BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P08 (926 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 34 0.14 03_01_0515 - 3864796-3865425 34 0.14 12_02_1174 - 26696869-26698191 32 0.74 09_02_0543 + 10427321-10428315,10428440-10429154 31 0.98 02_05_0686 - 30900748-30902167,30903442-30904742 31 0.98 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 31 0.98 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.3 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 31 1.7 08_01_0059 - 394001-394708 30 2.3 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 30 3.0 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 4.0 12_02_0299 - 17051570-17052474,17053542-17053755 29 5.2 06_03_0426 + 20667639-20667938 29 5.2 07_01_0862 - 7172083-7172931 29 6.9 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 28 9.2 04_04_1263 - 32207636-32207938,32208020-32208170,32208263-322085... 28 9.2 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 755 IPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 +P P P P L P PP PP P PP P PP Sbjct: 617 VPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPP 668 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +1 Query: 703 SASXTXTXXXXPXSPXXNPXXXXPXEPPXXXXTPXXPPXAXXXXXXXXXXXPXPPXXXXP 882 S S T P P P P P P PP P PP P Sbjct: 536 SPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLP 595 Query: 883 XXXXXXPXPXP 915 P P P Sbjct: 596 NCLVPSPPPPP 606 Score = 29.5 bits (63), Expect = 4.0 Identities = 20/81 (24%), Positives = 21/81 (25%), Gaps = 2/81 (2%) Frame = +2 Query: 674 PHQXRNGPSIPPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXX--PXXPPXPPXXXX 847 P NGP +P P P P P P P PP PP Sbjct: 699 PANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMTG 758 Query: 848 XXXPXPPXXXXXXXXPXXXPP 910 P PP P P Sbjct: 759 KKAPAPPPPPPQAPKPPGTVP 779 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +3 Query: 735 SXXSXXQSPXXPXPXTPXXXXNPSXXPXXXXXXXXKXXXXPXPPPXXPPXXXXXXXXPXP 914 S + Q P P P PS P P PPP PP P P Sbjct: 578 SNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPP 637 Query: 915 SXXP 926 P Sbjct: 638 PPPP 641 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 686 RNGPSIPPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXP 865 RN P+ PP P P P P PL P PP P P Sbjct: 745 RNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHPPSSKGLNAPAP 804 Query: 866 P 868 P Sbjct: 805 P 805 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/48 (29%), Positives = 14/48 (29%) Frame = +2 Query: 767 PXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P PP PP P PP P P Sbjct: 604 PPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVP 651 >03_01_0515 - 3864796-3865425 Length = 209 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P P PP PP P PP P PP Sbjct: 50 PLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPP 100 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/79 (24%), Positives = 23/79 (29%) Frame = +1 Query: 679 PXTQWSFHSASXTXTXXXXPXSPXXNPXXXXPXEPPXXXXTPXXPPXAXXXXXXXXXXXP 858 P T+ S + + P P P P PP +P PP P Sbjct: 42 PPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPP 101 Query: 859 XPPXXXXPXXXXXXPXPXP 915 PP P P P P Sbjct: 102 PPPSPPPPSPVKSSPPPPP 120 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.9 bits (69), Expect = 0.74 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 695 PSI-PPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPP 868 PS+ PPV Q L P P P P P+ P P P P PP Sbjct: 168 PSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +3 Query: 759 PXXPXPXTPXXXXNPSXXPXXXXXXXXKXXXXPXPPPXXPPXXXXXXXXPXPSXXP 926 P P P P P P + P PPP PP P P P Sbjct: 159 PPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPP 214 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/77 (24%), Positives = 23/77 (29%) Frame = +2 Query: 680 QXRNGPSIPPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXP 859 + + P++ PV P P P P P P PP PP P Sbjct: 112 EFKTPPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPP------PP 165 Query: 860 XPPXXXXXXXXPXXXPP 910 PP P PP Sbjct: 166 RPPSVKPPVVQPKPQPP 182 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 767 PXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXP 907 P P P P P P PP PP P PP P P Sbjct: 26 PPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGP 72 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXP 907 P P P P P P PP PP P PP P P Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPPAAP 393 Score = 30.3 bits (65), Expect = 2.3 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P PP PP P PP P PP Sbjct: 332 PKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 767 PXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPP 868 P P P P P P PP PP P PP Sbjct: 327 PPPPPPKAAPPP-PPPKGPPPPPPAKGPPPPPPP 359 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +2 Query: 755 IPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXP 907 +P P P P P P P PP PP P P P P Sbjct: 352 MPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPPKATMARFPKLSP 402 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/42 (30%), Positives = 13/42 (30%) Frame = +2 Query: 782 PXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXP 907 P P P P PP PP P PP P P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 755 IPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 +P P P P P PL PP PP P P P PP Sbjct: 1160 LPPSPPPATP-PPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPP 1210 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXX-PXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P P P PP PP P PP P PP Sbjct: 1138 PPPPLPEGPP--PLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPP 1187 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +2 Query: 695 PSIPPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXX 874 P PP L P P P P P P P PP P PP Sbjct: 1126 PDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPP 1185 Query: 875 XXXXXXPXXXP 907 P P Sbjct: 1186 PPLPSGPPPQP 1196 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +2 Query: 767 PXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPP 868 P P P + P P PP PP P PP Sbjct: 21 PKPFKPLSSAAPFRRPSPPPPPPSPVPSPAPPPP 54 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P P PP PP P PP P PP Sbjct: 13 PPATPPPPPRRAPPPPSPPIRPP-PPPTPRPYAPPPPSHPLAPPPPHISPP 62 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 29.9 bits (64), Expect = 3.0 Identities = 22/81 (27%), Positives = 24/81 (29%), Gaps = 2/81 (2%) Frame = +2 Query: 674 PHQXRN--GPSIPPVRQXXXXXXXXLXXXIPXXPXPXNPXXTPXPLXXPXXPPXPPXXXX 847 PHQ + GP P +Q P P N P P P PP PP Sbjct: 65 PHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPP---PPPPPSPPPSAP 121 Query: 848 XXXPXPPXXXXXXXXPXXXPP 910 P PP PP Sbjct: 122 PPPPPPPTQPPPREAQLAPPP 142 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPP 868 P P N P P P PP PP P PP Sbjct: 340 PRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPP 376 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +2 Query: 791 TPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 +P P+ PP PP P PP P PP Sbjct: 339 SPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 758 PXXPXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXPP 910 P P P P P P PP P P PP P PP Sbjct: 290 PPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFPWPFPP 340 >06_03_0426 + 20667639-20667938 Length = 99 Score = 29.1 bits (62), Expect = 5.2 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = -1 Query: 176 SRSWLEVSADSSTTPALAASMHIANTTRSFILLGAFQDRLQGCKSKS*G 30 SR++L S S + A+AAS + +R LL +QDR Q C+S G Sbjct: 50 SRTFLLWSLKVSRSYAMAASSAVLKVSRVVKLLRWWQDREQLCRSNGGG 98 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 767 PXPXNPXXTPXPLXXPXXPPXPPXXXXXXXPXPPXXXXXXXXPXXXP 907 P P P P P P PP PP P PP P P Sbjct: 173 PPPLPPKKKPLP--PPSPPPQPPLPEKENTPLPPLLLPPKKKPLPPP 217 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 166 QDLEEKLYNSILTGDYDSAVRQSLEYESXGXGSIIQNVVNXLIIDXRRNXMEYCYKLWVG 345 Q LE N I+T D +RQ L S++ N++ +D + +E C +WVG Sbjct: 1147 QLLELGKNNEIVT---DQVLRQELALVMPKIYSLLSNLIGSDEMDIVKVVLEGCRWIWVG 1203 Query: 346 NG 351 +G Sbjct: 1204 DG 1205 >04_04_1263 - 32207636-32207938,32208020-32208170,32208263-32208500, 32208604-32208814,32208927-32209108,32209196-32209297, 32210002-32211187,32212103-32212499,32212551-32212582, 32212885-32213157,32213307-32213394,32213486-32213723, 32213824-32214034,32214119-32214300,32214378-32214479, 32214801-32216224,32216751-32216822,32217688-32217719, 32218186-32218263,32218425-32218512,32218608-32218845, 32219060-32219162,32219386-32219558,32219644-32219745, 32219825-32220606,32220659-32221012,32224055-32224140, 32224250-32224400,32224534-32224771,32224876-32225119, 32225190-32225368,32225577-32225675,32225835-32227083 Length = 3195 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 322 YCYKLWV-GNGXEIVRKYFPLNFRTHHGRKLCQ--DHLQKLQP 441 Y ++LW GN E++ K+F ++ H CQ D L +P Sbjct: 720 YAWRLWKDGNATELLDKFFVDSYPLHEAFSFCQSDDRLTPAKP 762 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,994,100 Number of Sequences: 37544 Number of extensions: 399754 Number of successful extensions: 2055 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -