BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O24 (973 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 42 6e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 8e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 41 0.002 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 40 0.002 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 40 0.002 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 40 0.003 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 38 0.012 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 37 0.021 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 37 0.028 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 36 0.037 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 36 0.050 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 36 0.066 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.066 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.087 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 35 0.11 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 34 0.15 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 34 0.15 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 34 0.20 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 34 0.20 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 33 0.26 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 33 0.35 SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 33 0.35 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 33 0.46 SB_29968| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.46 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 33 0.46 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.61 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 32 0.81 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 32 0.81 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 32 0.81 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 32 0.81 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 32 0.81 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.81 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 32 0.81 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 1.1 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.1 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 1.1 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 31 1.1 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.4 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 31 1.4 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 31 1.4 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.9 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.9 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.9 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 31 1.9 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 30 2.5 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.5 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 2.5 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 2.5 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 30 2.5 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 30 3.3 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 30 3.3 SB_21829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 30 3.3 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.3 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 3.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 3.3 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 4.3 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 29 4.3 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 29 4.3 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 29 5.7 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 29 5.7 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 29 5.7 SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 29 5.7 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 29 5.7 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.7 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 7.5 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_38437| Best HMM Match : VWA (HMM E-Value=0) 29 7.5 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.5 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 29 7.5 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 7.5 SB_14418| Best HMM Match : GRP (HMM E-Value=1.8) 29 7.5 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 28 9.9 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 9.9 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PPA P P PPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.9 bits (94), Expect = 8e-04 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P SP P PP + PP P PP PP PP PP P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PP PP P PP PP PP PP P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P P PPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP+ P P PPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PP PP P PP PP PP PP P P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PP PP P PP PP PP PP P P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/46 (36%), Positives = 18/46 (39%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P P PP PP P PP PP +PP PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PPP PP P P PP Sbjct: 400 PPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 PPPP P PP P PP + PPP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPP-QPPPPPPPPPPP 405 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PP PP P PP PP PP PP P P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P PPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P P P PP P P PPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P PPP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP P P PPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP P P PPP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P P P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P PPP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P PPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P SP P PP PP P PP PP PP PP P P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPP--PPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P SPP PP P P PP PP PP P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P SPP P P PP PP PP PP P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/55 (32%), Positives = 19/55 (34%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P P PP+ PP P PP PP PP P P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P PP PP P PP PP PP PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P P P P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP 395 Score = 36.3 bits (80), Expect = 0.037 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 764 APXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 A ++SPP PP P +PP PP PP PP P P Sbjct: 359 AGINMSPPPPPPP--PPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P PP P PPP PP P P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.5 bits (78), Expect = 0.066 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = +2 Query: 749 SXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 S P P PP PP P PP P PP PP P P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP P PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P PPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PP PP P P PPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P P PP PP P PP P PP PP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P P PP PP P P PP PP PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P P PP PP P P PP PP PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PPP PP PP Sbjct: 409 PPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSP 853 P + P P P PP PP P PP PP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP PP Sbjct: 408 PPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G GG G G G G GG AG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG GGG G GG G G G G GG G AG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G G GG GGG G GG G G G G G +G V Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDV 718 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG G GG G G G G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GGG G GG G G G G GG G AG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXG 815 G GGG G GGG G GG G GG G GGGG G G Sbjct: 660 GDGGGGGGGGGG--GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 41.9 bits (94), Expect = 8e-04 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPP---XXXXXXXXXXXXXRXXPPPXPXPPP 968 P S P P PPPP P PP P PP PPP P PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PP PP P P PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 797 PPXFXXPXXTPPXXPPTSPPXPP 865 PP P PP PP PP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPP 118 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 785 PRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P PP PP PP PP Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPP 119 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/55 (34%), Positives = 23/55 (41%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P+ P + P P + PP PP P PP PP +PP PP P P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPN--APYPPPPYPPPPNPPYPPPPNPPYPPPP 199 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 95 PPPPYPPYPPPPPYP-PPPNPPYPPPPNAPYPPP 127 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PPP PP P P PPP Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 35.9 bits (79), Expect = 0.050 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +3 Query: 828 PRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P PPPP P PP P PP PP P PPP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP--NPPPPNPPYPPP 214 Score = 35.5 bits (78), Expect = 0.066 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P P PPP Sbjct: 177 PPYPPPPNPPYP-PPPNPPYPPPPNAPNPPP 206 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P P PPP Sbjct: 92 PPYPPPPYPPYPPPPPYPP---PPNPPYPPP 119 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 767 PXHLSP-PRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + SP P PP + PP PP +PP PP P P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PP Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P PPP Sbjct: 103 PPPPPYPPPPNPPYP-PPPNAPYPPPPNPPYPPP 135 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/52 (32%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXF-XXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P +P P +PP PP P P PP +PP PP P P Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P PPP Sbjct: 182 PPNPPYPPPPNPPYP-PPPNAPNPPPPNPPYPPP 214 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P S +P P +PP P P PP P PP PP P P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPP 191 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTA-PPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P + P P + PP PP P PP P PP PP P P Sbjct: 165 PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNP 220 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + P+P PP PP PP PP + P PP P P Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PPP PP P P PPP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPP---PPNAPYPPP 177 Score = 33.1 bits (72), Expect = 0.35 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPP------PXPPAXXPXXXPXPPP 969 P P P PP P PP P PP P P PPP Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P+ P + +P P + PP PP P PP P +PP PP Sbjct: 194 PYPPPPNAPNPPPPN--PPYPPPPNAPNPPYPPPPNAP-NPPYPP 235 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P + PP PP P PP P PP PP P P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPP-NPPYPPPPNAPYPPPPNPPYPPPPNAPYP 141 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 2/52 (3%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHL-SPPRTAPPXFXXPXX-TPPXXPPTSPPXPPXXXXP 880 P+ P + P P + +PP PP P PP PP + P PP P Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 31.9 bits (69), Expect = 0.81 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 749 SXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSP-PXPPXXXXP 880 S P P PP PP + P P PP +P P PP P Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P P P PPP P P P PP Sbjct: 133 PPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP 165 Score = 31.9 bits (69), Expect = 0.81 Identities = 16/51 (31%), Positives = 17/51 (33%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + P P PP PP P P PP PP P P P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPP 194 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P P P PPP PP P P PP Sbjct: 111 PPNPPYPPPPNAPYP-PPPNPPYPPPPNAPYPP 142 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Frame = +3 Query: 828 PRXXLPPPPXXP---QXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P PPPP P P P PP PP P PPP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P P P PPP PP P P PP Sbjct: 190 PPNPPYPPPPNAPNP-PPPNPPYPPPPNAPNPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/52 (30%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPP-XFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + P + PP PP P PP PP + P PP P P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P + PP P P PP PP + P PP P P Sbjct: 185 PPYPPPPNPPYPPPPNAPNP----PPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PP PP P PP P PP P P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/56 (30%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSP-PXPPXXXXPXXXXP 895 P+ P P P + PP P + P P PP P P PP P P Sbjct: 173 PYPPPPYPPPPNPPYPPPPN---PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PP PP P P PPP Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAP-NPPYPPP 225 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXP-PPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P PPP Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPP-PXPPAXXPXXXPXPPP 969 P P P P P PP P P P P PPP Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXP-PPXPPAXXPXXXPXPPP 969 P P P P P P PP PP P PPP Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTA-PPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P + PP PP P PP P PP P P P Sbjct: 98 PYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P AP SP PP P P PP +PP P P P Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPP 181 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PP P A P P P P Sbjct: 206 PPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/56 (26%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSP-PXPPXXXXPXXXXP 895 P+ P + P P + P P + P P P +P P PP P P Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYP 162 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPP 893 P P P PPPP P PP P PP Sbjct: 209 PPYPPPPNAPNPPYPPPPNAPN--PPYPPPP 237 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPP----PXPPAXXPXXXPXPP 966 P P P P P PP P PP P P PP Sbjct: 196 PPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 40.7 bits (91), Expect = 0.002 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP+ P P PPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P PP + PP P +PP PP PP PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P PP P PPP PP P P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPP 227 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP P P P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPP-PXPPAXXPXXXPXPP 966 P P P PP P PP P PP P P PP Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P PPP Sbjct: 218 PPPPPSPSPPRPPPP-PPPSPPRPLAAKLPEPPP 250 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPXHLS---PPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 TT P R P + A +S T+P P PP PP+ PP PP Sbjct: 169 TTFPPTRLPGNARVNAIDQISIGTSHPTSPSQITQPPPPPPRPPPSPPPPPP 220 Score = 31.9 bits (69), Expect = 0.81 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 764 APXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 +P ++ P PP PP P SPP PP P P Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/56 (28%), Positives = 16/56 (28%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P S P P PP P PP P P R P PPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PP P P PPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPP 220 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXP-PTSPPXPPXXXXP 880 SP+ PP P P PP P P PP PP P Sbjct: 197 SPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +2 Query: 722 TXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 T P P SP P PP +PP PP PP SPP P Sbjct: 202 TQPPPPPPRPPPSPPPPP-PPPSPSPP-------RPPPPPPPSPPRP 240 Score = 28.3 bits (60), Expect = 9.9 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P P SPPR PP P +PP P PP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPP----PPPSPPRPLAAKLPEPP 249 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG G GG G G G G GG G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G GG G G G GG G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG GGG G GG G G G GG +G G Sbjct: 802 GDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G GG G G G GG G G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G G G G G G GG + G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GG G GG G G G G G +G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGG 815 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 G G G G GG GGG G GG G G G G GG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G G G G G G GG G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G G GGG G GG G G G G GG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGG 872 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG GGG G GG G G G GG G G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGG 823 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G GGG G GG G GG G GGGG Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G G G GGG G GG G G G GG G G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 35.1 bits (77), Expect = 0.087 Identities = 19/44 (43%), Positives = 20/44 (45%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G G GGG G GG G G G G GG +G Sbjct: 798 GGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG--GYGDGGGFGDG 839 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G G GGG G GG G G G G G G G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGG-GYGDGDGGGGGG 817 Score = 34.3 bits (75), Expect = 0.15 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG G G G G G G G GG G G Sbjct: 816 GGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 G GGG G GGG G GG G G GGGG G G + G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 962 GXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGL 864 G G G GG GGG G GG G G G+ Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 30.7 bits (66), Expect = 1.9 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 7/54 (12%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXG-------GXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG GGG G G G G G G G GG G G Sbjct: 808 GDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGG 861 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG G G G G G G G GG G G Sbjct: 823 GGGDGGGYGD-GGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG G GG G G G G GG G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G G G G G G GG G G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G G G G G GG G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G G GG GGG G G G G GG G GV Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGV 113 Score = 35.1 bits (77), Expect = 0.087 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 G GGG G GGG G GG GG G GGGG G G G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRW 843 GGG G GG GGG G GG G G G G + Sbjct: 81 GGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFGSTY 122 Score = 31.9 bits (69), Expect = 0.81 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRW 843 GGG G GG GG G GG G G G G R+ Sbjct: 77 GGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARF 118 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P P PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PP P PPP PP P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 794 APPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 APP P PP PP PP PP P P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 782 PPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 PP PP P PP PP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 782 PPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 PP PP P PP PP PP PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 779 SPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 +PP PP P PP PP P PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 +P P PP PP P PP PP PP P Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPP-FPPPPPPTP 496 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 38.7 bits (86), Expect = 0.007 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP PP P P PPP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP PP P PPP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP PP P PPP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 35.5 bits (78), Expect = 0.066 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP PP P PPP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP P+ P P PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +2 Query: 761 PAPXH-LSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P + PP PP P PP P++PP PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 33.1 bits (72), Expect = 0.35 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PPP P P PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP PP P P PPP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPP 700 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPP 893 P P PPPP PQ P P PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPP 966 P P PPP PP P P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPX-PPPXPPAXXPXXXPXPP 966 P P P PP P PPP PP+ P P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAP 722 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 815 PXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P PP PP PP PP P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +2 Query: 782 PPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P +T P P PP PP PP P P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P + P P PPPP P PP P PP PPP PP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 33.1 bits (72), Expect = 0.35 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTS----PPXPPXXXXPXX 886 T P P + +P P PP PP P PP PP + PP PP P Sbjct: 351 TNNPPSPPPPTNNTPPPP---PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPP 407 Query: 887 XXP 895 P Sbjct: 408 PPP 410 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P +PP PP P PP P PP PP P P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKP-PPPPPPTNGPPPPPPP 390 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PP PP P PPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 31.9 bits (69), Expect = 0.81 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPX--PPPXPPAXXPXXXPXPPP 969 P P P PP P PPP PP P P PPP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPP---PTNGPPPPP 398 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PP PP P PPP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P P PP P PPP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PP PP P PPP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPP---XPXPPP 968 PPPP P PP P PP PPP P PPP Sbjct: 346 PPPP--PTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 4/58 (6%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTS----PPXPPXXXXP 880 T P P + P P PP PP P PP PP + PP PP P Sbjct: 361 TNNTPPPPPPTNKPPPPP---PPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P P P PP PP P P PPP PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPP 396 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTS--PPXPPXXXXPXXXXP 895 P + P+P P PP PP PPT+ PP PP P P Sbjct: 349 PPTNNPPSPP--PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXP--PPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPP---PTNKPPPPP 378 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGG-GXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G GG GG G G GG G G G G GG Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGR 846 GGG G G GG GGG GG G G G G G R Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG G G G G G G GG Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG G GG G G G G GG + G G Sbjct: 81 GGRGGGFGG-GGGFGGG-GGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = -1 Query: 973 GXGGGXGXGGG-XXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G GGG G GG G GG +G GGGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G GG GGG G G G G G GG +G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G GG G G G G G G GG +G Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G GG G G G G G G G G +G Sbjct: 46 GGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG G G G G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGG 79 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 Query: 956 GXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G GG GGG G GG G GG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G GG GGG GG G G G G GG Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 35.5 bits (78), Expect = 0.066 Identities = 18/47 (38%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G +GG G G GG G G G G GG + G G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHG 225 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWE 840 GG G G GG GGG G GG G G G GG ++ Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG-GSKGGGYD 247 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GGG G GG G G G GGR + G Sbjct: 197 GSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYG---GGGRHDYGGG 240 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GG G GG R G GG GG G GGGG Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGG 219 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 GGG G G GG GGG G GG G G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 35.9 bits (79), Expect = 0.050 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXG 867 GGG G G GG GGG G GG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 GG G G GG GGG G GG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 G GG GGG G GG G G G G GG +G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 G GG GGG G GG G G G G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 932 GGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG GGG G GG G G G G GG G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G GGG G GG G GG G GGGG Sbjct: 132 GGGGGGGGGGG---------GGGGGGGGGGGGGGGGGGGGGGGG 166 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 36.7 bits (81), Expect = 0.028 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PPP PP P P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPP 1179 Score = 36.3 bits (80), Expect = 0.037 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP P+ P P PPP Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP P + P P PPP Sbjct: 1157 PPPPPPP-PPPPPSSPSPPPPPPPPP 1181 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXP 957 P P P P P PPP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.3 bits (65), Expect = 2.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 782 PPRTAPPXFXXPXXTPPXXPPTSPPXP 862 PP PP P PP PP PP P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 782 PPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 PP PP P P PP PP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 29.9 bits (64), Expect = 3.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 1165 PPPPSSPSPPPPPPPPP 1181 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P P PP P P P P Sbjct: 1161 PPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P P PP P P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPP---PPPPPPPPP 1184 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 Query: 776 LSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 + PP PP +PP PP PP P Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXP-PPXPPAXXPXXXPXPPP 969 P P P PP P PP PPA P P PPP Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P +L P PP P P PP PP PP Sbjct: 216 PEPDYLEPT-PPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG GG G G G G GG G G Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG G G G G G G GG G G Sbjct: 182 GGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 35.1 bits (77), Expect = 0.087 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG GG G G G G G + G G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGG 213 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG GG G G G G GG + G G Sbjct: 157 GGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYG--GGGYGGGGG 201 Score = 33.1 bits (72), Expect = 0.35 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -1 Query: 964 GGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 GG GGG R GG G GG G GGGG G G G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWE 840 GGG G GG GG G GG G G G GG +E Sbjct: 188 GGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGGYE 230 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG G G G G G R G G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGG 168 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXG-GXXWGXXGGGGRXXRGCXXGXXEXG 800 G GGG G GGG GG G G G GGGG G G G Sbjct: 131 GYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G G GGG GG G G G GG + G Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG 173 Score = 28.7 bits (61), Expect = 7.5 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 2/60 (3%) Frame = -1 Query: 973 GXGGGXGX-GGGXXRXXXXXXXXXXGXXG-GXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 G GGG G GG R G G G G GG G GGGG G G G Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 36.3 bits (80), Expect = 0.037 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G AGG GG G GG G G G+G GG Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMG---GGGEGMGAAGG 1829 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG G GG G G G GG G G Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 35.1 bits (77), Expect = 0.087 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G G GGG G GG G G GG G G Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGG 1808 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG-GGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG G GG G G G G G+G GG G AG Sbjct: 1782 GGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG-GGGEGMGAAG 1828 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG---GGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G A G G GG G GG G G G+G GG G Sbjct: 1775 GGGGGMGGGGMAAGGGEFGGGEGMGG--GGMAGGGGGMGGGGGGMGG 1819 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G GGG GG G GG G GGGG Sbjct: 1805 GGGGGMGGGGG---GMGGGGEGMGAAGGGMGAGGEGGGAGGGGG 1845 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -3 Query: 944 GXXAGGXGGGXGXGG--XXGXXXXGXXGLGXXGGRWEGXAGV 825 G GG GGG G GG G G G+ GG + G G+ Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGM 1798 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G G G G G GG G G Sbjct: 1800 GGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGG 1846 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGG---XGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G G G G G+ GG G G Sbjct: 1768 GGGGGMAGG--GGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 932 GGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG GGG G GG G G G GG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGG 1790 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 722 TXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXT-PPXXPPTSPPXPPXXXXP 880 T P + P P PP P P T PP PPT PP PP P Sbjct: 1003 TSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 35.1 bits (77), Expect = 0.087 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP PP P P PPP Sbjct: 1020 PTDPPTEPPTDPPTP-PPTEPPTPPPTEPPTPPP 1052 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/50 (38%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPXHL-SPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 TT P P + P +PP T PP P PP PPT PP P Sbjct: 1012 TTNVPDPLPTDPPTEPPTDPPTPPPTEPPT--PPPTEPPTPPPTDPPTQP 1059 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PP PP P P P Sbjct: 1028 PTDPPTPPPTEPPTP-PPTEPPTPPPTDPPTQP 1059 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PPP P P P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P+P +P PP PP PP +PP PP P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P S + AP PP A P P PP PP PP P P P Sbjct: 54 PPSPPAAAPA-APPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P + + P + P PP P PP P +PP PP P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P P P PP P PPP Sbjct: 77 PPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 32.3 bits (70), Expect = 0.61 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP---XXXXXXXXXXXXXRXXPPPXPXPPP 968 PPPP P P P PP PPP P PPP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 32.3 bits (70), Expect = 0.61 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 877 PXXXXPXXPPXPX-PPPXPPAXXPXXXPXPPP 969 P P PP P PP PP P P PPP Sbjct: 67 PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPX---PPAXXPXXXPXPPP 969 P P P PP P P PPA P P PPP Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P + PA +PP A P P P PP P P P Sbjct: 58 PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPP 893 P + P P PPPP P PP P PP Sbjct: 81 PPAAPPPPPPLPAPPPPPAQPAPQPP-PAPP 110 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXP 945 P P P P P PPP PP P Sbjct: 89 PPLPAPPPPPAQPAPQPPPAPPHFLP 114 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GGG GG G G G G GGR + G Sbjct: 101 GGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 35.1 bits (77), Expect = 0.087 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 962 GXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GGG G GG G G G G GGR G G Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGG----GRGGGGYGGGRGGGYGG 139 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG-GGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G +GG G GG GG G G G G GG + G G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRG 134 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 GG G G GG GGG G G G G G Sbjct: 116 GGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKG 150 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 35.9 bits (79), Expect = 0.050 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 P P H PP+ PP PP PP PP P Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPP 462 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 35.5 bits (78), Expect = 0.066 Identities = 19/55 (34%), Positives = 21/55 (38%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P + P P + PPRT PP P P PP PP P P P Sbjct: 173 PIDPPRTQPPPIPP-IDPPRTQPPPI-PPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P + PPRT PP P P PP PP P P P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPI-PPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PPP PP P P P P Sbjct: 168 PPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP 198 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PPP PP P P P P Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P + PPRT PP P P PP PP P P P Sbjct: 150 PAPMTLPPISPIDPPRTQPPPI-FPIDPPRTQPPPIPPIDPPRTQPPPIPP 199 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P PP PPP PP P P P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.5 bits (78), Expect = 0.066 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PPP PP P PPP Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 35.1 bits (77), Expect = 0.087 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP PP P PPP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P +PAP PP APP P PP PP PP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PPP P P P PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P S P APP P PP PP PP P P P Sbjct: 294 PPPADGSAP--APPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXP 962 P P PPPP P PP P PP PPP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDG------GAPPPPPPP 337 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P PP P PP P P P PP Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PPP P P PPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPP 325 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 35.1 bits (77), Expect = 0.087 Identities = 23/61 (37%), Positives = 25/61 (40%), Gaps = 6/61 (9%) Frame = +2 Query: 731 PFRXPXSXXSP--APXHLSPPRTAPPXFXXPXXTPPXXPPT--SPP--XPPXXXXPXXXX 892 P R S SP AP + PP APP P PP PP +PP PP P Sbjct: 2156 PARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Query: 893 P 895 P Sbjct: 2216 P 2216 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 2/47 (4%) Frame = +2 Query: 731 PFRXPXSXXSP--APXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P S P AP PP PP P PP PP S P Sbjct: 2176 PMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSP 2222 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 5/60 (8%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPP--XXPPTSPP---XPPXXXXPXXXXP 895 P P P L P + PP P PP PP+ PP PP P P Sbjct: 2152 PPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 34.7 bits (76), Expect = 0.11 Identities = 24/59 (40%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGG-XGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 G G G G GGG R G GG G GG G GGGGR RG G G Sbjct: 136 GGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGR-GRGTGGGSRGGG 193 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GGG G GG G G G G GG G G Sbjct: 130 GGWRGRGGGEGNGAGGGIGRGGGRGRGG-GEGGWGGRGGNGGGRGG 174 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGXGXXXGXXA--GGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GG GGG G GG G G G GR G G Sbjct: 156 GGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRG-GGGDGRGRGRGG 203 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 G GG GG G GG G G G+G GGR G Sbjct: 123 GVQRGGRGGWRGRGGGEGNGAGG--GIGRGGGRGRG 156 Score = 29.5 bits (63), Expect = 4.3 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -3 Query: 962 GXGXXXGXXAG---GXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G AG G GGG G GG G G G G G EG G Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEG-GWGGRGGNGGGRGGGEGGGG 180 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGR 846 GGG G G GG GGG G GG G G G GGR Sbjct: 45 GGGRG---GPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGR 82 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPP 893 P PR PPPP P PP P PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXP 957 P P P PP P PPP PPA P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPPASSTGSTP 893 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PPP PP P P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXP 945 P P PP P PPP PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GG G G GG GGG G GG G G G G +G Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 32.7 bits (71), Expect = 0.46 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 G G G G GG GGG G GG G G G G G +G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDG-DGDGDGDGDGDG 346 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GGG G G G G G G +G G Sbjct: 309 GGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDG 355 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G GG GGG G G G G G G +G Sbjct: 308 GGGGGDGGG---GGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXG 876 GGG G G GG GGG G GG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGG 900 GGG G G GG GGG G GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXG 891 GG G G GG GGG G GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGG 322 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G GGG GG G G G GG G G Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G GG G G G GG G G Sbjct: 243 GGGATGGGGGATGGGGGATGGGG--GATGGGGGATGGGGGATGGGGG 287 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGX-GGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G G GGG G GG G G G GG G G Sbjct: 304 GGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GG G G GG G G GG G G G G G GV Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGV 312 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXG 867 GGG G GG GG G GG G G G Sbjct: 334 GGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 29.1 bits (62), Expect = 5.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G A G GGG GG G G G GG G G Sbjct: 270 GGGGATGGGGGATGGGGGATGGG--GGATGGGGGATGGGGGATGVGG 314 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G G GG G G G G G G Sbjct: 272 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATG 318 Score = 28.3 bits (60), Expect = 9.9 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = -3 Query: 968 GGGXGX--XXGXXAGGXG-----GGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G G GG G GG GG G G G GG G GV Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGV 344 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G G GG G G G+ GG G G Sbjct: 314 GGATGGGGGATGGGVGATGGGGGATG----GGGGVTGGGGGATGGGG 356 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 828 PRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXP 962 P +PPPP P P P PP PPP P P Sbjct: 915 PGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P +P P +PP PP PP PP PP PP Sbjct: 958 PPGGSAPPPGGGAPPLPPPPG----GSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.9 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 761 PAPXHLSPPRT--APPXFXXPXXTPPXXPPTSPPXPP 865 P P +PP APP P + P PP PP PP Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PP PP P PPP Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPP 987 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.9 bits (74), Expect = 0.20 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG G G G G G G G G GG G AG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGG-GNDGGNGGGGAG 74 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G G GGG G G G G G G G AG Sbjct: 46 GGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G GG G G G GG G G G G G +G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSG 105 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G AG GGG G G G G GG G G Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVG 108 Score = 31.9 bits (69), Expect = 0.81 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G G AGG G G G G G G G G G G AG Sbjct: 44 GNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGN-GGAAG 89 Score = 31.9 bits (69), Expect = 0.81 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G G GG G G G G G GG Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGG 109 Score = 31.5 bits (68), Expect = 1.1 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 G GGG G GGG G G G GG G GGGG G G G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDG-GNGGGGAGNGGGGGGAGNGGAAGAAGAG 94 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GGG G G G G G GG G G Sbjct: 31 GVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGG 77 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXG-XGGXXGXXXXGXXGLGXXGG 849 GGG G G G GG G GG G G G G GG Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GG G GG G G G G AG Sbjct: 50 GNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAG 96 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXG 867 G G G G G GG G GG G G G Sbjct: 81 GAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 33.9 bits (74), Expect = 0.20 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXG-GRW 843 GGG G G GG GGG G GG G G G +W Sbjct: 30 GGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKW 72 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXG 891 GGG G G G GGG G GG G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGGGGG 51 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 932 GGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG GGG G GG G G G GG Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 PPPP P PP P PP PP PPP Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 405 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXP-PPXPPAXXPXXXPXPPP 969 P P P PP PP PPA P PPP Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.1 bits (62), Expect = 5.7 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 5/61 (8%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPP-----PXPXPP 965 P S P + PPP PP P PP R PP P P PP Sbjct: 340 PPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGR--PPSSLGNPPPPPP 397 Query: 966 P 968 P Sbjct: 398 P 398 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P S +P P + APP PP PP P PP Sbjct: 340 PPSRGAPPPPSMG---MAPPPVGGAAPPPPPPPPVGGPPPP 377 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P PP P PPP PP P PP Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P SPA PP P P PP P T P PP P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVP 177 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/51 (29%), Positives = 18/51 (35%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + +P+ PP P P PP P T P PP P P Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP 164 Score = 32.3 bits (70), Expect = 0.61 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PP P PPP PP P P Sbjct: 188 PPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 30.3 bits (65), Expect = 2.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PPP PP P P PPP Sbjct: 179 PAVPLAAASPPPPSGGPPPPPP---PPPPPPPPP 209 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP PP P PPP Sbjct: 138 PPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/51 (27%), Positives = 17/51 (33%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P + P P ++P T P P P PP PP P P Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PPP PP P PP Sbjct: 195 PPPPPPPPPPPPPPPILELAAPP 217 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PPP PP PPP Sbjct: 196 PPPPPPPPPPPPPPILELAAPPP 218 Score = 28.7 bits (61), Expect = 7.5 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXP-XXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P S AP PPR P PP P T P PP P P Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGP 151 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PPP PP P PPP Sbjct: 130 PTSPATRAPPPPPPIAPATGGPPPPP 155 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 962 GXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG GGG G GG G G G G GG G G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGG--GDGIDGGDGGGDGGGDGGGDGG 479 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG G G G G G G GG Sbjct: 443 GGDGGGDGG-GGGDGGGDGIDGGDGGGDGGGDGGGDGGG 480 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 33.1 bits (72), Expect = 0.35 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXG--XGGXXGXXXXGXXGLGXXGG 849 GGG G G G GGG G GG G G G G GG Sbjct: 305 GGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 346 Score = 32.7 bits (71), Expect = 0.46 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 5/52 (9%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGX--GXGGXXGXXXXGXXGLGXXG--GRWEGXAG 828 GGG G G G G GGG G GG G G G G G GR +G G Sbjct: 265 GGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMG 316 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGG--GXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G G G G G G GG G G G G GG G G Sbjct: 297 GGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGG 345 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G G G G GGG G G G G+G G+ G G+ Sbjct: 320 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQGGGMGRGPGQGWGCRGM 368 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G G G G GGG R G G G GG WG GGG Sbjct: 257 GGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGG-GWGRMQGGG 299 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG-XXGGRWEGXAG 828 GGG G G GGG G G G G+G GG W +G Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSG 289 >SB_43997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1067 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 SP+ S P ++PP P + P PP+SPP P Sbjct: 145 SPSSSFPSVPPSSPPSSSSPSSSSPSVPPSSPPSSP 180 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +2 Query: 722 TXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPP 856 T P P S P SPP ++ P P PP PP+SPP Sbjct: 139 TYPPSSSPSSSFPSVPPS-SPPSSSSPSSSSPS-VPPSSPPSSPP 181 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 Query: 767 PXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P +PP AP P PP PPT+PP PP Sbjct: 222 PTTQTPPTKAPTDPPVPPTNPP-VPPTNPPAPP 253 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 737 RXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 R P + P PP PP T P PPT+PP P Sbjct: 220 RPPTTQTPPTKAPTDPP--VPPTNPPVPPTNPPAPPTNPPKP 259 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 32.7 bits (71), Expect = 0.46 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G GG GGG G GG G G GG Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G G G GGG G GG G G GG Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 >SB_29968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = +2 Query: 284 EASREAN**ATRKAAYC-PACSYTRTSSSDQTCRDN-SNRLYLRSRFIQLYHPXRLSLSL 457 EAS A R+ Y P C R + +TCR+N ++ +Y+R+ +++ R +LSL Sbjct: 422 EASHTVRRGAKRRLVYSQPYCQRVREQCTKKTCRENFTSVIYVRNAYLESTRMDRATLSL 481 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 722 TXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 T ++ P +PA P PP P PP P PP PP Sbjct: 533 TTAHYQVPIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 892 PXXPPXPXP-PPXPPAXXPXXXPXPPP 969 P PP P PP PP P P PPP Sbjct: 565 PPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 877 PXXXXPXXPPX-PXPPPXPPAXXPXXXPXPP 966 P P PP PPP PP+ P P PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P P P + P PP PP PP P PP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 32.7 bits (71), Expect = 0.46 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 3/57 (5%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPX--HLSPPRTAPPXFXXPXXTPP-XXPPTSPPXPPXXXXP 880 T P P P P + PP T PP P PP PP + P PP P Sbjct: 26 TPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSP 82 Score = 30.7 bits (66), Expect = 1.9 Identities = 19/59 (32%), Positives = 23/59 (38%), Gaps = 6/59 (10%) Frame = +2 Query: 737 RXPXSXXSPAPXHLSPPR--TAPPXFXXPXXTPPXXPP--TSPP--XPPXXXXPXXXXP 895 + P +P P +PP+ T PP P P PP T PP PP P P Sbjct: 12 KRPVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 32.7 bits (71), Expect = 0.46 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 3/59 (5%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPP---XPXPPP 968 P S P PR PPP P P P PP R PPP P PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPP-----PSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 397 PVPSKPVHPT-LPPXQIKPVPVYPTP 471 P+P+ P HPT PP Q KP P P P Sbjct: 1093 PIPTNPAHPTEPPPRQPKPTPA-PRP 1117 Score = 30.7 bits (66), Expect = 1.9 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P + P P SPP +A P P P PP+ P PP P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPI---PPPRKPSPPPSEPAPPPRQPPP 1078 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP P+ P P PPP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPP 1059 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPR--TAPPXFXXPXXTPPXXPPTSPPXPP 865 P R P S P + PPR + PP P P P TS P PP Sbjct: 1043 PPRKPSPPPSAVP--IPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 877 PXXXXPXXPPX-PXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP P P PPP Sbjct: 1057 PPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPP 1088 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 877 PXXXXPXXPPX-PXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP P P PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPP 1066 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P P PPR PP PP P P P P P Sbjct: 1055 PIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 722 TXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 T P P+ L PPR P P P PP P PP P P Sbjct: 1023 TEQPVPPKRKASPPSAQPLPPPRKPSP----PPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 877 PXXXXPXXPPX--PXPPPXPPAXXPXXXPXPPP 969 P P PP P PPP P+ P P PPP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPS-PPPSEPAPPP 1073 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.3 bits (70), Expect = 0.61 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPP 966 P PP P PPP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 916 PPPXPPAXXPXXXPXPPP 969 PPP PP P P PPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.9 bits (69), Expect = 0.81 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP PQ PP P PP Sbjct: 426 PPPPGFPQFQPPPPPPP 442 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PPP PP P PPP Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PPP P P PPP Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPP 718 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PPP P P PPP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPP 716 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 841 SHLXXXXXXPXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 S L P P P P PPP PP P PP Sbjct: 689 SSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPP 730 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP PP P PPP Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPP 714 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PPP P P PPP Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PPP PP P P P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG--GGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G GG GG G G G GG G G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGG 88 Score = 31.9 bits (69), Expect = 0.81 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GGG G G GG GG G GG G G G G +G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATG-GGGGATGDG 93 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G GG G G G GG G G Sbjct: 65 GGGATGGGGGATGGHGGATGGGG--GATGDGGGATGGGGGATGGGGG 109 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G GG G G G GG G G Sbjct: 72 GGGATGGHGGATGGGGGATGDGG--GATGGGGGATGGGGGATGGHGG 116 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G G GG G G G G G G Sbjct: 94 GGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATG 140 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G G GG G G G G G G Sbjct: 108 GGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATG 154 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG G G GG G G G GG G G Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATG---GGGGATGDGGGATGGGGG 102 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGG--XXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G GG G G+G GG G Sbjct: 86 GGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGG 134 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXG-GXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GG GG G G G G G GG G G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGG 94 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 31.9 bits (69), Expect = 0.81 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG-GGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G +GG G GG GG G G G G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 223 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 G G G G GG GGG G GG G G G Sbjct: 206 GYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 956 GXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWE 840 G G GG GGG G GG G G G GG ++ Sbjct: 206 GYGGGRGGGGYGGGRGGGGGYGGGRRDYGG-GSKGGGYD 243 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG GG G G GG Sbjct: 197 GGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGG 236 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 31.9 bits (69), Expect = 0.81 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGG 900 GGG G G GG GGG G GG Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGG 364 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXG 891 GG G G GG GGG G GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRG 361 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXG 876 G G G G GG GGG G GG G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 GG G GG GGG G GG G G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXG 852 G GG GGG G GG G G G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXGXGGXXGXXXXGXXGLG-XXGGRW 843 GGG G G G G GGG G G G G+G GG W Sbjct: 21 GGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGW 64 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXG--XGGXXGXXXXGXXGLGXXGG 849 GGG G G G G GGG G GG G G G G GG Sbjct: 45 GGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGG 87 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/49 (36%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAG-GXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G G G G GGG G G G G+G G+ G G+ Sbjct: 61 GGGWGRMQGGGMGRGPGGGLGRGPGGGWGRMQEGGMGRGPGQGWGCRGM 109 Score = 30.7 bits (66), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G G G G GGG R G G G GG WG GGG Sbjct: 13 GGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGG-GWGRMQGGG 55 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = -3 Query: 956 GXXXGXXAGGXGG--GXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G G G GG G G GG G G G G GG G G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGG 46 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 31.9 bits (69), Expect = 0.81 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXG-GGXGXGGXXGXXXXGXXGLGXXGG 849 GGG G +GG G GG GG G G G G GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGG 132 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G GG GGG G GG G G G G Sbjct: 317 GGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 932 GGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GG GGG GG G G G GGR G Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGG 344 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 31.9 bits (69), Expect = 0.81 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 S +P L+PP APP P PP P PP PP P P Sbjct: 171 SVSPGILAPP-PAPPGVLAPPPAPPGVLP-PPPAPPGALIPPPPAP 214 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 PAP + P APP P PP PP PP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPP 893 P P P L PPP P PP P PP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXP-QXXPPXPXPP 893 P P P LPPPP P PP P PP Sbjct: 184 PGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPX---HLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 TT P P +PAP + +PP P P PP +PP PP P Sbjct: 294 TTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P H R PPP PP P PP P P PPP Sbjct: 196 PPPHSRHGSAPPPPERSSGPP-PPPPGRGPSQRSLAPPPTGSSRPLPAPPP 245 Score = 29.5 bits (63), Expect = 4.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PPP P A P PPP Sbjct: 2 PPPPPPPGPPPPPSA--PSGPVKPPP 25 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 G +GG GG G GG G G L G R AG Sbjct: 79 GGFSGGGGGSMGGGGLGGLFAGGMPKLRPAGERKAAGAG 117 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPP 856 P R P S P P P+ APP PP P PP Sbjct: 253 PMRGPTSGGEPPP-----PKNAPPPPKRGSSNPPPPPTRGPP 289 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 910 PXPPPXPPAXXPXXXPXPPP 969 P PPP PP P P PPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPP 215 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 904 PXPXPPPXPPAXXPXXXPXPPP 969 P P PPP PP P PPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPP 216 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 201 PPPPGFPGGAPPPPPPP 217 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P PP P PP P P P PPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPP---PPPPP 217 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPX---HLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 TT P P +PAP + +PP P P PP +PP PP P Sbjct: 206 TTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P H R PPP PP P PP P P PPP Sbjct: 108 PPPHSRHGSAPPPPERSSGPP-PPPPGRGPSQRSLAPPPTGSSRPLPAPPP 157 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPP 856 P R P S P P P+ APP PP P PP Sbjct: 165 PMRGPTSGGEPPP-----PKNAPPPPKRGSSNPPPPPTRGPP 201 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP PP P P PPP Sbjct: 181 PPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP P PP P P P PPP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPP 183 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P + P +P +PP PP PP P S P PP Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 28.7 bits (61), Expect = 7.5 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +2 Query: 749 SXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 S S P +PP P PP P +PP PP P P Sbjct: 156 SIASQPPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPP 204 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 31.5 bits (68), Expect = 1.1 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXG---XGGXXGXXXXGXXGLGXXGGRWEG 837 GG G GG GGG G GG G G G+G GG G Sbjct: 168 GGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMG 214 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 965 GGXGXXXGXXA--GGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G + GG GGG GG G G G G GG AG Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGG-MGGGMGGMMGGGSMGGGMMSMAG 175 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = +3 Query: 840 LPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 + P P P PP P P + PPP P P P Sbjct: 1421 MAPAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPAP 1463 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P P P P P P PPP Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = +2 Query: 782 PPRTA-PPXFXXPXXTPPXXPPTSPPXPP 865 PP +A PP PP PP PP PP Sbjct: 953 PPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXP 884 P S P P +PPPP P PP P Sbjct: 954 PTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P P P PPP PP PP Sbjct: 960 PPIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 394 PPVPSKPVHPTLPPXQIKPVPVYPTP 471 PP P+ + P +P Q+ P P+ P P Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLP 976 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P + PP+ PP TP PPT P PP Sbjct: 525 PTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXX-PXXTPPXXPPTSPPXPP 865 P P PP PP P +PP P PP PP Sbjct: 468 PPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 30.7 bits (66), Expect = 1.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP PP PPA P PP Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPP 481 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 G G G G GG GGG G G G G G G +G Sbjct: 250 GDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDG 293 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 S +P +P PP P P PP PP PP P Sbjct: 332 SDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +2 Query: 758 SPAPXHLSPPR--TAPPXFXXPXXTPPXXPPTSPPXPP 865 SP+P PP+ TAP F P TPP P+ P PP Sbjct: 612 SPSPPSRVPPQPETAPKPF--PNITPPEVRPSLPGTPP 647 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PP PP P P PP Sbjct: 316 PAPPNPYIPTAPPNPSIPPAPP--NPSIPPAPP 346 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/52 (28%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = +2 Query: 737 RXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXP----PTSPPXPPXXXXP 880 + P + + PP+ P TPP P PT+PP PP P Sbjct: 161 KPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETP 212 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP P PP PP P P Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSP 218 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P P PP P P P PP Sbjct: 189 PTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPP 222 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 1/50 (2%) Frame = +2 Query: 719 TTXXPFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPP-TSPPXPP 865 TT P P PAP + P T P P T P PP P PP Sbjct: 168 TTTKPETKPPKP--PAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPP 215 Score = 28.3 bits (60), Expect = 9.9 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPP-RTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P PAP SPP TAPP P TP PP SP PP P Sbjct: 182 PSTIPTPPTPPAPP--SPPIPTAPPTPPMPE-TP--LPPGSPHIPPAPLHP 227 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 394 PPVPSKPVHPTLPPXQIKPVPVYPTPAXRXH 486 PP P P PT PP P+P P P H Sbjct: 191 PPAPPSPPIPTAPP--TPPMPETPLPPGSPH 219 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPP-AXXPXXXPXP--PP 969 P P P PP P PP PP P P P PP Sbjct: 280 PAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPP 316 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPP-AXXPXXXPXP--PP 969 P P P PP P PP PP P P P PP Sbjct: 298 PAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPP 334 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.7 bits (66), Expect = 1.9 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPP 893 P P LPPPP P P P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPP 147 Score = 29.1 bits (62), Expect = 5.7 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPP 856 P +P P +PP PP P P PPT+PP Sbjct: 131 PPPPVTPPPGPETPP---PPDTPAPPVPPTEAPPTAPP 165 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP PPP P P P PP Sbjct: 123 PPPPTGTLP--PPPVTPPPGPETPPPPDTPAPP 153 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPP 966 PP PPP PP P P PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PPP PP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 1312 PPPPPPPPPPPPPPLPP 1328 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P S P P ++S + P +PP PP PP PP P Sbjct: 1284 PESQRLPHP-NISGQKANNKEQIQPPESPPPPPPPPPPPPPPPLPP 1328 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 776 LSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 + PP + PP P PP PP PP P Sbjct: 1305 IQPPESPPP---PPPPPPPPPPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPP 933 P P PP P PPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPP 1325 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 30.3 bits (65), Expect = 2.5 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P S P P +PPP P PP PP PPP P PPP Sbjct: 203 PNSQMPPNAPPGLMPPPGMLP---PPGGMPPGRMPPQGLPF------PPPGPIPPP 249 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 892 GGXGXGGXXWGXXGGGG 842 GG G GG WG GGGG Sbjct: 226 GGFGGGGGVWGNGGGGG 242 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 PP PPP PP P PPP Sbjct: 275 PPPGMPPPMPPGGMPPNMEQPPP 297 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/46 (30%), Positives = 15/46 (32%) Frame = +2 Query: 743 PXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P P + PP PP P PP P PP P Sbjct: 236 PPMGAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPP 281 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PP P P PPP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPP 81 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 403 PSKPVHPTLPPXQIKPVPVYPTP 471 P+ P+ PTLPP P P P P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPP 81 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.3 bits (65), Expect = 2.5 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTP-PXXP--PTSPPXPPXXXXP 880 PAP PP PP P P P P P PP PP P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 29.1 bits (62), Expect = 5.7 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPA-XXPXXXPXP 963 P P P PP P P P PP P P P Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPPGPDGPMGLPGP 1684 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 901 PPXPXPPPXPPAXXPXXXPXPPP 969 P P PP PP P P PPP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPP 305 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 403 PSKPVHPTLPPXQIKPVPVYPTP 471 P+ P+ PTLPP P P P P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPP 305 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXG--XXXXGXXGLGXXGGRWEGXAG 828 GG G GG GG G GG G G G G GG + G G Sbjct: 756 GGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRG 803 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGG 845 G GG G GGG R GG G G +G GG Sbjct: 781 GHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGG 823 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGG--XGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG GG G GG G G G GG +G G Sbjct: 768 GGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGG 816 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPP 966 P PP P PP P P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 29.9 bits (64), Expect = 3.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P P PP P+ P P PPP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPP 808 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 910 PXPPPXPPAXXPXXXPXPPP 969 P PPP PPA P PPP Sbjct: 83 PPPPPPPPASNVPAPPPPPP 102 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 904 PXPXPPPXPPAXXPXXXPXPP 966 P P PPP P + P P PP Sbjct: 82 PPPPPPPPPASNVPAPPPPPP 102 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 29.9 bits (64), Expect = 3.3 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEG 837 GG G G GG GGG GG G G G GGR +G Sbjct: 177 GGDDGGDGGDDGGGSGGGGDDGGSDG------GGGGNDGGRDDG 214 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 785 PRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P T PP P PP PPT PP P P Sbjct: 26 PPTDPPT--DPPTDPPTDPPTDPPTDPPTDPP 55 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 788 RTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 +T PP P PP PPT PP P P Sbjct: 23 QTDPPT--DPPTDPPTDPPTDPPTDPPTDPP 51 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +2 Query: 761 PAPXHLSPPRTA-PPXFXXPXXTPPXXPPTSPPXP 862 PAP L P T PP P PP PPT+ P Sbjct: 899 PAPVPLQPYNTPMPPISSTPYQAPPTLPPTTLTTP 933 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 G GG GGG GG G G G G GG Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 101 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXG 876 GGG G G GGG G GG G G Sbjct: 82 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 >SB_21829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 764 APXHLSPPRTAPPXFXXPXXTPPXXPP 844 AP ++SPP +PP P +PP P Sbjct: 329 APPYVSPPYVSPPYVSPPYVSPPYVSP 355 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +2 Query: 731 PFRXPXSXXSP--APXHLSPPRTAPPXFXXPXXTPPXXPPT--SPP 856 P+ P P +P +++PP APP PP PT +PP Sbjct: 236 PYVTPPYVTPPYVSPSYVAPPYVAPPYVAPTFVAPPYVAPTFVAPP 281 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -3 Query: 968 GGGXGXXXGXXAGGX---GGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GG G G AGG GGG GG G G GG G GV Sbjct: 124 GGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGV 174 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 944 GXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 G GG GGG GG G G G G GG Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGG 116 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXG 876 GGG G G GGG G GG G G Sbjct: 97 GGGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 3.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P PP PP P P PP Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 797 PPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 PP P PP PP P PP P P Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPT-SPPXP 862 P P PP T PP P P P T +PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GGG G GG G G G G G G GG + G AG Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGG-GGGGGHFSGGAG 318 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 737 RXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXP 862 + P +P P ++ P APP +PP PP P P Sbjct: 281 KAPVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMP 322 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 749 SXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPT--SPPXPP 865 S + P PP P F PP PPT +PP PP Sbjct: 275 SQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPP 315 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP PP PP P PPP Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPP 327 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 767 PXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P H P APP F PP PP PP P Sbjct: 265 PYHGGPFNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPP 302 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXG 891 GGG G G GG GGG G GG G Sbjct: 412 GGGRGYYRGGRGGGRGGG-GRGGRGG 436 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.5 bits (63), Expect = 4.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 843 PPPPXXPQXXPPXPXPP 893 PPPP P PP P PP Sbjct: 424 PPPPPPPAPLPPPPPPP 440 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXP 945 P PP P PPP PP P Sbjct: 426 PPPPPAPLPPPPPPPPQP 443 Score = 28.3 bits (60), Expect = 9.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 916 PPPXPPAXXPXXXPXPP 966 PPP PPA P P PP Sbjct: 425 PPPPPPAPLPPPPPPPP 441 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 827 PPXXPPTSPPXPPXXXXPXXXXP 895 PP PPT PP PP P P Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQP 453 Score = 29.5 bits (63), Expect = 4.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P P P P P P P P Sbjct: 432 PTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP PP PPP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 4.3 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAGV 825 GGG G GG G G G GG G GG G GV Sbjct: 6 GGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGV 53 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 29.5 bits (63), Expect = 4.3 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -1 Query: 967 GGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGGRXXRGCXXGXXEXG 800 GGG G GG GG G GG G GGG GC G G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEG-GYGMGGGDYSGGCGYGSSYGG 195 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXPXXXXP 895 P P + P A P P PP P + P PP P P Sbjct: 362 PPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIP 406 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +3 Query: 180 IVLLLAFAGIECRKTYKPIDKNANIDFINMEAGGARPVGKPTDK 311 I L A G++CR + + NI +N+E GA+PV +P K Sbjct: 245 IHLKCARLGLKCRLGRELRNSKINIWLLNLENLGAKPVKRPLSK 288 >SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) Length = 178 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G G G R G G +G GGGG Sbjct: 41 GHGGGHGGGRGRGRGHGHGGDVGGDDGDGGNCDGDGYGDVGGGG 84 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXP 957 P P PP P PPP PP P Sbjct: 75 PLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPP 933 P P PP P PPP PP Sbjct: 74 PPLCAPPPPPPPPPPPPPP 92 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.1 bits (62), Expect = 5.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPPAXXPXXXP 957 P P PP P PPP PP P Sbjct: 276 PLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 877 PXXXXPXXPPXPXPPPXPP 933 P P PP P PPP PP Sbjct: 275 PPLCAPPPPPPPPPPPPPP 293 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG GG G G GG Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGG 849 GG G G GG GGG G G G GL G Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCG 525 >SB_34751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 892 PXXPPXPXPPPXPPA 936 P PP P PPP PPA Sbjct: 680 PARPPPPIPPPHPPA 694 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 29.1 bits (62), Expect = 5.7 Identities = 20/54 (37%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = -3 Query: 968 GGGXGXXXGXX-AGGXGGGXG-XGGXXGXXXXG----XXGLGXXGGRWEGXAGV 825 GGG G G GG GGG G GG G G G+G G +G G+ Sbjct: 1097 GGGQGMMMGNAMGGGMGGGMGMQGGGMGMQGGGMGMQDGGMGMGDGMMQGMQGM 1150 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +3 Query: 801 PXSXXPXXHPRXXLPPPPXXPQXXPPXPXPPXXXXXXXXXXXXXRXXPPPXPXPPP 968 P P PR P P PP P P + P P PPP Sbjct: 863 PVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPPP 918 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 29.1 bits (62), Expect = 5.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 892 PXXPPXPXPPPXPPA 936 P PP P PPP PPA Sbjct: 375 PFAPPPPPPPPPPPA 389 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPPXXXXP 880 P P PP PP P P P P PP P Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGP 71 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PP P PP PP P P P Sbjct: 707 PGLPGPPGPASPPSPPGPPGPPG--PNGPPGP 736 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PP P PP PP P P P Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPG--PKGPPGP 821 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXP 963 P P P PP P PP PP P P P Sbjct: 877 PGLPGPPGPASPPSPPGPPGPPG--PKGPPGP 906 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP P PP PP P PP Sbjct: 114 PPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP P P PP Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PP P PP P P PP Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P + P PP P P PP PP PP Sbjct: 1254 PPPPGMRPMPPQPPFMPPPPRMQPPGPP-GPPGPP 1287 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPP 966 P P P P P PP PP P P PP Sbjct: 1253 PPPPPGMRPMPPQPPFMPP-PPRMQPPGPPGPP 1284 >SB_38437| Best HMM Match : VWA (HMM E-Value=0) Length = 3445 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/25 (52%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +1 Query: 394 PPVPSK-PVHPTLPPXQIKPVPVYP 465 P P+K P PT PP KP PV P Sbjct: 1428 PTKPTKRPTRPTRPPKPTKPAPVPP 1452 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 28.7 bits (61), Expect = 7.5 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +2 Query: 758 SPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 SP P S PR PP P TP PPT P PP Sbjct: 1352 SPIP---STPRPRPPTPPRPP-TPRPRPPTPRPGPP 1383 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G GG G G GG G G G GG++ G G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGY-GFAGYGGQYGGPRG 1310 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 28.7 bits (61), Expect = 7.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 910 PXPPPXPPAXXPXXXPXPPP 969 P PPP PP P PPP Sbjct: 661 PPPPPPPPGGQAGGAPPPPP 680 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 868 PXXPXXXXPXXPPXPXPPPXPPAXXPXXXPXPPP 969 P P P PPP PP P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Frame = +1 Query: 892 PXXPPXPXP----PPXPPAXXPXXXPXPPP 969 P PP P P PP PP P PPP Sbjct: 676 PPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 4/30 (13%) Frame = +1 Query: 892 PXXPPX----PXPPPXPPAXXPXXXPXPPP 969 P PP P PPP PP P PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 >SB_14418| Best HMM Match : GRP (HMM E-Value=1.8) Length = 145 Score = 28.7 bits (61), Expect = 7.5 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = -3 Query: 968 GGGXGXXXGXX-AGGXGGGXGXGGXXGXXXXGXXGLGXXGGRW 843 G G G G GG G G G G G G G GRW Sbjct: 70 GHGDGDGDGDSDGGGDGDGDGDGDGDSDSDGGGDGDGDGDGRW 112 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 965 GGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLG 861 GG G G GG GGG GG G G G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGG 505 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 28.3 bits (60), Expect = 9.9 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -3 Query: 968 GGGXGXXXGXXAGGXGGGXGXGGXXGXXXXGXXGLGXXGGRWEGXAG 828 GG G G GGG GG G G G GG G AG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAG-NGGAGGGGAG 462 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 785 PRTAPPXFXXPXXTPPXXPPTSPPXP 862 P TAPP P TPP PP +P P Sbjct: 232 PPTAPPNTPPPPVTPP--PPNTPGPP 255 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 9.9 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 8/55 (14%) Frame = -3 Query: 968 GGGXGXXXGXXA----GGXGGGXGXGGXXGXXXXGXXGLGXXGG----RWEGXAG 828 GGG G G GG GG G G G G G GG W G G Sbjct: 196 GGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWSGGYG 250 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +3 Query: 816 PXXHPRXXLPPPPXXPQXXPPXPXPP 893 P P PPPP + PP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 892 PXXPPXPXPPPXPPAXXPXXXPXPPP 969 P PP PPP P P P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +1 Query: 904 PXPXPPPXP-PAXXPXXXPXPPP 969 P PPP P PA P P PPP Sbjct: 299 PAAAPPPPPLPAGVPAPPPPPPP 321 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.3 bits (60), Expect = 9.9 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -1 Query: 973 GXGGGXGXGGGXXRXXXXXXXXXXGXXGGXGXGGXXWGXXGGGG 842 G GGG G GGG GG G GG +G GGGG Sbjct: 101 GRGGGGGYGGG----------------GGYGGGGRSYGGGGGGG 128 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 761 PAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 PAP SPP PP P +PP P +P P Sbjct: 522 PAPQPPSPP-APPPKPAPPPRSPPAAAPCNPAMAP 555 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +2 Query: 731 PFRXPXSXXSPAPXHLSPPRTAPPXFXXPXXTPPXXPPTSPPXPP 865 P P S P P P P P PP PP PP Sbjct: 135 PMHPPLSNTRHNPKVAVPHPNTPYYHPKPADPAPMQPPAPPPSPP 179 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,308,448 Number of Sequences: 59808 Number of extensions: 455276 Number of successful extensions: 7217 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 1453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4412 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2872045441 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -