BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P08 (926 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 2.6 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 2.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 5.9 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 5.9 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 7.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 7.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 7.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 7.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 7.8 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 7.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 7.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 7.8 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -2 Query: 628 LQVVVLIF-KYWLYLVL 581 LQV+ + F YWLYLVL Sbjct: 49 LQVLFVSFVSYWLYLVL 65 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/17 (64%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -2 Query: 628 LQVVVLIF-KYWLYLVL 581 LQV+ + F YWLYLVL Sbjct: 67 LQVLFVSFVSYWLYLVL 83 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 5.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 73 APNKMKLLVVFAMCMLAASA 132 APN + VV+A C L A+A Sbjct: 123 APNGHQTQVVYASCKLQAAA 142 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 598 WLYLVLWILKYTLLFSHKVMNFQLTSSV 515 W L WI+ YTL +VM Q + V Sbjct: 161 WRCLYRWIVLYTLSKMSQVMLIQFCAFV 188 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -2 Query: 646 RSRXLQLQVVVLIFKYWLYLVLWILKYTLLFSHKVMNFQLT 524 R+ + L +V +F Y++YL Y + ++NF T Sbjct: 134 RNDYVSLLQLVFVFCYFIYLFTVYYIYYSVHEASIINFGYT 174 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 634 LQLQVVVLIFKYWLYLVLWILKYTLLF 554 LQL+ + L+F ++ L+L I +LF Sbjct: 1321 LQLEPIGLVFVFFFALILVIQFVAMLF 1347 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 634 LQLQVVVLIFKYWLYLVLWILKYTLLF 554 LQL+ + L+F ++ L+L I +LF Sbjct: 1321 LQLEPIGLVFVFFFALILVIQFVAMLF 1347 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 634 LQLQVVVLIFKYWLYLVLWILKYTLLF 554 LQL+ + L+F ++ L+L I +LF Sbjct: 1321 LQLEPIGLVFVFFFALILVIQFVAMLF 1347 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 634 LQLQVVVLIFKYWLYLVLWILKYTLLF 554 LQL+ + L+F ++ L+L I +LF Sbjct: 1321 LQLEPIGLVFVFFFALILVIQFVAMLF 1347 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 69 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 7.8 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = +1 Query: 397 HGRKLCQDHLQKLQPRSEARFHNQSLXMRELPTAMV*TSILNSSVGSSLP 546 HG + +LQP+ A H QS + P+A + SS G + P Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASP 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,881 Number of Sequences: 336 Number of extensions: 3095 Number of successful extensions: 24 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 25961683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -