BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P08 (926 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 1.4 AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical prote... 25 3.3 AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory a... 25 3.3 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 9.9 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.2 bits (55), Expect = 1.4 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 418 DHLQKLQPRSEARFHNQSLXMRELPTAMV*TSIL 519 DH+ +L PR + R+H+ S + PT + T++L Sbjct: 445 DHVCELLPRLQPRYHSISSSSKLHPTTVHVTAVL 478 >AJ973475-1|CAJ01522.1| 127|Anopheles gambiae hypothetical protein protein. Length = 127 Score = 25.0 bits (52), Expect = 3.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 85 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 213 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AJ697728-1|CAG26921.1| 127|Anopheles gambiae putative sensory appendage protein SAP-2 protein. Length = 127 Score = 25.0 bits (52), Expect = 3.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +1 Query: 85 MKLLVVFAMCMLAASAGVVELSADTSNQDLEEKLYNSILTGDY 213 MKL V A +LA +A + + DL+E L + L +Y Sbjct: 1 MKLFVAIAFALLALAAAQEQYTTKYDGIDLDEILKSDRLFNNY 43 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 9.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 325 CYKLWVGNGXEIVRKY 372 C LW+GN + + KY Sbjct: 775 CASLWLGNAIQTLNKY 790 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 722,904 Number of Sequences: 2352 Number of extensions: 13417 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 100882044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -