BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O22 (981 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 95 6e-20 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 95 6e-20 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 5e-19 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 7e-19 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 1e-18 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-18 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 90 2e-18 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 1e-14 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 76 4e-14 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 75 9e-14 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 75 1e-13 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 69 4e-12 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 56 4e-08 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 50 3e-06 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 50 4e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 50 4e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 48 1e-05 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 48 1e-05 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 48 1e-05 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 47 2e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 46 4e-05 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 45 8e-05 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 45 8e-05 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 45 8e-05 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 45 8e-05 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 45 8e-05 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 45 8e-05 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 45 8e-05 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 45 8e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 45 8e-05 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 45 8e-05 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 45 8e-05 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 45 8e-05 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 45 8e-05 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 45 8e-05 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 45 8e-05 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 45 8e-05 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 45 8e-05 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 45 8e-05 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 45 8e-05 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 45 8e-05 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 45 8e-05 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 45 8e-05 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 45 8e-05 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 45 8e-05 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 45 8e-05 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 45 8e-05 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 45 8e-05 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 45 8e-05 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 45 8e-05 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 45 8e-05 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 45 8e-05 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 45 8e-05 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 45 8e-05 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 45 8e-05 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 45 8e-05 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 45 8e-05 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 45 8e-05 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 45 8e-05 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 45 8e-05 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 45 8e-05 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 45 8e-05 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 45 8e-05 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 45 8e-05 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 45 8e-05 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 45 8e-05 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 45 8e-05 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 45 8e-05 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 45 8e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 45 8e-05 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 8e-05 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 45 8e-05 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 45 8e-05 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 45 8e-05 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 45 8e-05 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 45 8e-05 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 45 8e-05 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 45 8e-05 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 45 8e-05 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 45 8e-05 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 45 8e-05 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 45 8e-05 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 45 8e-05 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 45 8e-05 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 45 8e-05 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 45 8e-05 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 45 8e-05 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 45 8e-05 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 45 8e-05 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 45 8e-05 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 45 8e-05 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 45 8e-05 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 45 8e-05 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 45 8e-05 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 45 8e-05 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 45 8e-05 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 45 8e-05 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 8e-05 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 45 8e-05 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 45 8e-05 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 45 8e-05 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 45 8e-05 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 45 8e-05 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 45 8e-05 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 45 8e-05 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 45 8e-05 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 45 8e-05 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 45 8e-05 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 45 8e-05 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 95.5 bits (227), Expect = 6e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 291 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYXLTQRR 422 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERY LTQRR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 95.5 bits (227), Expect = 6e-20 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +3 Query: 291 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYXLTQRR 422 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERY LTQRR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 92.3 bits (219), Expect = 5e-19 Identities = 41/50 (82%), Positives = 41/50 (82%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE*XD 403 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE D Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 91.9 bits (218), Expect = 7e-19 Identities = 40/47 (85%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 91.5 bits (217), Expect = 1e-18 Identities = 41/54 (75%), Positives = 43/54 (79%) Frame = -1 Query: 573 GSIFVXVVQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 G I + + GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 50 GYIELDLNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 90.6 bits (215), Expect = 2e-18 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAF+ Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 90.2 bits (214), Expect = 2e-18 Identities = 39/45 (86%), Positives = 39/45 (86%) Frame = -1 Query: 546 GGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 GGR LW NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 93 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 86.6 bits (205), Expect = 3e-17 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -1 Query: 543 GRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 GR LW NASN AFLRF A CWPFAHMF+PALSPDS DNRITAFE Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 81.4 bits (192), Expect = 1e-15 Identities = 37/47 (78%), Positives = 37/47 (78%) Frame = -1 Query: 552 VQGGRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 V GGR LW NASN AFLRF A WPFAHMFF ALSPD DNRITAFE Sbjct: 15 VSGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 78.2 bits (184), Expect = 1e-14 Identities = 34/38 (89%), Positives = 34/38 (89%) Frame = -1 Query: 525 NASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE 412 NASN AFLRF A CWPFAHMFFPALSPDS DNRITAFE Sbjct: 24 NASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 76.2 bits (179), Expect = 4e-14 Identities = 41/76 (53%), Positives = 41/76 (53%) Frame = -1 Query: 543 GRXLWXNASNXAFLRFRALCWPFAHMFFPALSPDSXDNRITAFE*XDXXXXXXXXXXXXX 364 GR LW NASN AFLRF A CWPF HMF PALSPDS D ITAFE D Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIARSSRMHERRES 61 Query: 363 XXXXXXXRPIRKPPLP 316 R IRK LP Sbjct: 62 VSEEAEERSIRKQTLP 77 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 74.9 bits (176), Expect = 9e-14 Identities = 37/53 (69%), Positives = 39/53 (73%) Frame = +3 Query: 438 QNQXITQERTCEQKASTXPGTVKRPRCWRXXIGXAPPEPPSQKSTPQVRGGET 596 +NQ ITQERTCEQKAS PGTVKRPRCWR IG AP + K QVRGGET Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSIT-KIDAQVRGGET 165 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 74.5 bits (175), Expect = 1e-13 Identities = 37/52 (71%), Positives = 38/52 (73%) Frame = +3 Query: 441 NQXITQERTCEQKASTXPGTVKRPRCWRXXIGXAPPEPPSQKSTPQVRGGET 596 NQ ITQERTCEQKAS PGTVKRPRCWR IG AP + K QVRGGET Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPRCWRFSIGSAPLTSIT-KIDAQVRGGET 136 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 69.3 bits (162), Expect = 4e-12 Identities = 28/52 (53%), Positives = 28/52 (53%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP SPP P P PPPP P P PP PPPPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 67.3 bits (157), Expect = 2e-11 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P P PPPP P P PP PPPPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 65.3 bits (152), Expect = 7e-11 Identities = 27/52 (51%), Positives = 29/52 (55%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P+ P +PPPP P P PP PPPPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPP---PPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 64.9 bits (151), Expect = 9e-11 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P P PPPP P P P PPPPPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 64.5 bits (150), Expect = 1e-10 Identities = 27/52 (51%), Positives = 27/52 (51%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P P PPPP P P PP PPPPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPP-PPPPPPPPPPAPPPPPPPPPPP 430 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P P PPPP P P P PPPPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 64.1 bits (149), Expect = 2e-10 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPP P P PP PP P P PPPP P P PP PPPPPP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 60.9 bits (141), Expect = 2e-09 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P PP PP P PPPP P P PP PPPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 60.9 bits (141), Expect = 2e-09 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPP P P PP PP P P PPPP P P PP PPP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 43.6 bits (98), Expect = 3e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 885 SPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 SPP P P P PP P P PP PPPPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 35.1 bits (77), Expect = 0.088 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPP 926 P PPPP P P PP PP P PP Sbjct: 407 PPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 884 LPPPSKXNXPPXPPPXXXPPXXPPRXXPPXP 976 + PP PP PP PP PP PP P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPP 393 Score = 32.3 bits (70), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPP 932 P PPPP P P PP PP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 31.9 bits (69), Expect = 0.82 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 863 PXPHXXXLPPPSKXNXPPXPPPXXXPPXXPPRXXPP 970 P P PPP PP PPP PP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.1 bits (62), Expect = 5.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 905 NXPPXPPPXXXPPXXPPRXXPPXP 976 N P PPP PP P PP P Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPP 385 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 772 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 14 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 37 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 419 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 568 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 36 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 67.3 bits (157), Expect = 2e-11 Identities = 34/43 (79%), Positives = 34/43 (79%) Frame = -2 Query: 506 FYGSGXCAGLLLTCSFLRYXXXXXITVLPPLSEXIPLAAAERP 378 FYGS AGLLLTCSFLRY ITVLPPLSE IPLAAAERP Sbjct: 14 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 58.4 bits (135), Expect = 8e-09 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPPP P P P PP PN +P P PP P P P PPPP P Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 58.0 bits (134), Expect = 1e-08 Identities = 28/55 (50%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = +3 Query: 822 PKXXPP-PPXPXPLXXPPTXXXSPPXPNXXFPXRP--PPPXXPXPXPPXPPPPPP 977 P PP PP P PL PP +PP PN +P P PPP P P PP PP PPP Sbjct: 147 PYPPPPNPPYPPPLYPPPP---NPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 57.6 bits (133), Expect = 1e-08 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP P P PP PP PN +P P PP P PP P PPPP Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Score = 57.2 bits (132), Expect = 2e-08 Identities = 27/54 (50%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +3 Query: 822 PKXXPPP--PXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPP P P P PP PP PN P PPPP P P PP PP PPP Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPN---PPYPPPPNAPNPPPPNPPYPPP 214 Score = 55.2 bits (127), Expect = 8e-08 Identities = 23/52 (44%), Positives = 24/52 (46%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP P P PP PP PN +P P P P P P PPPP P Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Score = 54.8 bits (126), Expect = 1e-07 Identities = 25/53 (47%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +3 Query: 822 PKXXPP-PPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PP PP P P PP PP PN P P PP P P P PP PPP Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 54.0 bits (124), Expect = 2e-07 Identities = 24/54 (44%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPP--PPP 977 P P PP P PP PP PN +P P P P P PP PPP PPP Sbjct: 111 PPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/51 (43%), Positives = 24/51 (47%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 P P PP P P PP +PP PN +P P P P P PP P PP Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Score = 53.2 bits (122), Expect = 3e-07 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPPP P P PP PP PN P PPPP P P PP PP PPP Sbjct: 95 PPPPYP-PYPPPPPY---PPPPN---PPYPPPPNAPYPPPPNPPYPPP 135 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP P PP PP P P PPPP P P PP PPPP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPP-PLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 52.0 bits (119), Expect = 7e-07 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP P PP PP PN P PPPP P P P PPPP P Sbjct: 190 PPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP--PYPPPPNP 239 Score = 51.2 bits (117), Expect = 1e-06 Identities = 25/58 (43%), Positives = 26/58 (44%), Gaps = 6/58 (10%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPP------PPPP 977 P PP P P P PP PP PN +P P PP P P P PP PPPP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPP-PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Score = 50.4 bits (115), Expect = 2e-06 Identities = 24/55 (43%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXS-PPXPNXXFPXR--PPPPXXPXPXPPXPPPPPP 977 P PP P P PP+ PP PN +P PPPP P P P PPPP P Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPP 971 PPP P P PP PP P P PP P P P PP PPPP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPP-PPNPPYP--PPPNPPYPPPP 199 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/38 (52%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 867 PPTXXX-SPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPT +PP P +P PPPP P P PP PP PPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPP--PYPPPPNPPYPPP 119 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 56.0 bits (129), Expect = 4e-08 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPPP PP S P P P PPPP P PP PPPPPP Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 43.6 bits (98), Expect = 3e-04 Identities = 23/57 (40%), Positives = 24/57 (42%), Gaps = 5/57 (8%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPP---TXXXSPPXPNXXFPXRPPPPXXPXPXPPX--PPPPPP 977 P PPP PL PP + PP P P PPPP P P PP PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/52 (42%), Positives = 23/52 (44%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PPP P P P PP P P +PPPP P PPPPPP Sbjct: 915 PGGSVPPPPPPPGGNAPLP---PPPPGGSAPSQPPPPGGNAP----PPPPPP 959 Score = 35.9 bits (79), Expect = 0.050 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 7/48 (14%) Frame = +3 Query: 855 PLXXPP--TXXXSPPXPNXXFPXRPPPPXXPXPXPPXP-----PPPPP 977 P PP + PP P P PPPP P P P PPPPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP 957 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 4/42 (9%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXP----NXXFPXRPPPPXXPXP 947 PPPP P PP +PP P P PPPP P P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 Query: 884 LPPPSKXNXPPXPPPXXXPPXXPPR 958 LPPP + PP PPP PP P R Sbjct: 973 LPPPPGGSAPP-PPPPPPPPPPPMR 996 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 56.0 bits (129), Expect = 4e-08 Identities = 26/48 (54%), Positives = 27/48 (56%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGG 833 GGGGGG GG G G GGGG G G GG+ GG G G GGGG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGG 109 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/50 (50%), Positives = 25/50 (50%) Frame = -3 Query: 970 GGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGG GG G G GGGG G G GG GG G G GGGG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG GG G G G G G G GG GG G G G G FG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXP---PPPPP 977 P PPP P PPT PP P P PPPP P PP P PPPPP Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXP---PPPPP 977 PPP P PPT PP P P PPPP P PP P PPPPP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 50.4 bits (115), Expect = 2e-06 Identities = 23/51 (45%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPP---PPPP 977 PPPP P PP +PP P PPPP P PP PP PPPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Score = 48.4 bits (110), Expect = 9e-06 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 834 PPPPXPX---PLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPPP P P PPT PP P P PPPP P PP P PP Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/51 (49%), Positives = 25/51 (49%), Gaps = 3/51 (5%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPP---XPPPPPP 977 PPPP P PP SPP P P PPP P P PP PPPPPP Sbjct: 346 PPPP---PTNNPP----SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +3 Query: 885 SPPXPNXXFPXRPPPPXXPXPXPPXP---PPPPP 977 +PP P P PPPP P PP P PPPPP Sbjct: 345 NPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPP 378 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXP 947 P PPP P PPT PP P P PPPP P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 28.7 bits (61), Expect = 7.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 912 PXRPPPPXXPXPXPPXPP 965 P PPPP P PP PP Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 50.0 bits (114), Expect = 3e-06 Identities = 27/53 (50%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 976 GGGGGGXGG-XGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG GG G G GGGG G G GG GG G G GGGG G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGG 821 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG GG G G GG G G G G GG G G GGGG G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG G G G GG G G G GG GG G G GGGG G Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 48.8 bits (111), Expect = 7e-06 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGG G GG G G GGGG G G G GG G G GG G +G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Score = 48.8 bits (111), Expect = 7e-06 Identities = 26/52 (50%), Positives = 26/52 (50%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG GG G G GGG G FG GG G G G GGGG G Sbjct: 812 GGGGGGGGGGGGGGDGGGYGDGG-GFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 48.4 bits (110), Expect = 9e-06 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GG GG G G GGGG G G GG+ G G G GGGG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 48.4 bits (110), Expect = 9e-06 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGG GG G G GGGG G G G GG G G GGGG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 48.4 bits (110), Expect = 9e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGG 833 GGGGGG GG G G G GG G G GG GG G G G GG Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGG 834 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGG 836 GGGGGG GG G G GGG G G GG GG G G GGG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 47.6 bits (108), Expect = 2e-05 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG G G GG G G GGGG +G GG GG G G GGGG G Sbjct: 805 GGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGG 856 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GGG G G G GGGG G G GG G G G GGGG G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 46.0 bits (104), Expect = 5e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 G GGGG G G G GGGG G GG GG G G GGGG G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/52 (44%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GGG GG G G GGGG +G G GG G G GGG G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGG 833 GGGGGG GG G G G G G GG GG G G G GG Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGG GG G G G GGG G GG GG G G GGGG G Sbjct: 823 GGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GGG G G GGG G G GG GG G G GGGG G Sbjct: 824 GGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGG 887 GGGGGG GG G G GGGG G G GG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXI 905 GGGGGG GG G G GGGG G I Sbjct: 855 GGGGGGGGGGGGGGGGGGGGGGVI 878 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXI 905 GGGGGG GG G G GGGG G + Sbjct: 854 GGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGG 839 GGG G GG G GGGG G G GG GG G G GG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGG--GGGGGGGGGGGGGGGGGGGGG 876 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/52 (48%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GGG GG G G GGGG G G GG GG G G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGG 836 GGGGGG GG G G GGGG G G GG GG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 46.8 bits (106), Expect = 3e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 G GG G GG G G GGGG G G GG GG G G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXG 890 GGGGGG GG G G GG G G G Sbjct: 688 GGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 975 GXGGXXRGGXXGGXXXGGGXGGXFXLXGGGRXXXWGXG 862 G GG GG GG GGG GG G G G G Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/48 (45%), Positives = 23/48 (47%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPPP P P PP PP P+ P PPPP P P P PPP Sbjct: 204 PPPPPPRPPPSPPPPPP-PPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Score = 48.4 bits (110), Expect = 9e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +3 Query: 867 PPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P PP P P PPPP P P PP PPPPPP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = +3 Query: 840 PPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 P P + PP PP P+ P PPPP P P P PPPPP Sbjct: 195 PTSPSQITQPPPPPPRPP-PS---PPPPPPPPSPSPPRPPPPPPP 235 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPP 968 P PPPP P P P P P P PP P P PPP Sbjct: 213 PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 888 PPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P+ PPPP P PP PPPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSP 224 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 48.0 bits (109), Expect = 1e-05 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +3 Query: 888 PPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PP P P PPPP P P PP PPPPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/31 (54%), Positives = 18/31 (58%) Frame = +3 Query: 885 SPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 +PP P P PPPP P P PP PPPPP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 PPPP P P PP P P PPPP P P PP PPP P Sbjct: 464 PPPPPPPP----------PPPP----PPPPPPPPPPPPFPPPPPPTP 496 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 48.0 bits (109), Expect = 1e-05 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXP----XPPXPPPPPP 977 PPPP P L PP P PPPP P P PP PPPPPP Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/51 (43%), Positives = 24/51 (47%) Frame = +3 Query: 825 KXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 K PPPP P P+ + PP P P PP P PP PPPPPP Sbjct: 674 KKVPPPPPPLPVIEGSSLSVPPPPP----PPPPPLLSGTLPMPPPPPPPPP 720 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPPP P PP PP P PPPP P P PPPPP Sbjct: 715 PPPPPPGCAGLPPP----PPSPQPGCAGLPPPPPPPPPGCAGLPPPPP 758 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 834 PPPPXPXP--LXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPP 956 PPPP P P PP PP P PPPP P P Sbjct: 727 PPPPSPQPGCAGLPPPP---PPPPPGCAGLPPPPPPIDVPMKP 766 Score = 29.9 bits (64), Expect = 3.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 863 PXPHXXXLPPPSKXNXPPXPPPXXX--PPXXPPRXXPPXP 976 P P LPPP PP PPP PP PP P P Sbjct: 732 PQPGCAGLPPP-----PPPPPPGCAGLPPPPPPIDVPMKP 766 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/52 (50%), Positives = 27/52 (51%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGG G GG G G GGGG G +G GG GG G G GGGG G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGG-GYGGGGYGGG-GGGYGGSGYGGGGGYGG 216 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/52 (48%), Positives = 26/52 (50%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGG G GG G G GGGG G +G GG G G G GGGG G Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGG-GYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 47.6 bits (108), Expect = 2e-05 Identities = 24/52 (46%), Positives = 25/52 (48%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGG GG G G GGGG + GG GG RG G GGGG G Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGG 174 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/52 (48%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -3 Query: 973 GGGGGXGGXGXGXXG-GGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGG G G G G GGG G +G GG GG G G GGGG +G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHG---GGGYGGGGYGGGGGGYG 204 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/48 (47%), Positives = 24/48 (50%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGG 833 GGG GG G G G GGGG G +G GG GG G G GGG Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGG---GYGGGGYGGGRSGGG 227 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGG-GGXXFG 821 GG GGG GG G GGG R G G GG G G G GG GG +G Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Score = 35.5 bits (78), Expect = 0.066 Identities = 23/53 (43%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGGGGRXGXIXF-GXG-GEXXXVGGXXRGXGXGGGGXXFG 821 GGGGG G GGG R G + G G G GG G G GGGG G Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 35.5 bits (78), Expect = 0.066 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -3 Query: 970 GGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGG GG G GGG R G G GG G G GGGG G Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 32.3 bits (70), Expect = 0.62 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGG 920 GGGG G GG G G GGGG Sbjct: 210 GGGGYGGGGYGGGRSGGGG 228 Score = 31.9 bits (69), Expect = 0.82 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGE 884 GGG GG G G G GGGG G G G E Sbjct: 200 GGGYGGSGYGGGGGYGGGGYGGGRSGGGGYE 230 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGG 887 GGGG G G G G GGG G G GG Sbjct: 199 GGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/52 (44%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPX----PXPPXPPPPPP 977 PPPP P P P + P P P PPPP P P PP P PPPP Sbjct: 50 PPPPPPSP----PAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 46.8 bits (106), Expect = 3e-05 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 834 PPPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPP 968 PPPP P PP + P P P PPPP P P PP PP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 P P PP P PP P P PPP P P PP PP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 887 PPPSKXNXPPXPP--PXXXPPXXPPRXXP 967 PPP PP PP P PP PP P Sbjct: 86 PPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 47.2 bits (107), Expect = 2e-05 Identities = 36/90 (40%), Positives = 43/90 (47%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLTQRR*YGYPQNQXITQERTCEQKASTXPGTVK 506 +C G +PLPRSLTR ARSF CGER LT + R + V+ Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLTN------GGGDFLEDARKILNR------EVR 144 Query: 507 RPRCWRXXIGXAPPEPPSQKSTPQVRGGET 596 PR R IG AP + KS Q+ GGET Sbjct: 145 GPRQSRFSIGSAPLTSIT-KSDAQISGGET 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/31 (67%), Positives = 23/31 (74%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLTQR 419 +C G +PLPRSLTR ARSF CGER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 3/50 (6%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXP---XPPXPPPPP 974 PPPP P PP PP P P P PP P P PP PP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/50 (42%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPP--PPPP 977 PPP + PP PP F PPPP P PP PP PPPP Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPP 1273 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 837 PPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXP 953 PPP P PP PP P P P PP P P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 30.7 bits (66), Expect = 1.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 867 PPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPP 974 PPT PP N P PP PPPPP Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPP 1239 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 5/57 (8%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXP-----PPPPP 977 P P P P+ T P P PPP P P PPPPP Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPP 1257 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 4/50 (8%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXS----PPXPNXXFPXRPPPPXXPXPXPPXPPPP 971 PPPP P P P S PP P F PPPP PP PPPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 8/38 (21%) Frame = +3 Query: 888 PPXPNXXFPXRPPPPXXPXPXPP--------XPPPPPP 977 PP P+ PPPP P P PPPPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPP 306 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 46.4 bits (105), Expect = 4e-05 Identities = 22/51 (43%), Positives = 24/51 (47%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXF 824 G GGGG G G G GGGG G G G +G G G GGGG + Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGY 1847 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/52 (50%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGG-XXRGXGXGGGGXXFG 821 GGGGG G G G GGG G FG GGE GG G G GGGG G Sbjct: 1768 GGGGGMAGGGGGMGGGGMAAGGGEFG-GGEGMGGGGMAGGGGGMGGGGGGMG 1818 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/52 (44%), Positives = 23/52 (44%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG G G G GGGG G GG G G G GGG G Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMG 1811 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/52 (46%), Positives = 24/52 (46%) Frame = -3 Query: 976 GGGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGGG GG G GGGG G GGE G G GGGG G Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGG 1812 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGG G GG G GGG G G GGE G G G GGG G Sbjct: 1793 GGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/54 (44%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -3 Query: 976 GGG--GGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGG GGG G G G GGGG G G GG +G G G GG G G Sbjct: 1788 GGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAG 1841 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/53 (45%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGG--GGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGGGG GG G GG GG G G G +GG G G GGGG G Sbjct: 1775 GGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG--GGGMGGGGEGMG 1825 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -3 Query: 973 GGGGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GG GG GG G GGG G G GG G G G GGGG G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 38.7 bits (86), Expect = 0.007 Identities = 25/55 (45%), Positives = 26/55 (47%), Gaps = 3/55 (5%) Frame = -3 Query: 976 GGG---GGGXGGXGXGXXGGGGRXGXIXFGXGGEXXXVGGXXRGXGXGGGGXXFG 821 GGG GGG G G G GGGG G G GG +GG G G GGG G Sbjct: 1782 GGGMAAGGGEFGGGEGM-GGGGMAGG-GGGMGGGGGGMGGGGEGMGAAGGGMGAG 1834 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 46.0 bits (104), Expect = 5e-05 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = +3 Query: 912 PXRPPPPXXPXPXPPXPPPPPP 977 P RPPPP P P PP PPPPPP Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 918 RPPPPXXPXPXPPXPPPPPP 977 R P P P PP PPPPPP Sbjct: 858 RRPRPRPRRPPPPPPPPPPP 877 Score = 32.7 bits (71), Expect = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 918 RPPPPXXPXPXPPXPPPPPP 977 RP P P PP PPPPPP Sbjct: 859 RPRPRPRRPPPPPPPPPPPP 878 Score = 30.7 bits (66), Expect = 1.9 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 887 PPPSKXNXPPXPPPXXXPPXXPP 955 P P + PP PPP PP PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPP 884 Score = 30.3 bits (65), Expect = 2.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 887 PPPSKXNXPPXPPPXXXPPXXPP 955 P P PP PPP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +3 Query: 834 PPPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPP----PXXPXPXPPXPPPPPP 977 PPP P P PP T P PN P PPP P P P P P PPP Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPP 115 Score = 42.3 bits (95), Expect = 6e-04 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = +3 Query: 834 PPPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPP----PXXPXPXPPXPPPPPP 977 PPP P PP T P PN P PPP P P P P P PPP Sbjct: 33 PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPP 85 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSP--PXPNXXFPXRPPP----PXXPXPXPPXPPPPPP 977 PPP P P PP P P PN P PPP P P P P P PPP Sbjct: 53 PPPNIPIP-GNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP 105 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 834 PPPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PPP P P PP T P PN P PPP P P PPP P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPP---NTPIPGDPPPNTP 118 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +3 Query: 834 PPPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPP----PXXPXPXPPXPPPPPP 977 PPP P PP T PN P PPP P P P P P PPP Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPP 75 Score = 30.3 bits (65), Expect = 2.5 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +3 Query: 837 PPPXPXPLXXPP-TXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 PP P PP T P PN P R PPP P P P P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIP-RAPPPNTAIPGDRPPNTPIP 50 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/46 (43%), Positives = 21/46 (45%) Frame = +3 Query: 840 PPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P + P PP P P PPPP P P P PPPPPP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPP-PPPPPPPPPPPPQPSTPPPPPP 711 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 843 PXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP PP P P PPPP P PP PP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPP----PPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPP 968 P PPPP P P PP +PP P P PP P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPP---PSTPPVQQSGAPGSPAGSP 729 Score = 35.9 bits (79), Expect = 0.050 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPP 971 PPPP P P PP PP P P PPP P P P Sbjct: 685 PPPPPPPPPPPPP-----PPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 873 TXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 T +P P P P P PP PPPPPP Sbjct: 662 TISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPP 696 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXP-XPXPPXPPPPPP 977 P PPP P PP PP P PPPP P P P PP PP Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPP--PPPPGKPTKPTKPSLPPVPP 827 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 33.5 bits (73), Expect = 0.27 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNR TRGERRFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 888 PPXPNXXFPXRPPPPXXPXPXPPXPPPP 971 P P +P PPPP P P PP P P Sbjct: 1652 PWYPVFHYPA-PPPPPPPAPGPPGPDGP 1678 Score = 29.9 bits (64), Expect = 3.3 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 6/54 (11%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXP-NXXFPXRPP-PPXXPXPXP----PXPPPPPP 977 PPPP P P P P P P PP PP P P P P PP Sbjct: 1663 PPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P PP P PP + P PP P P P P PP P Sbjct: 1799 PPGPPGPPGAIGWKGNPGNPAGPPGLDG--PPGPPGPQGPKGWPGVPGPPGP 1848 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 837 PPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPP 971 PPP P P PP P P P P P P PP P P Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPG---PQGPDGPKGP-PGPPGLPGP 1702 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 Score = 31.5 bits (68), Expect = 1.1 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 822 PKXXPPPPXPXPLXXPPTXXXSPPXPNXXFPXRPPPPXXPXPXPPXPPPPPP 977 P P P P PP PP P PP P P P P PP Sbjct: 143 PSPPNPTEAPEPETVPPQPETVPPQPETV----PPQPGSEEPEPVSQAPEPP 190 Score = 29.9 bits (64), Expect = 3.3 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 834 PPPPXPXPLXXPPTXXXSPPXPNXXFP---XRPPPPXXPXPXPPXPPPP 971 P P P PP PP P P + P P P P PP P Sbjct: 154 PETVPPQPETVPPQPETVPPQPGSEEPEPVSQAPEPPKPKTSAPEPPKP 202 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 122 AALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 637 ICDTGYIPLPRSLTRYARSFDCGERKWLT 665 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 289 SALMNRPTRGERRFAYW 339 +ALMNRPTRGERRFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 45.2 bits (102), Expect = 8e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = +3 Query: 327 VCVLGALPLPRSLTRCARSFGCGERYXLT 413 +C G +PLPRSLTR ARSF CGER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +1 Query: 217 INKLTTTIAFILCFRFRGEVWEVFSALMNRPTRGERRFAYW 339 +++LT L RF V +ALMNRPTRGERRFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,602,495 Number of Sequences: 59808 Number of extensions: 464535 Number of successful extensions: 12596 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6417 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2907797044 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -