BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P09 (934 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 27 0.61 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 27 0.81 DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. 26 1.4 AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding pr... 25 4.3 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 7.6 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 27.5 bits (58), Expect = 0.61 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 722 GXPXGPXPXPPPXXVXXXXRXTPXPPHTPAXXXPTPPLXP 841 G P GP P PPP PP P PL P Sbjct: 525 GGPLGPPPPPPPGGAVLNIPPQFLPPPLNLLRAPFFPLNP 564 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 27.1 bits (57), Expect = 0.81 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +2 Query: 722 GXPXGPXPXPPPXXVXXXXRXTPXPPH--TPAXXXPTPPLXP 841 G P GP PP V TP P P P PP P Sbjct: 184 GMPPGPQMMRPPGNVGPPRTGTPTQPQPPRPGGMYPQPPGVP 225 >DQ182013-1|ABA56305.1| 75|Anopheles gambiae G(alpha)c protein. Length = 75 Score = 26.2 bits (55), Expect = 1.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 114 YIDEFGQTTTRMQ*KKCFICEICDAIALFVT 206 ++D GQ T R + KCF C + + L T Sbjct: 13 FVDVGGQRTQRQKWTKCFDCSVTSILFLVST 43 >AY146716-1|AAO12076.1| 159|Anopheles gambiae odorant-binding protein AgamOBP12 protein. Length = 159 Score = 24.6 bits (51), Expect = 4.3 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = -3 Query: 461 LRYPLILWITVLPPLSELIP 402 +RY +LW+ +L +S L+P Sbjct: 4 VRYHFVLWLLILIGVSSLVP 23 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 7.6 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -3 Query: 194 SNSITNFTNKAFFSLHS 144 SN+I NFT KAF L S Sbjct: 520 SNNIENFTRKAFKDLPS 536 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 665,530 Number of Sequences: 2352 Number of extensions: 12045 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 101708946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -