BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_P05 (965 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 25 0.67 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 24 1.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 8.2 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 25.4 bits (53), Expect = 0.67 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 507 LEYRLLSFSSLQWVSLTSNLQQACLRQLDRLGGKNIL 397 LE LSF L++ L NL L Q+ L N+L Sbjct: 433 LEINGLSFQGLEYTLLHLNLDNVSLSQVPALSTPNLL 469 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 24.2 bits (50), Expect = 1.5 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 359 IFELIWNLMTSVCAAADIHSSWY 291 +F ++WN + A+ D + WY Sbjct: 284 LFTILWNCQNTRVASEDFKAIWY 306 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 350 AQRYSYKCESEVLPHGRIFFPP 415 A+R +Y CE + HG+ + P Sbjct: 59 AKRAAYDCEGVIRHHGQWNYSP 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,708 Number of Sequences: 336 Number of extensions: 3883 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27306312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -