjct: 399 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 458 Query: 935 XXXPXNPFP 961 P P P Sbjct: 459 VEPPPPPAP 467 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP---PPP 907 P+ P P P P P P PP PP P P PPP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPP 396 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXF-PPXPXCPPXXGPXPXPPPP 907 T P P P P PA PA PP P P P P P PP Sbjct: 445 TVEPPPPPPPAPTKVEPPPPPA---PAEVEPPPPPAPTELEPPPPPAPP 490 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/83 (26%), Positives = 29/83 (34%), Gaps = 3/83 (3%) Frame = +2 Query: 692 IPVHSVFAQMX*LTALVSPRQXIXTXXSPSXPXXX-PXXXPXPXXPASXLPAXFPPXPXC 868 I HS A + + P I +P P P P + + PP P Sbjct: 1205 ISAHSTLATAPIPKSFLHPPVPIVAAPAPPPPSQIVKVVLPGSLTPLTRMSVVLPPLPPL 1264 Query: 869 PPXX--GPXPXPPPPGXXRLSLT 931 PP P P PPPP ++T Sbjct: 1265 PPSRTSAPPPPPPPPSTKSSAIT 1287 >AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-PA protein. Length = 1895 Score = 34.3 bits (75), Expect = 0.26 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P + +PA P P PP GP P P PP Sbjct: 590 PSPVPPPAPVPA---PAPPAPPAHGPPPTPGPP 619 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 33.9 bits (74), Expect = 0.34 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 11 GGGGRGFGGGGGGR-GFGGGGGGRGGGGGRGGGGGFGRGGGGRG 53 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 F GGGG G G GG+ G GG G G G G G Sbjct: 17 FGGGGGGRGFGGGGGGRGGGGGRGGGGG-FGRGGGGRGGG 55 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAG---XXGXGXXXGXXXGXEG 775 GGGG G +GG G GG G G G G G G G Sbjct: 175 GGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGG 221 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 R+ + GGGG G G +GG G G G G G G G G Sbjct: 205 RQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNG 255 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G +GG G GG G G G G G Sbjct: 219 GGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 918 RFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 RF GGGG G G GG+ GG G G Sbjct: 244 RFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 275 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ GG G+ G G G G Sbjct: 231 GGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 R+ + GGGG G G +GG G G G G G G G G Sbjct: 167 RQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNG 217 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G +GG G GG G G G G G Sbjct: 181 GGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 221 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 918 RFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 RF GGGG G G GG+ GG G G Sbjct: 206 RFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 237 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ GG G+ G G G G Sbjct: 193 GGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 236 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/51 (33%), Positives = 20/51 (39%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 R+ + GGGG G G +GG G G G G G G G G Sbjct: 205 RQNNWNKGGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNG 255 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G +GG G GG G G G G G Sbjct: 219 GGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGG 259 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 918 RFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG 823 RF GGGG G G GG+ GG G G Sbjct: 244 RFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGG 275 Score = 29.1 bits (62), Expect = 9.6 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ GG G+ G G G G Sbjct: 231 GGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGG 274 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 33.5 bits (73), Expect = 0.45 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXA--GSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GGQ G GG G G G G G G G Sbjct: 34 GGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHG 79 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 33.5 bits (73), Expect = 0.45 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 A PP P PP P P PPPP + P P Sbjct: 70 AKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P + LP PP P PP P P P PPG Sbjct: 68 PKAKLPPPPPPPPPPPPPPPP-PPPSPPG 95 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G GG G G G G G G G Sbjct: 77 PGGGFGGQGGGFGGQGGFGGGGFGGRPGG--GFGGPGGGFGGPGG 119 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G G G G G G G G Sbjct: 56 PGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P+ P P P PA PA P P PP P PPPP Sbjct: 166 APAAPKAAPAPAAAPK-PAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P A PP P PP P P PP P Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPPP-PPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP P PPPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPP 197 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P+ P P P PA PA P P PP P PPPP Sbjct: 166 APAAPKAAPAPAAAPK-PAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P A PP P PP P P PP P Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPPP-PPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP P PPPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPP 197 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +2 Query: 737 LVSPRQXIXTXX---SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 L+SP++ + +P+ P P P P P PP P P PPPP Sbjct: 431 LLSPKKTLNASGFDFTPAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Query: 908 G 910 G Sbjct: 491 G 491 >AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p protein. Length = 286 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G GG G G GS G G G G G Sbjct: 34 FAPGSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 77 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 47 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 87 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +2 Query: 737 LVSPRQXIXTXX---SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 L+SP++ + +P+ P P P P P PP P P PPPP Sbjct: 613 LLSPKKTLNASGFDFTPAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Query: 908 G 910 G Sbjct: 673 G 673 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G GG G G G G G G G Sbjct: 77 PGGGFGGQGGGFGGQGGFGGGGFGGRPGG--GFGGPGGGFGGPGG 119 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G G G G G G G G Sbjct: 56 PGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 >AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA protein. Length = 286 Score = 33.1 bits (72), Expect = 0.59 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 F PG G G GG G G GS G G G G G Sbjct: 34 FAPGSGSISGGSIGGGSIGGGSIGGGSIGGGLIGGGSIGGGSIG 77 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG G G GS G G G G G Sbjct: 47 GGGSIGGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGG 87 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 33.1 bits (72), Expect = 0.59 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G GG G G G G G G G Sbjct: 77 PGGGFGGQGGGFGGQGGFGGGGFGGRPGG--GFGGPGGGFGGPGG 119 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGG G G GGQ G G G G G G G G Sbjct: 56 PGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFG 100 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 33.1 bits (72), Expect = 0.59 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P+ P P P PA PA P P PP P PPPP Sbjct: 166 APAAPKAAPAPAAAPK-PAPPPPAAGAPKPPPPPPPKAAPRPPPP 209 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P A PP P PP P P PP P Sbjct: 176 PAAAPKPAPPPPAAGAPKPPPPP-PPKAAPRPPPPAP 211 Score = 29.9 bits (64), Expect = 5.5 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P + P P PP P PPPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPP 197 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +2 Query: 737 LVSPRQXIXTXX---SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 L+SP++ + +P+ P P P P P PP P P PPPP Sbjct: 613 LLSPKKTLNASGFDFTPAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Query: 908 G 910 G Sbjct: 673 G 673 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 33.1 bits (72), Expect = 0.59 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 3/61 (4%) Frame = +2 Query: 737 LVSPRQXIXTXX---SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 L+SP++ + +P+ P P P P P PP P P PPPP Sbjct: 613 LLSPKKTLNASGFDFTPAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 672 Query: 908 G 910 G Sbjct: 673 G 673 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P+ P P P P + P P P P P PPPP Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P+ P P P P + P P P P P PPPP Sbjct: 46 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 93 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 648 GGGGRGGGGGFGGR-GGGGRGGGGGFGGRGGGGRGGGGFGGRGG 690 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G G G G G G G Sbjct: 662 GGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG G G G +G G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH06048 protein. Length = 377 Score = 32.7 bits (71), Expect = 0.78 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS--LTXXXXPX 949 P P P P P+ P+ P P P GP P P PG P Sbjct: 155 PIRPGGLFPGGPSPGGPSPGEPSPGEPSPGGPSPGGPSPGGPSPGGPSPGGPSPGGPSPG 214 Query: 950 NPFPXG 967 PFP G Sbjct: 215 GPFPGG 220 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 648 GGGGRGGGGGFGGR-GGGGRGGGGGFGGRGGGGRGGGGFGGRGG 690 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G G G G G G G Sbjct: 662 GGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 32.7 bits (71), Expect = 0.78 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G GG G G G G G G G Sbjct: 648 GGGGRGGGGGFGGR-GGGGRGGGGGFGGRGGGGRGGGGFGGRGG 690 Score = 30.3 bits (65), Expect = 4.2 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G G G G G G G Sbjct: 662 GGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGG 698 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 32.7 bits (71), Expect = 0.78 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 764 TXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 T +P+ P P P P + P P P P P PPPP Sbjct: 28 TPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPP 75 >AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA protein. Length = 377 Score = 32.7 bits (71), Expect = 0.78 Identities = 20/66 (30%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLS--LTXXXXPX 949 P P P P P+ P+ P P P GP P P PG P Sbjct: 155 PIRPGGLFPGGPSPGGPSPGEPSPGEPSPGGPSPGGPSPGGPSPGGPSPGGPSPGGPSPG 214 Query: 950 NPFPXG 967 PFP G Sbjct: 215 GPFPGG 220 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 532 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 591 Query: 956 FPXG 967 P G Sbjct: 592 GPPG 595 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 554 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 606 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P PAS + P P PP P PPPPG Sbjct: 698 PPPPMPASPTASSAAPPP--PPPPAPPAPPPPPG 729 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSL 928 P P P P + A PP P PP P P P G SL Sbjct: 697 PPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSL 740 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P+ L + P P PP PPPP Sbjct: 720 APPAPPPPPGFSPL-GSPSGSLASTAPSPPHAPPMLSSFQPPPPP 763 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 148 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 207 Query: 956 FPXG 967 P G Sbjct: 208 GPPG 211 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 170 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 222 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GGQ G GG + G G G Sbjct: 34 GGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GGQ G GG + G G G Sbjct: 34 GGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGG 66 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 32.3 bits (70), Expect = 1.0 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GGGG G G K G G GG G + G G G G G G+ Sbjct: 26 GGGGQG-GWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGK 69 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 915 FXPGGGGXGXGPXKGGQXGXGGXXAGSXEAG-XXGXGXXXGXXXGXEG 775 F GGG G G +GG GG G + G G G G G G Sbjct: 17 FVSAGGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGG 64 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = -3 Query: 900 GGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEGE 772 GG G G +GG GG G G G G G G G+ Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGK 79 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGG-XXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G KGG G GG G G G G G G G Sbjct: 40 GGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGG 84 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGG G G GG+ G GG G G G G G G Sbjct: 56 GGGKHGGGGGGGGKHG-GGNGGGGKHGGGGGGGGGGGKHGG 95 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 562 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 621 Query: 956 FPXG 967 P G Sbjct: 622 GPPG 625 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 584 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 636 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 562 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 621 Query: 956 FPXG 967 P G Sbjct: 622 GPPG 625 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 584 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 636 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 148 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 207 Query: 956 FPXG 967 P G Sbjct: 208 GPPG 211 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 170 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 222 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNP 955 P P P P P PP P P GP P P G R P P Sbjct: 148 PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRP 207 Query: 956 FPXG 967 P G Sbjct: 208 GPPG 211 Score = 31.1 bits (67), Expect = 2.4 Identities = 20/57 (35%), Positives = 20/57 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFPXG 967 P P P P P PP P P GP P PPG R P P P G Sbjct: 170 PPGPPGPTRPGPYGPPG-PPGPTGPTRPGP---PGPPGPTRPGPPGPPGPTRPGPPG 222 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGP-XPXP-PPPG 910 P P P P P P PP P PP P P P PPPG Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPG 262 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXP--XCPPXXGPXPXPPPPG 910 +P P P P P P P P P PP P P PP G Sbjct: 151 APPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKG 198 Score = 29.1 bits (62), Expect = 9.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPG 910 PP P PP GP P PPG Sbjct: 212 PPGPPGPPGTGPPGPPGPPG 231 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPPG 910 P +PP P P P P PPPPG Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPPPG 106 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P PA P P P PP P PPPPG Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPG 112 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP 898 P P P P P P PP P PP GP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 R+ + GGGG G G GG+ G GG G G G G Sbjct: 206 RQNNWNKGGGGGGGG---GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGS--XEAGXXGXGXXXGXXXGXEGE 772 GGGG G G GG+ GG G G G G G +G+ Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGD 278 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPPG 910 P +PP P P P P PPPPG Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPPPG 136 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P PA P P P PP P PPPPG Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPG 142 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP 898 P P P P P P PP P PP GP P Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G GG G GG G G G G G Sbjct: 62 GGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGG 98 >AY051830-1|AAK93254.1| 960|Drosophila melanogaster LD33689p protein. Length = 960 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGG G G GGQ G GG G AG Sbjct: 501 GGGAGAGAAAGGQQGDGGAGGGGIGAG 527 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 PS P P P P P P P P P P PPP Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 681 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P P P PPPP Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPP 678 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G GG G GG G G G G G Sbjct: 37 GGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGG 73 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 R+ + GGGG G G GG+ G GG G G G G Sbjct: 206 RQNNWNKGGGGGGGG---GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGS--XEAGXXGXGXXXGXXXGXEGE 772 GGGG G G GG+ GG G G G G G +G+ Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGD 278 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 31.9 bits (69), Expect = 1.4 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = -3 Query: 927 REXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 R+ + GGGG G G GG+ G GG G G G G Sbjct: 206 RQNNWNKGGGGGGGG---GGRGGFGGRRGGGGGGGGGGGG 242 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGS--XEAGXXGXGXXXGXXXGXEGE 772 GGGG G G GG+ GG G G G G G +G+ Sbjct: 232 GGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPRDGD 278 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 PS P P P P P P P P P P PPP Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 821 Score = 29.5 bits (63), Expect = 7.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P P P P P PPPP Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPP 818 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGP-XPXP-PPPG 910 P P P P P P PP P PP P P P PPPG Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPG 264 Score = 29.9 bits (64), Expect = 5.5 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXP--XCPPXXGPXPXPPPPG 910 +P P P P P P P P P PP P P PP G Sbjct: 153 APPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKG 200 Score = 29.1 bits (62), Expect = 9.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPPG 910 PP P PP GP P PPG Sbjct: 214 PPGPPGPPGTGPPGPPGPPG 233 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPPG 910 P +PP P P P P PPPPG Sbjct: 113 PPAYPPPPQRPWGPPPPPGPPPPG 136 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P PA P P P PP P PPPPG Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPG 142 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP 898 P P P P P P PP P PP GP P Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPPG 910 P +PP P P P P PPPPG Sbjct: 83 PPAYPPPPQRPWGPPPPPGPPPPG 106 Score = 29.9 bits (64), Expect = 5.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P PA P P P PP P PPPPG Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPG 112 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXP 898 P P P P P P PP P PP GP P Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 >AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-PA protein. Length = 1701 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPXNPFP 961 P P P P +P PP P P P PP P ++LT P P Sbjct: 1630 PLPLPWPPLPLPEIPLPLPPLPTALPPL--PPLPPLPPLPEVNLTAISLPEISLP 1682 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 Query: 839 PAXFPPXPXCPPXXGPXPXPPPPGXXRL 922 P PP P PP P P PPPP R+ Sbjct: 467 PPPPPPPPPPPPPTEPPPPPPPPPEPRV 494 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P PP P PP P P PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 824 PASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P +PP P PP P P PPP Sbjct: 187 PPPPPPPYYPPYPYYPPPPPPPPLPPP 213 >AE013599-2168|AAF58070.2| 960|Drosophila melanogaster CG8405-PA protein. Length = 960 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAG 823 GGG G G GGQ G GG G AG Sbjct: 501 GGGAGAGAAAGGQQGDGGAGGGGIGAG 527 >AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA protein. Length = 113 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXE-AGXXGXGXXXGXXXGXEG 775 G GG G GP GGQ G GG G E G G G G G G Sbjct: 37 GQGGFGGGPGFGGQGGFGG---GPGEYGGQGGFGGGPGGYGGQGG 78 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP G G GG AG G G G Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLG 94 >AY122174-1|AAM52686.1| 877|Drosophila melanogaster LD34142p protein. Length = 877 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P S P P P P GP P PPP Sbjct: 241 PQTNPWSVLPPSKQPQQPQPPPVSAPGRGPGPLPPP 276 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P+ LP P PP P P P PP Sbjct: 304 PPPASPSPSLPPPASPSLSLPPPASPSPSPSPP 336 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P+ P P P P P PPPP Sbjct: 305 PPASPSPSLPPPASPSLSLPPPASP---SPSPSPPPP 338 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P+ LP P PP P P P PP Sbjct: 2571 PPPASPSPSLPPPASPSLSLPPPASPSPSPSPP 2603 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P+ P P P P P PPPP Sbjct: 2572 PPASPSPSLPPPASPSLSLPPPASP---SPSPSPPPP 2605 >AE014296-2433|AAF49702.1| 2061|Drosophila melanogaster CG9425-PA, isoform A protein. Length = 2061 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P S P P P P GP P PPP Sbjct: 1425 PQTNPWSVLPPSKQPQQPQPPPVSAPGRGPGPLPPP 1460 >AE014296-2432|AAS65008.1| 2103|Drosophila melanogaster CG9425-PB, isoform B protein. Length = 2103 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P S P P P P GP P PPP Sbjct: 1467 PQTNPWSVLPPSKQPQQPQPPPVSAPGRGPGPLPPP 1502 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 585 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 623 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 546 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 584 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 930 VREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 V + F GGGG G G GG GG G G G G Sbjct: 13 VAQAGFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGG 53 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 391 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 429 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 546 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 584 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 585 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 623 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 779 SXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPP 901 S P P P P P+ PP P PP G P PP Sbjct: 887 SPPPAPPMLKAIPPPPPPMAPSMMPPPP--PPCPGAPPPPP 925 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 31.1 bits (67), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Frame = +2 Query: 785 PXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP-----XPPPPGXXR 919 P P P P P + P PP PP P P PPPP R Sbjct: 229 PPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPR 278 Score = 30.3 bits (65), Expect = 4.2 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPX-PXCPPXXGPXPXPPPP 907 P+ P P P P P + P PP PP P PPPP Sbjct: 190 PTRPPTRPPTRP-PTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPP 233 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 930 VREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 V + F GGGG G G GG GG G G G G Sbjct: 13 VAQAGFIGGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGG 53 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 31.1 bits (67), Expect = 2.4 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G +GG GG AG G G G G G G Sbjct: 189 GGGGRGGGGGRGGGGFRGG--AGRNGGGGGGGGFNRGRGGGGGG 230 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G GG G G G G G Sbjct: 22 GGGGRGFGGGGGGRGGGGGRGGGGG-FGRGGGGRGGG 57 Score = 30.3 bits (65), Expect = 4.2 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG-GXXAGSXEAGXXGXGXXXGXXXGXEG 775 GGGG G G GG+ G G G G G G G G G Sbjct: 175 GGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGG 219 Score = 29.5 bits (63), Expect = 7.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -3 Query: 906 GGGGXGXGPXKGGQ-XGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G +GG GG G G G G G Sbjct: 195 GGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGG 232 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +PP PP P P PPPP Sbjct: 207 PTPGAYYPPPPPFYPPYYGYPPYYPPYPYPPPP 239 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G G + G G G G G G Sbjct: 26 PGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G G + G G G G G G Sbjct: 26 PGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G AG G G Sbjct: 95 GGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG GG A + G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G G GG+ G GG G G G G G Sbjct: 22 GGGGRGFGGGGGGRGGGGGRGGGGG-FGRGGGGRGGG 57 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P A P P PP G PPPP Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P PA PA PP P P G PPPP Sbjct: 371 SPPPPTAASVGVPPPP-PAP--PAGVPPAPPPMPVFGAGGAPPPP 412 >AY052101-1|AAK93525.1| 607|Drosophila melanogaster SD04973p protein. Length = 607 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP PP GP P PPPP Sbjct: 100 PPYGRYPPTGGPPPGPPPP 118 >AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 protein. Length = 148 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG G GG +GS + G G Sbjct: 51 GGGGGGGG---GGSGGGGGGGSGSGDGGGGAIG 80 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G G + G G G G G G Sbjct: 26 PGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG+ G G AG G G Sbjct: 95 GGGGGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG GG A + G G G Sbjct: 93 GGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 GGGG G G GG G GG +G G G G G G Sbjct: 58 GGGGGGGGWSSGGGGGGGGWSSG---GGGGGGGWSSGGGGG 95 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXG 808 GGGG G G GG G GG +G G G Sbjct: 69 GGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGG 101 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXGXEG 775 PGGGG G GG G G + G G G G G G Sbjct: 26 PGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG 70 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P A P P PP G PPPP Sbjct: 383 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P PA PA PP P P G PPPP Sbjct: 371 SPPPPTAASVGVPPPP-PAP--PAGVPPAPPPMPVFGAGGAPPPP 412 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P P A P P PP G PPPP Sbjct: 499 PPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SP P P P PA PA PP P P G PPPP Sbjct: 487 SPPPPTAASVGVPPPP-PAP--PAGVPPAPPPMPVFGAGGAPPPP 528 >AE013599-3005|AAF57474.1| 567|Drosophila melanogaster CG8929-PC, isoform C protein. Length = 567 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP PP GP P PPPP Sbjct: 60 PPYGRYPPTGGPPPGPPPP 78 >AE013599-3004|AAF57475.2| 607|Drosophila melanogaster CG8929-PB, isoform B protein. Length = 607 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP PP GP P PPPP Sbjct: 100 PPYGRYPPTGGPPPGPPPP 118 >AE013599-3003|AAF57473.2| 607|Drosophila melanogaster CG8929-PA, isoform A protein. Length = 607 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 851 PPXPXCPPXXGPXPXPPPP 907 PP PP GP P PPPP Sbjct: 100 PPYGRYPPTGGPPPGPPPP 118 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P + PA PP P P G P PP G Sbjct: 280 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMG 313 >X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. Length = 196 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G GL G + GGG G G GG GG G +G G G G Sbjct: 55 GGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P + PA PP P P G P PP G Sbjct: 261 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMG 294 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 909 PG-GGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXG 796 PG GGG G GP GG G GG G G G G G Sbjct: 25 PGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGG 65 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXGXXXG 784 P GGG G GP GG G GG G G G G G Sbjct: 35 PYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGG 78 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G GL G + GGG G G GG GG G +G G G G Sbjct: 55 GGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G G G +G G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G G G +G G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -3 Query: 903 GGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGG G G GG G G G +G G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 >AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. Length = 2715 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +PP P PP PPPP Sbjct: 650 PQQPQQYPPGNYPPRPQYPPGAYATGPPPPP 680 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G GL G + GGG G G GG GG G +G G G G Sbjct: 55 GGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 113 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXGXXXG 784 G GL G + GGG G G GG GG G +G G G G Sbjct: 112 GGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGG 170 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 30.3 bits (65), Expect = 4.2 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 809 PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPG 910 P P + PA PP P P G P PP G Sbjct: 261 PPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMG 294 >AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB, isoform B protein. Length = 2716 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +PP P PP PPPP Sbjct: 651 PQQPQQYPPGNYPPRPQYPPGAYATGPPPPP 681 >AE014297-2397|AAS65166.1| 2556|Drosophila melanogaster CG7467-PC, isoform C protein. Length = 2556 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +PP P PP PPPP Sbjct: 651 PQQPQQYPPGNYPPRPQYPPGAYATGPPPPP 681 >AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA, isoform A protein. Length = 2703 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P +PP P PP PPPP Sbjct: 651 PQQPQQYPPGNYPPRPQYPPGAYATGPPPPP 681 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 30.3 bits (65), Expect = 4.2 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = -3 Query: 909 PG-GGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXG 796 PG GGG G GP GG G GG G G G G G Sbjct: 25 PGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGG 65 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = -3 Query: 909 PGGGGXGXGPXKGGQXG--XGGXXAGSXEAGXXGXGXXXGXXXG 784 P GGG G GP GG G GG G G G G G Sbjct: 35 PYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGG 78 >M23221-1|AAA28540.1| 2038|Drosophila melanogaster fsh protein. Length = 2038 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 903 GGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP GG GG A S G G G Sbjct: 1822 GGGGGSGPASAGGPNSGGGGTANSNSGGGGGGG 1854 >M15762-1|AAA70424.1| 50|Drosophila melanogaster unknown protein protein. Length = 50 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 903 GGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP GG GG A S G G G Sbjct: 11 GGGGGSGPASAGGPNSGGGGTANSNSGGGGGGG 43 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +2 Query: 776 PSXPXXXPXXX--PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPX 949 P+ P P P P P + P P P P P PPPP L + P Sbjct: 184 PAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPP 243 Query: 950 NP 955 P Sbjct: 244 PP 245 >AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB, isoform B protein. Length = 2038 Score = 29.9 bits (64), Expect = 5.5 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = -3 Query: 903 GGGXGXGPXK-GGQXGXGGXXAGSXEAGXXGXG 808 GGG G GP GG GG A S G G G Sbjct: 1822 GGGGGSGPASAGGPNSGGGGTANSNSGGGGGGG 1854 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 29.9 bits (64), Expect = 5.5 Identities = 18/62 (29%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = +2 Query: 776 PSXPXXXPXXX--PXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPPGXXRLSLTXXXXPX 949 P+ P P P P P + P P P P P PPPP L + P Sbjct: 184 PAKPYPYPDLAAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPPPPP 243 Query: 950 NP 955 P Sbjct: 244 PP 245 >BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p protein. Length = 195 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PP P P PPP Sbjct: 28 PLYPPGYYPIYALPPPQGPPYPAPPPPPPP 57 >AY437926-1|AAR24077.1| 924|Drosophila melanogaster AMO protein. Length = 924 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P P P P P PPPP Sbjct: 10 SPSGPPGPPPPRP-PKTPPGASPRGTPTADSTPGDVTPARGPPPP 53 >AY283154-1|AAQ18122.1| 924|Drosophila melanogaster polycystin-2 protein. Length = 924 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P P P P P PPPP Sbjct: 10 SPSGPPGPPPPRP-PKTPPGASPRGTPTADSTPGDVTPARGPPPP 53 >AY095027-1|AAM11355.1| 1379|Drosophila melanogaster LD11664p protein. Length = 1379 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPP 907 A PP P PP P PPPP Sbjct: 15 AALPPQPSVPPPLPDAPPPPPP 36 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG---GXXAGSXEAGXXGXGXXXGXXXG 784 GG G G GP GG+ G G G G G G G G G Sbjct: 52 GGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGG 95 >AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p protein. Length = 174 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG---GXXAGSXEAGXXGXGXXXGXXXG 784 GG G G GP GG+ G G G G G G G G G Sbjct: 52 GGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGG 95 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 29.5 bits (63), Expect = 7.3 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPP 907 P P P P P PA P PP P P GP P PPPP Sbjct: 129 PPPPKPAPQYGPPPQ-PA---PQYGPPPPKPAPQYGPPPTQYGPPPP 171 >AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p protein. Length = 1024 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G GG+ GG G G G G G Sbjct: 846 GGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGGPG 882 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 29.5 bits (63), Expect = 7.3 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 776 PSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXP---XPPPP 907 P P P P P PA P PP P P GP P PPPP Sbjct: 129 PPPPKPAPQYGPPPQ-PA---PQYGPPPPKPAPQYGPPPTQYGPPPP 171 >AE014298-1408|AAF46552.2| 1884|Drosophila melanogaster CG32685-PC protein. Length = 1884 Score = 29.5 bits (63), Expect = 7.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 842 AXFPPXPXCPPXXGPXPXPPPP 907 A PP P PP P PPPP Sbjct: 15 AALPPQPSVPPPLPDAPPPPPP 36 >AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-PA protein. Length = 1024 Score = 29.5 bits (63), Expect = 7.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXGGXXAGSXEAGXXGXGXXXG 796 GGGG G GG+ GG G G G G G Sbjct: 846 GGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGGPG 882 >AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA protein. Length = 575 Score = 29.5 bits (63), Expect = 7.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 815 PXXPASXLPAXFPPXPXCPPXXGPXPXPPP 904 P P P P P PP P P PPP Sbjct: 28 PLYPPGYYPIYALPPPQGPPYPAPPPPPPP 57 >AE014134-2193|AAF53183.2| 924|Drosophila melanogaster CG6504-PA protein. Length = 924 Score = 29.5 bits (63), Expect = 7.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 SPS P P P P P P P P P PPPP Sbjct: 10 SPSGPPGPPPPRP-PKTPPGASPRGTPTADSTPGDVTPARGPPPP 53 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 29.5 bits (63), Expect = 7.3 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = -3 Query: 906 GGGGXGXGPXKGGQXGXG---GXXAGSXEAGXXGXGXXXGXXXG 784 GG G G GP GG+ G G G G G G G G G Sbjct: 52 GGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGG 95 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 TA +P P P P PAS +PA P PP P P P Sbjct: 345 TAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTP 403 >AY089613-1|AAL90351.1| 798|Drosophila melanogaster RE28061p protein. Length = 798 Score = 29.1 bits (62), Expect = 9.6 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 7/66 (10%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXG---PXKGGQXGXGGXXA----GSXEAGXXGXGXX 802 G G G R+ R GGGG G P GG GG + G+ G G G Sbjct: 708 GSGRYGGGFGSRDYRQSSGGGGGGRSGPPPRSGGSGSGGGGGSYRSNGNSYGGNSGGGGY 767 Query: 801 XGXXXG 784 G G Sbjct: 768 YGGGAG 773 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 TA +P P P P PAS +PA P PP P P P Sbjct: 53 TAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTP 111 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 TA +P P P P PAS +PA P PP P P P Sbjct: 345 TAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTP 403 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 TA +P P P P PAS +PA P PP P P P Sbjct: 345 TAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTP 403 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 29.1 bits (62), Expect = 9.6 Identities = 17/59 (28%), Positives = 19/59 (32%) Frame = +2 Query: 731 TALVSPRQXIXTXXSPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 TA +P P P P PAS +PA P PP P P P Sbjct: 345 TAAAAPVTRSEEAVKPPTQPGQPAATPAGQEPASAVPAPAAPPKETPPAVKPATLNPTP 403 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 29.1 bits (62), Expect = 9.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 797 PXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 P P P P PP P PP G PP P Sbjct: 541 PGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGP 577 >AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA protein. Length = 798 Score = 29.1 bits (62), Expect = 9.6 Identities = 21/66 (31%), Positives = 24/66 (36%), Gaps = 7/66 (10%) Frame = -3 Query: 960 GXGLXGXXXXVREXRFXPGGGGXGXG---PXKGGQXGXGGXXA----GSXEAGXXGXGXX 802 G G G R+ R GGGG G P GG GG + G+ G G G Sbjct: 708 GGGRYGGGFGSRDYRQSSGGGGGGRSGPPPRSGGSGSGGGGGSYRSNGNSYGGNSGGGGY 767 Query: 801 XGXXXG 784 G G Sbjct: 768 YGGGAG 773 >AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-PB, isoform B protein. Length = 1155 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P+ L + P P PP PPPP Sbjct: 612 APPAPPPPPGFSPL-GSPSGSLASTAPSPPHAPPMLSSFQPPPPP 655 >AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-PA, isoform A protein. Length = 1165 Score = 29.1 bits (62), Expect = 9.6 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 773 SPSXPXXXPXXXPXPXXPASXLPAXFPPXPXCPPXXGPXPXPPPP 907 +P P P P P+ L + P P PP PPPP Sbjct: 612 APPAPPPPPGFSPL-GSPSGSLASTAPSPPHAPPMLSSFQPPPPP 655 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,909,319 Number of Sequences: 53049 Number of extensions: 931223 Number of successful extensions: 8473 Number of sequences better than 10.0: 229 Number of HSP's better than 10.0 without gapping: 3252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6489 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4853571111 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -