BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O21 (906 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0790 - 24636805-24637770 51 1e-06 06_01_0486 - 3455030-3455770 49 4e-06 02_04_0400 - 22608519-22608844,22609044-22609122 48 8e-06 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 48 1e-05 07_03_1751 - 29215074-29216270 48 1e-05 07_03_0558 + 19461369-19462448 48 1e-05 07_03_0177 - 14770777-14772045 48 1e-05 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 48 1e-05 08_01_0059 - 394001-394708 47 2e-05 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 47 2e-05 07_03_0560 + 19479597-19480667 47 2e-05 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 47 2e-05 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 46 4e-05 03_02_0765 + 11000724-11002496 46 4e-05 03_01_0515 - 3864796-3865425 46 4e-05 03_01_0023 + 198414-198968 46 4e-05 07_03_0559 + 19475893-19476783 46 5e-05 06_03_1326 - 29355467-29355817 45 7e-05 09_04_0506 - 18188785-18190599 45 1e-04 07_01_0080 + 587674-588510 45 1e-04 01_01_0570 - 4231100-4232560 45 1e-04 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 44 1e-04 06_01_0178 + 1386981-1387505 44 1e-04 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 44 1e-04 12_02_1174 - 26696869-26698191 44 2e-04 10_08_0880 + 21267034-21267537 44 2e-04 06_02_0175 - 12624608-12625297 44 2e-04 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 44 2e-04 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 44 2e-04 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 44 2e-04 02_05_0686 - 30900748-30902167,30903442-30904742 44 2e-04 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 43 3e-04 06_02_0126 + 12130409-12130532,12131015-12131373 43 3e-04 01_01_0070 - 542603-542686,542803-543441 43 3e-04 06_02_0120 + 12055076-12055175,12055322-12055725 43 4e-04 03_05_0630 + 26260159-26260272,26260520-26260894 43 4e-04 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 43 4e-04 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 42 5e-04 12_01_0841 - 7873458-7874225 42 7e-04 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 42 7e-04 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 42 7e-04 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 42 7e-04 12_02_0299 - 17051570-17052474,17053542-17053755 42 9e-04 10_08_0553 - 18720436-18720494,18721102-18721106,18721136-187212... 42 9e-04 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 42 9e-04 07_01_0479 + 3606663-3607448 42 9e-04 06_02_0127 + 12140843-12140966,12141170-12141567 42 9e-04 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 42 9e-04 12_02_1219 + 27096477-27096590,27096704-27097078 41 0.001 12_02_0450 + 19172812-19172920,19173020-19173088,19173168-191732... 41 0.001 10_08_0222 - 15983756-15984313 41 0.001 09_03_0145 - 12749288-12751510 41 0.001 09_02_0543 + 10427321-10428315,10428440-10429154 41 0.001 06_03_1506 + 30641428-30642168 41 0.001 06_03_0674 + 23422004-23422552,23423295-23423369,23424360-234244... 41 0.001 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 41 0.002 06_01_0690 + 5033943-5034740 41 0.002 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 41 0.002 02_01_0158 - 1103461-1104186 41 0.002 12_02_1114 - 26171876-26172493 40 0.002 10_08_0214 - 15915156-15915713 40 0.002 09_06_0283 + 22024779-22026134,22026181-22026714 40 0.002 04_04_1413 - 33386049-33386339 40 0.002 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 40 0.002 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 40 0.002 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 40 0.003 10_08_0213 - 15912048-15912716 40 0.003 03_05_0576 + 25765137-25766420 40 0.003 06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935,150... 40 0.004 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 40 0.004 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 40 0.004 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 40 0.004 01_05_0490 + 22672241-22674679 40 0.004 12_01_0838 - 7830944-7831444 39 0.005 10_08_0217 - 15962192-15962884 39 0.005 10_07_0161 - 13674631-13675433,13675793-13675862 39 0.005 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 39 0.005 12_01_0776 + 7076218-7076832 39 0.006 11_07_0007 - 27262229-27262638,27263252-27263312 39 0.006 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 39 0.006 09_02_0274 + 6611555-6611615,6612229-6612638 39 0.006 08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384,748... 39 0.006 07_03_1533 + 27523811-27524710 39 0.006 07_03_0782 - 21497949-21498563 39 0.006 06_02_0271 + 13618149-13618297,13618311-13618560 39 0.006 05_05_0101 - 22398814-22399164 39 0.006 05_01_0545 - 4756266-4757510 39 0.006 03_05_0704 - 26953474-26953643,26953770-26953801,26953915-269540... 39 0.006 02_05_0149 + 26290236-26290880 39 0.006 01_06_1758 - 39681942-39682030,39682115-39682345,39682643-396826... 39 0.006 01_01_0036 + 278982-279494 39 0.006 12_02_1177 - 26708215-26708309,26708355-26708392,26708476-267095... 38 0.008 12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388,784... 38 0.008 10_03_0023 - 7151465-7152111,7152222-7152405 38 0.008 04_01_0034 - 401208-402923 38 0.008 03_05_0267 - 22538631-22539452 38 0.008 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 38 0.011 10_08_0221 - 15980370-15980927 38 0.011 10_08_0220 - 15977247-15977804 38 0.011 09_05_0008 + 20042390-20042845,20043323-20043457,20043539-200436... 38 0.011 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 38 0.011 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 38 0.011 05_04_0303 - 20010761-20011756 38 0.011 04_04_0679 + 27214577-27215023 38 0.011 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 38 0.011 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 38 0.015 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 38 0.015 07_03_1136 + 24218601-24218734,24218769-24219906 38 0.015 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 38 0.015 06_02_0122 - 12095385-12095713,12096018-12096120 38 0.015 06_01_0760 - 5676973-5677830 38 0.015 03_05_0688 + 26762668-26762893,26763027-26763101,26763865-267640... 38 0.015 03_05_0252 - 22403504-22404676 38 0.015 12_02_0687 + 22123216-22123760,22125021-22125330 37 0.019 06_03_1370 + 29645598-29646288,29646364-29646752 37 0.019 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 37 0.019 04_04_1125 + 31085106-31085714 37 0.019 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 37 0.019 02_05_0157 - 26353971-26354336,26354645-26354726,26354838-263549... 37 0.019 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 37 0.019 01_06_0146 + 26969011-26969995,26970878-26970930 37 0.019 06_02_0125 + 12122812-12122911,12123647-12123993 37 0.025 05_06_0078 - 25412770-25413852 37 0.025 05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094,450... 37 0.025 04_03_0904 + 20717005-20718087 37 0.025 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 37 0.025 02_04_0271 + 21445113-21445865,21446727-21446788,21446927-214470... 37 0.025 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 37 0.025 11_01_0066 - 536281-537196,537397-537452 36 0.033 10_08_0223 - 15986763-15987575 36 0.033 10_08_0116 + 14935582-14936089,14936850-14937188,14937914-149379... 36 0.033 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 36 0.033 08_01_1038 + 10540185-10540709 36 0.033 07_03_0527 - 19085828-19086319 36 0.033 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 36 0.033 11_06_0610 - 25449085-25453284 36 0.044 11_04_0246 - 15311912-15312481 36 0.044 10_08_0218 - 15967064-15967906 36 0.044 05_07_0217 - 28469229-28469798 36 0.044 02_05_0269 + 27307837-27308424 36 0.044 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 36 0.044 01_02_0131 - 11441713-11441728,11441911-11441953,11442324-11442762 36 0.044 01_01_0082 + 625198-625719 36 0.044 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 36 0.059 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 36 0.059 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 36 0.059 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 36 0.059 10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904... 36 0.059 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 36 0.059 09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155... 36 0.059 09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763... 36 0.059 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 36 0.059 08_02_1084 - 24232968-24234779 36 0.059 08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695... 36 0.059 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 36 0.059 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 36 0.059 08_01_0202 - 1638978-1639571 36 0.059 07_03_1160 - 24430240-24431268 36 0.059 07_01_0862 - 7172083-7172931 36 0.059 06_02_0123 + 12104187-12104252,12105455-12105775 36 0.059 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 36 0.059 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 36 0.059 06_01_0145 + 1092764-1093351 36 0.059 05_05_0334 + 24156532-24156565,24156681-24156782,24157145-241572... 36 0.059 05_03_0662 + 16732965-16733037,16733310-16733413,16734468-167348... 36 0.059 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 36 0.059 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 36 0.059 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 36 0.059 04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479... 36 0.059 03_06_0297 - 32924162-32924605 36 0.059 03_02_0350 - 7734494-7734952,7735765-7736133 36 0.059 02_05_1258 + 35290183-35290198,35290292-35290599,35290844-352909... 36 0.059 02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 36 0.059 02_03_0120 + 15463163-15465250 36 0.059 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 36 0.059 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 36 0.059 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 36 0.059 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 36 0.059 11_06_0300 + 22095396-22096145,22096261-22096344,22097062-220973... 35 0.077 11_01_0133 + 1121392-1122731,1123417-1123858 35 0.077 10_08_0216 - 15942379-15942852,15942956-15943033 35 0.077 09_04_0430 + 17502387-17503505 35 0.077 08_02_1256 + 25645085-25645396 35 0.077 07_03_0890 - 22332768-22333382 35 0.077 02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164,678... 35 0.077 01_06_0561 + 30251547-30252173,30252248-30252405,30253250-302541... 35 0.077 01_06_0317 + 28425408-28426079,28426286-28426351 35 0.077 01_02_0007 + 10132380-10133201 35 0.077 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 28 0.095 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 35 0.10 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 35 0.10 10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 35 0.10 09_06_0081 + 20745627-20748144,20748211-20748308 35 0.10 09_04_0180 + 15367737-15367755,15368874-15369739 35 0.10 09_02_0369 - 8012470-8013120 35 0.10 09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443,404... 35 0.10 09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 35 0.10 08_02_0826 - 21583507-21583555,21584000-21584679 35 0.10 08_02_0796 - 21300251-21300373,21300846-21301721 35 0.10 08_01_0546 - 4746118-4746580,4747335-4747342 35 0.10 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 35 0.10 07_03_1155 - 24413270-24413728 35 0.10 07_03_0154 + 14509979-14512033 35 0.10 07_03_0089 - 13300902-13301645 35 0.10 06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 35 0.10 04_04_1416 - 33411900-33412148,33412735-33412854,33412986-334132... 35 0.10 03_05_0737 + 27258320-27259007,27259263-27259435,27262684-272627... 35 0.10 03_02_0738 - 10824121-10825572 35 0.10 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 34 0.14 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 34 0.14 09_02_0082 - 4060018-4061604 34 0.14 08_02_0620 + 19387935-19388279 34 0.14 08_02_0602 + 19183549-19184919 34 0.14 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 34 0.14 05_01_0142 - 940421-940701,941262-941574 34 0.14 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 34 0.14 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 34 0.14 03_06_0599 + 34984869-34985319,34986581-34987563 34 0.14 03_05_0292 + 22846273-22846377,22847161-22847823 34 0.14 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 34 0.14 02_04_0021 + 18975992-18976408 34 0.14 02_01_0692 + 5179778-5181847 34 0.14 01_01_0929 - 7344911-7345978 34 0.14 11_04_0415 - 17395988-17396161,17397349-17397444,17397489-173980... 34 0.18 11_01_0385 + 2915532-2916482 34 0.18 10_08_0338 + 16916429-16916650,16916728-16917900 34 0.18 10_08_0127 - 15010125-15011068,15011328-15011835 34 0.18 10_07_0107 - 12936839-12937030,12937305-12937386,12937476-129375... 34 0.18 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 34 0.18 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 34 0.18 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 34 0.18 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 34 0.18 05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 34 0.18 05_03_0040 - 7646525-7647775 34 0.18 04_03_0747 - 19251617-19251781,19252377-19252502,19252606-192527... 34 0.18 04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463,871... 34 0.18 03_02_1033 + 13550955-13551700,13552837-13553290,13553451-135536... 34 0.18 03_02_1031 + 13541327-13542072,13543209-13543662,13543823-135440... 34 0.18 01_02_0031 + 10364487-10365407 34 0.18 01_01_0219 + 1863478-1864041,1864459-1865109 34 0.18 12_02_0306 + 17307166-17309091 33 0.24 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 33 0.24 10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 33 0.24 09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415,243... 33 0.24 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 33 0.24 06_03_0464 + 21043706-21044305,21044418-21044460,21047402-21047421 33 0.24 05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 33 0.24 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 33 0.24 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 33 0.24 04_03_1022 - 21778315-21779007 33 0.24 04_03_0098 + 11183039-11183752 33 0.24 03_02_0342 - 7645323-7645909,7646323-7646491 33 0.24 01_06_1799 + 39948481-39948607,39948694-39948762,39948859-399489... 33 0.24 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 33 0.24 10_08_0229 - 16016818-16017387 33 0.31 08_01_0134 + 1067826-1068158 33 0.31 07_01_0516 - 3850252-3852870 33 0.31 06_03_1042 - 27089563-27089594,27090017-27090577,27090740-27090797 33 0.31 06_03_0500 + 21470681-21470952,21471049-21471089,21472322-214724... 33 0.31 05_05_0356 - 24373879-24374469 33 0.31 05_01_0380 + 2978256-2979284 33 0.31 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 33 0.31 02_05_0407 + 28715332-28715385,28715528-28715680,28715810-287158... 33 0.31 02_02_0582 - 11798252-11798908 33 0.31 01_06_0840 + 32343700-32344138,32345329-32345419,32345584-323458... 33 0.31 01_06_0027 - 25742122-25742310,25742481-25742553,25743219-25744159 33 0.31 01_05_0070 - 17842347-17842643 33 0.31 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 33 0.31 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 33 0.31 01_01_1108 + 8758486-8758815,8758913-8758960,8761512-8761664,876... 33 0.31 01_01_0715 - 5542648-5543219,5543352-5543544 33 0.31 12_02_1070 - 25814741-25815850 33 0.41 11_08_0048 - 28022335-28022520,28022607-28022699,28022804-280228... 33 0.41 09_04_0580 + 18681019-18681475,18682637-18682920,18683088-186833... 33 0.41 09_01_0037 - 604001-604957 33 0.41 08_02_1390 - 26665605-26665933,26665939-26666023 33 0.41 08_02_0839 + 21693348-21694853 33 0.41 08_02_0224 + 14457427-14457879 33 0.41 08_02_0110 + 12650328-12650552,12650827-12651423,12651480-126518... 33 0.41 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 33 0.41 07_03_0190 + 14893243-14893582,14893684-14893808 33 0.41 07_01_0812 + 6381428-6381880 33 0.41 07_01_0714 - 5451246-5451408,5453401-5453534,5453608-5453796,545... 33 0.41 06_03_0248 - 18696184-18696199,18696920-18697314 33 0.41 05_05_0142 - 22673607-22674134 33 0.41 05_03_0398 - 13515850-13516302 33 0.41 05_03_0039 - 7621613-7622695 33 0.41 05_02_0122 - 6840840-6841307 33 0.41 04_04_1421 - 33449539-33449994 33 0.41 04_04_0900 + 29232365-29232931 33 0.41 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 33 0.41 04_01_0047 - 519802-519817,519897-519939,519983-520025,520193-52... 33 0.41 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 33 0.41 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 33 0.41 02_05_0201 + 26687369-26689228 33 0.41 01_06_1602 - 38559661-38559936,38560008-38560137,38562550-385627... 33 0.41 01_06_1377 + 36764461-36765339 33 0.41 01_01_0073 + 555485-556315 33 0.41 12_01_0495 - 3935395-3937110 32 0.55 11_02_0082 - 8088169-8088284,8088613-8088697,8090344-8090442,809... 32 0.55 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 32 0.55 10_08_0236 + 16078162-16078731 32 0.55 10_08_0227 - 16004868-16005449 32 0.55 10_02_0009 + 4128909-4130123 32 0.55 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 32 0.55 07_03_1432 - 26508135-26508881,26509301-26509708 32 0.55 07_03_1175 - 24555965-24556117,24557809-24558264,24558270-245584... 32 0.55 07_03_0091 + 13312904-13313647 32 0.55 07_01_0788 - 6140512-6140659,6140744-6140808,6141691-6141799,614... 32 0.55 06_03_0905 + 25843547-25844314 32 0.55 06_02_0129 + 12151133-12151840,12151919-12152365,12152453-121533... 32 0.55 04_04_1046 + 30405805-30405858,30405991-30407950,30408460-30408476 32 0.55 04_04_0708 - 27441373-27442611 32 0.55 02_05_1277 - 35408097-35409080 32 0.55 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 32 0.55 02_01_0471 - 3364215-3364912,3365511-3365742,3365827-3366198,336... 32 0.55 02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113... 32 0.55 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 29 0.72 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 32 0.72 12_01_0135 + 1042889-1044255,1045368-1045809 32 0.72 11_06_0016 - 19284810-19284926,19285527-19286879 32 0.72 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 32 0.72 10_08_0894 - 21365629-21365766,21365849-21365950,21366042-213662... 32 0.72 10_08_0224 - 15993497-15994075 32 0.72 08_02_1615 + 28257275-28258428,28258523-28259144 32 0.72 08_02_1019 - 23657175-23658047 32 0.72 08_01_0531 - 4604556-4604582,4604829-4604921,4605381-4605572,460... 32 0.72 07_03_1433 + 26513728-26514135,26525534-26526280 32 0.72 07_03_0594 - 19833967-19834557 32 0.72 06_03_1133 - 27886823-27887088,27887837-27888629,27888674-27889000 32 0.72 06_01_0125 + 970746-970967,971126-971226,971897-972026,972108-97... 32 0.72 05_07_0100 + 27679280-27680320 32 0.72 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 32 0.72 04_04_1582 - 34590698-34591199,34593849-34594690 32 0.72 04_01_0607 + 7955026-7955664 32 0.72 03_05_0543 - 25404630-25405408,25405461-25405605 32 0.72 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 32 0.72 03_02_0027 + 5100865-5100878,5102241-5102708,5102795-5103021,510... 32 0.72 02_02_0240 + 8196140-8198248,8198381-8198650 32 0.72 02_01_0584 - 4326072-4326094,4326306-4326885 32 0.72 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 32 0.72 12_01_0969 - 9765114-9765664,9767963-9768512,9769507-9769561,976... 31 0.95 11_04_0272 - 15631598-15631898,15633162-15633291,15636394-156365... 31 0.95 11_01_0621 - 4981070-4981136,4982906-4983825 31 0.95 10_08_0343 - 16960764-16960895,16961166-16961171,16961272-169616... 31 0.95 10_08_0226 - 16001958-16002527 31 0.95 10_01_0286 - 2978630-2979075,2980050-2980194 31 0.95 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 31 0.95 08_02_1553 + 27835320-27835364,27836853-27836966,27837062-278374... 31 0.95 08_02_0780 + 21148283-21148634,21148730-21149146,21150194-21150534 31 0.95 08_02_0713 + 20335317-20335916,20336029-20336071,20336278-20336342 31 0.95 08_02_0697 + 20144063-20144341,20144755-20145366 31 0.95 08_01_0620 - 5416197-5416225,5416333-5416652,5417144-5417235,541... 31 0.95 07_03_0421 - 18011768-18011832,18012039-18012081,18012194-18012784 31 0.95 07_01_0577 - 4286048-4286186,4286600-4286660,4286957-4287089,428... 31 0.95 06_03_1450 + 30246702-30247346,30248603-30248689,30248789-302489... 31 0.95 06_02_0124 + 12116278-12116374,12116595-12116881 31 0.95 05_07_0125 + 27861368-27862282 31 0.95 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 31 0.95 05_01_0210 + 1583176-1584177 31 0.95 04_04_1687 - 35365766-35366356,35367137-35368135 31 0.95 03_03_0106 - 14500935-14501263,14501357-14501432,14501531-14501542 31 0.95 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 31 0.95 02_03_0342 + 17959432-17959623,17959808-17959903 31 0.95 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 31 0.95 01_01_0345 + 2752790-2753102,2753309-2754079,2755795-2756078 31 0.95 11_01_0561 - 4418452-4418658,4420168-4420509 25 1.0 12_01_0442 + 3495333-3496484 31 1.3 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 31 1.3 10_08_0949 - 21759821-21759833,21759985-21760301,21760650-217607... 31 1.3 10_08_0215 - 15939842-15940056,15940235-15940913 31 1.3 09_02_0327 - 7284829-7284889,7284946-7286126 31 1.3 08_02_1403 + 26811020-26811146,26813351-26813609,26814932-26814983 31 1.3 08_01_0619 + 5412058-5413224,5413357-5413476,5413755-5413831,541... 31 1.3 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 31 1.3 07_03_1636 + 28290642-28291574 31 1.3 07_03_1065 + 23711677-23711837,23711859-23712180,23713071-23713277 31 1.3 07_03_1012 + 23295976-23296264,23296475-23296548,23296972-232969... 31 1.3 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 31 1.3 06_03_1080 + 27436389-27436742,27437573-27437804,27437911-274381... 31 1.3 06_03_0696 + 23617687-23617851,23618838-23619536 31 1.3 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 31 1.3 06_02_0046 + 10928708-10928798,10929997-10930077,10930567-109306... 31 1.3 05_05_0155 + 22787658-22787930,22788029-22788096,22789600-227899... 31 1.3 05_03_0458 + 14280953-14281866,14281964-14282912 31 1.3 04_04_1126 + 31095651-31096115 31 1.3 04_04_0675 + 27183826-27184443 31 1.3 03_03_0193 - 15312568-15312753,15312811-15312933,15313112-153131... 31 1.3 02_04_0028 + 19027510-19027983,19028087-19028278,19028369-190285... 31 1.3 02_03_0201 + 16302797-16302799,16303949-16304084,16304163-163042... 31 1.3 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 31 1.3 02_01_0077 - 546033-546223,546314-546566,546635-546865,547165-54... 31 1.3 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 31 1.3 01_03_0202 - 13762042-13762572 31 1.3 11_06_0368 + 22756988-22758205 31 1.7 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 31 1.7 06_03_1146 - 28004896-28005554,28005664-28005844 31 1.7 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 31 1.7 06_03_0757 + 24267599-24268882 31 1.7 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 31 1.7 05_04_0419 + 21103418-21103597,21103768-21103931,21104420-21104846 31 1.7 05_04_0091 + 17839118-17839303,17840876-17840923,17841381-178415... 31 1.7 04_04_1366 + 32970640-32970981,32971678-32971765,32971919-329720... 31 1.7 04_01_0354 - 4646826-4647314 31 1.7 04_01_0197 + 2323790-2324098,2324145-2324774 31 1.7 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 31 1.7 03_02_0234 + 6625417-6626184,6626314-6626339,6626435-6626531,662... 31 1.7 02_02_0444 + 10340927-10341063,10341157-10341241,10341480-103415... 31 1.7 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 31 1.7 01_01_1067 + 8403584-8404195,8404532-8404693,8404837-8405346,840... 31 1.7 01_01_0720 - 5593311-5595371,5597550-5598027,5598118-5598146 31 1.7 12_02_0046 + 12830974-12832386 30 2.2 12_01_0292 + 2193309-2193338,2193565-2193640,2193744-2195203,219... 30 2.2 10_08_0237 - 16085539-16086120 30 2.2 10_05_0028 - 8311041-8311709,8312175-8312478,8314768-8314841 30 2.2 10_01_0360 - 3970796-3971248,3972080-3972436 30 2.2 09_04_0324 - 16686872-16687074,16687479-16687521,16687735-166880... 30 2.2 09_04_0168 - 15295442-15295477,15295478-15295552,15295660-152957... 30 2.2 08_02_1618 + 28280414-28281193 30 2.2 08_02_1330 + 26191062-26191314,26191894-26191961,26192125-261923... 30 2.2 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 30 2.2 07_03_1350 - 25955624-25955842,25955877-25955922,25956456-25956751 30 2.2 07_03_1090 + 23891294-23892222,23892317-23892516,23895241-238954... 30 2.2 07_03_0544 + 19309026-19310105 30 2.2 07_01_0756 + 5819367-5820038,5820847-5821005 30 2.2 06_03_1310 + 29238644-29240260 30 2.2 06_01_1050 + 8262033-8262165,8262262-8262391,8262486-8263026 30 2.2 06_01_0586 - 4203024-4203425,4203527-4203595,4203681-4203746,420... 30 2.2 05_05_0173 + 22956927-22958615 30 2.2 05_05_0135 - 22626163-22626198,22626391-22626441,22626516-226266... 30 2.2 05_04_0235 + 19291204-19291769,19291860-19292250 30 2.2 05_03_0665 - 16774043-16774522 30 2.2 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 30 2.2 04_04_1542 - 34264994-34265331,34266195-34267029 30 2.2 04_04_1414 - 33394518-33394847 30 2.2 04_04_0360 - 24684159-24684565,24684654-24685089 30 2.2 04_03_0422 + 15746168-15746620 30 2.2 04_03_0413 + 15612568-15613005 30 2.2 04_01_0225 + 2836634-2837086 30 2.2 03_03_0139 + 14769393-14769764,14770113-14770193,14770537-14770737 30 2.2 03_02_0719 + 10654842-10654977,10655039-10655124,10655226-106570... 30 2.2 03_01_0616 + 4527148-4527507,4528285-4528293,4529160-4529498 30 2.2 02_04_0563 - 23895573-23895614,23896330-23896390,23896901-238970... 30 2.2 02_02_0682 - 12923103-12923747,12924607-12924870,12924953-129252... 30 2.2 02_02_0525 - 11182043-11182080,11182386-11182511,11182760-11183486 30 2.2 02_01_0016 + 110796-110979,111252-111768,111847-112213 30 2.2 01_01_1063 - 8386813-8387236,8387322-8387779 30 2.2 01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 30 2.2 01_01_0347 + 2765517-2767109,2767214-2767228 30 2.2 12_02_1076 - 25862671-25863159,25863290-25863451,25863614-258638... 30 2.9 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 30 2.9 12_02_0310 - 17358220-17358834 30 2.9 12_01_0877 - 8415186-8415272,8415696-8416310 30 2.9 12_01_0362 - 2746626-2747726,2748358-2748982,2749086-2749156 30 2.9 10_08_0638 - 19503580-19503990 30 2.9 10_08_0241 - 16111792-16112367 30 2.9 10_08_0240 - 16106963-16107538 30 2.9 10_08_0238 - 16093780-16094355 30 2.9 10_08_0233 - 16061182-16061714,16062765-16063578 30 2.9 10_06_0036 - 9914606-9915561,9916287-9916368 30 2.9 09_06_0172 + 21329904-21331512,21331595-21331740,21332333-213325... 30 2.9 09_06_0125 - 21011757-21012428 30 2.9 09_04_0112 - 14757947-14758972 30 2.9 07_03_1643 + 28329090-28329125,28329260-28329335,28329413-28330305 30 2.9 07_03_1156 - 24416835-24417461 30 2.9 06_03_1006 + 26844161-26844198,26844304-26844372,26844526-268445... 30 2.9 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 30 2.9 04_04_1049 + 30414545-30414596,30414732-30414853,30415121-304151... 30 2.9 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 30 2.9 04_04_0066 - 22495396-22495424,22495716-22495758,22495871-224961... 30 2.9 04_04_0053 + 22389227-22389613,22390528-22390981,22391618-223916... 30 2.9 04_01_0583 + 7563290-7563904 30 2.9 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 30 2.9 03_06_0485 + 34242121-34243188 30 2.9 03_06_0088 - 31562596-31563096 30 2.9 03_05_0524 - 25181432-25181483,25181565-25181691,25181776-251818... 30 2.9 03_02_0085 - 5539188-5539388,5539576-5539714,5540108-5540279,554... 30 2.9 01_06_1737 - 39559321-39559461,39559761-39559817,39559919-395601... 30 2.9 01_06_1651 + 38909410-38909625,38909713-38910181,38910265-38910899 30 2.9 01_06_1321 + 36280691-36281269 30 2.9 12_02_0643 - 21461123-21461902 29 3.8 12_01_0551 + 4446937-4447353,4449141-4450013,4451206-4451244,445... 29 3.8 12_01_0526 - 4171313-4171417,4171514-4171597,4171688-4171758,417... 29 3.8 11_02_0086 + 8186355-8186667,8186773-8187335 29 3.8 10_08_0243 - 16124790-16125361,16126358-16126547 29 3.8 10_02_0067 + 4884902-4885210,4886008-4886037 29 3.8 09_06_0115 + 20944586-20945185 29 3.8 09_04_0072 + 14323449-14324274,14324351-14324447,14325175-143252... 29 3.8 09_01_0112 + 1737438-1737777,1738441-1738511,1738974-1739052,174... 29 3.8 08_02_0743 - 20647440-20647927,20647997-20648426,20650127-206505... 29 3.8 07_01_1013 - 8593690-8595006,8595275-8595928,8595951-8596065,859... 29 3.8 07_01_0907 - 7636725-7637681 29 3.8 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 29 3.8 05_07_0031 - 27183252-27183317,27183542-27184282 29 3.8 05_01_0024 - 164618-165139,166884-166949,167046-167216,167321-16... 29 3.8 04_04_0430 - 25153572-25154060 29 3.8 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 29 3.8 02_05_0750 - 31479876-31480985 29 3.8 02_05_0246 + 27136590-27138610,27138933-27139056,27139401-271396... 29 3.8 02_05_0059 - 25482207-25482271,25482432-25482651 29 3.8 >06_03_0790 - 24636805-24637770 Length = 321 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/40 (57%), Positives = 23/40 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG GRG GG Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGG 126 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 128 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGG 129 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 91 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 130 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 95 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 134 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 147 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G GG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G GG Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 114 GGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 78 GVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GGG G G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G G Sbjct: 110 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNG 149 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 93 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 94 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG GGG G G GG Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 135 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 99 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 138 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 103 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 145 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 146 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 111 GGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GGG G G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDG 153 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG GG GG G GGG G G GG Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 112 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG GG GG G GGG G G Sbjct: 118 GGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNG 156 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G GG G G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G G G G Sbjct: 124 GGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDG 162 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G G G GG Sbjct: 129 GGGGGGGGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGG 168 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G G G G GRG G Sbjct: 135 GGGGGGGGGGGGGNGGDDGDNGDDGEDGDGDAGGRGGKG 173 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXRXXTXXGXX*XDNXXXG 722 GGGG GG GGGG G GG GGG G G DN G Sbjct: 100 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGGDDGDNGDDG 159 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G GG GG G GGG G GG Sbjct: 219 GGNKGGGGDGGSDNAQSGDGGGGWESSGGGGG 250 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = -2 Query: 905 GXXGGG--XXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G G G GG G GG G Sbjct: 236 GDGGGGWESSGGGGGRGDVSGAGGGGGGGGGDDANG 271 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G G GGG G G Sbjct: 236 GDGGGGWESSGGGGGRGDVSGAGGGGGGGGG 266 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G G GG GGGG G GG GGG G Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G G G G G G G G RGI G Sbjct: 159 GEDGDGDAGGRGGKGRGRGRGRGMGSGIGRGNGQNGDRGINSG 201 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 GGG G GG G G GGG GG GD Sbjct: 238 GGGGWESSGGGGGRGDVSGA----GGGGGGGGGD 267 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G G GG GGGG G GG GGG G Sbjct: 76 GWGVWSGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 114 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GGG G GG Sbjct: 220 GNKGGGGDGGSDNAQSGDGGGGWESSGGGGGRGDVSGAGGG 260 >06_01_0486 - 3455030-3455770 Length = 246 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/63 (36%), Positives = 25/63 (39%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P+ Y P + PP P P PPP P PP P P P PPP PPP Sbjct: 94 PSPPPYVPPYIPPPTPPYVPPYIPP--PTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPP 151 Query: 898 XXP 906 P Sbjct: 152 SPP 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 P PRP PP P PP PP P P P PP PPP P Sbjct: 81 PPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPP 122 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 PP PR PP P PP PP P PPP PP P Sbjct: 66 PPPSPRCPSCHPPYTPPTPRPPPTPPYVPSPPPYVPPYIPP 106 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 PP P P PPP P P PP P PPP P PP P Sbjct: 77 PPYTP-PTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIP 117 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 5/63 (7%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPX---PXXPPXXPPX--PPXPXPPP 882 P + Y P PP +P P PP P PP PP PP P Sbjct: 98 PYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSPPATK 157 Query: 883 XXP 891 P Sbjct: 158 TCP 160 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPPXPPSXXPPP 899 P PPP PP P P PPP PP+ P Sbjct: 121 PPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSPPATKTCP 160 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 32 GCGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGG 73 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 38 GGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGG 77 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGG 90 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 53 GGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 74 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 36 GGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 37 GGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG GGG G G GG Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGG 78 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 42 GGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGG 81 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 43 GGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 46 GGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGG 88 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGG 89 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 879 GGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG G GG G G GGG GG G GR G Sbjct: 34 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGG 71 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG G GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGYYPPWNGGYYPPGPG 107 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G G GG Sbjct: 66 GGGGGGGGGGGGGGGGGGGGGGGGGGGYYPPWNGG 100 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG GRG GG Sbjct: 72 GGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGG 111 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 79 GGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGG 118 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG GG G GGG G G GG Sbjct: 74 GGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGG 113 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 83 GGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGG 122 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 65 GGVGGGYGGGGGGYGGGGGGYGG-GGRGGGGGGGYGGGGG 103 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 51 GRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGG 92 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G GGG GGG GG GG GG G GGG GRG GG Sbjct: 55 GGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGG 95 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GGG G G GG Sbjct: 84 GYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRGGG 123 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G GG GG G GGG G G GG Sbjct: 48 GGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGG 87 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG G G GGG G G GG Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGG 80 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 64 GGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGG 105 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GGG G GG GG GG GGG GR Sbjct: 91 GGGGGGGYGGGGG-GGRGGGGGGGGRGGGGRGGGR 124 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG RGG G GG G G GG GG G G Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGGG 82 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG GG G GG G G GGG GG G GR G Sbjct: 69 GGYGGGG--GGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGG 113 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG GG G GG G G GGG GG G GR G Sbjct: 77 GYGGGGGGYGGGGRGGGGGG-GYGGGGGGGRGGGGGGGGRGGGGRGG 122 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 60 GGYGGGGVGGGYGGGGGGYGGGGGGYGGGG-RGGGGGGG 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG + G GGGG G GG GGG Sbjct: 205 GGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGG 239 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -1 Query: 906 GXXGGGXXRGGX---GXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG RGG GG G G GG GG G GR G Sbjct: 213 GGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRG 262 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G GG GGG G Sbjct: 63 GGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGG 100 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG GG G G Sbjct: 99 GGGGGGGRGGGGGGGGRGG--GGRGGGRDG 126 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG GG G G Sbjct: 199 GGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGG 231 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG----RGIXGG 786 GG GG G G GG GG GGG G RG GG Sbjct: 238 GGDYNSGGRGGGTGGGGRGGGYNRGGGDDRGFDDHRGGRGG 278 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG G GG GGGG G GG GGG G Sbjct: 76 GGYGGGGGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGG 114 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 GGG GG G GG G G GGG GG D Sbjct: 93 GGGGGYGGGGGGGRGGGGGGGGRGGGGR-GGGRD 125 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGX-GXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG GG GG GG G GGG G G Sbjct: 229 GGGGGYNRGGGDYNSGGRGGGTGGG-GRGGGYNRGGG 264 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX---GGXXGXGGGXXXGRG 798 G GGG GG GG GG GG GGG RG Sbjct: 199 GGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRG 237 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG-GAGD 796 G GGG + G G GG G GGG G GD Sbjct: 203 GGGGGGYNKSGGGGGGYNRGGGDFSSGGGGGYNRGGGD 240 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG G GGGG G GG GGG G Sbjct: 44 GGGGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGG 81 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 901 GGGGXXEGGXGG--GGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GG GG G GG GGG Sbjct: 58 GGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGG 94 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -1 Query: 897 GGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG GG G G GG GG D G Sbjct: 231 GGGYNRGGGDYNSGGRGGGTGGGGRGGGYNRGGGDDRG 268 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GGGG G GGGG G G GGG G R Sbjct: 63 GGGGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGGGGGGGR 106 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G G GG GGG G G Sbjct: 199 GGGGGGGGGGYNKSGGGGGGYNRGGGDFSSGGGGG 233 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GGG G GG Sbjct: 213 GGGGGGYNRGGGDFSSGGGGGYNRGGGDYNSGGRGGG 249 >07_03_1751 - 29215074-29216270 Length = 398 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 217 GGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAGGGAGVGGG 256 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 227 GGLGGGAGGGHGGGGGLGGGAGGGAGVGGGAGGGAGAGGG 266 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 175 GGAGGGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGG 214 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 162 GAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGVGGG 204 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G G G G G+ GG Sbjct: 117 GGKGGGLGGGGGLGGGGGGGAGGGLGGGAGGGAGAGVGGG 156 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 203 GGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGG 242 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 277 GGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGG 316 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G G Sbjct: 213 GGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAGGGAG 252 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 281 GGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGG 320 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG GG G G GG GG G GGG G G GG + Sbjct: 240 GGGLGGGAGGGAGVGGGAGGGAGAGGGLGAGGGAGGGGGI 279 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G GGG G G+ GG Sbjct: 179 GGLGGGSGGGGGLGGGAGGGAGVGGGAGGGAGGGGGLGGG 218 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G+ GG Sbjct: 300 GFGGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGG 340 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 189 GGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGG 228 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G+ GG Sbjct: 208 GAGGGGGLGGGAG-GGAGGGGGLGGGAGGGHGGGGGLGGG 246 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX---GGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G+ GG Sbjct: 130 GGGGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGGGGLGGG 172 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G GG GG G GGG G G GG Sbjct: 36 GFGGGGGVGHGGGVGIGFGGGKGGGVGVGGGGGFGGGAGGG 76 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG GG GG G GGG G G Sbjct: 202 GGGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAG 234 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 350 GAGAGGGFGGGKG-GGFGGGVGGGHGAGGGGAGGGGGFGG 388 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 222 GAGGGGGLGGGAG-GGHGGGGGLGGGAGGGAGVGGGAGGG 260 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GGG G G G GG GG G G GG G G+ GG Sbjct: 62 GVGGGGGFGGGAGGGLGHGGGIGGGFGGGKGGGLGGGVGVGGG 104 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGGXXV 777 G GG GGG G G GG GG G GGG G G GG V Sbjct: 158 GAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGGGAGV 201 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG G G GG Sbjct: 338 GGGAGGGFGGGGGAGAGGGFGGGKGGGFGGGVGGGHGAGGG 378 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G G Sbjct: 122 GLGGGGGLGGGGG-GGAGGGLGGGAGGGAGAGVGGGAGAG 160 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 184 GSGGGGGLGGGAGGGAGVGGGAGG--GAGGGGGLGGGAGGG 222 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G GGG G G+ GG Sbjct: 193 GGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLGGG 232 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G GGG G G+ G Sbjct: 231 GGAGGGHGGGGGLGGGAGGGAGVGGGAGGGAGAGGGLGAG 270 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG GG G GGG G G GG Sbjct: 252 GVGGGAGGGAGAGGGLGAGGGAGGGGGIGGGAGGGAGAGGG 292 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 256 GAGGGAGAGGGLGAGGGAGGGGGIGGGAGGGAGAGGGFGGG 296 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG--GXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G G GGG G GI GG Sbjct: 241 GGLGGGAGGGAGVGGGAGGGAGAGGGLGAGGGAGGGGGIGGG 282 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG G G GGG G G GG Sbjct: 246 GAGGGAGVGGGAGGGAGAGGGLGAGGGAGGGGGIGGGAGGG 286 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/37 (51%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G GG G GG GG GG G GGG G+G Sbjct: 262 GAGGGLGAGGGAGGGGGIGGGAGGGAGAGGGFGGGKG 298 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/37 (51%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G G GG GG G GGG G+G Sbjct: 286 GAGAGGGFGGGKGGGFGGGGGGGGGAGAGGGFGGGKG 322 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G G G G G GG Sbjct: 305 GGGGGGAGAGGGFGGGKGGGFGGGFGGGKGGGVGGGAGGG 344 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG G G+ GG Sbjct: 104 GIGHGGGVGGGFGGGKGGGLGGGGGLGGGGGGGAGGGLGGG 144 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G G G G G GG Sbjct: 109 GGVGGGFGGGKGGGLGGGGGLGGGGGGGAGGGLGGGAGGG 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G GGG G G G Sbjct: 188 GGGLGGGAGGGAGVGGGAGGGAGGGGGLGGGAGGGAG 224 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG G G GGG G G GG Sbjct: 270 GGGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGG 306 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G G G G G GG Sbjct: 295 GGKGGGFGGGGGGGGGAGA--GGGFGGGKGGGFGGGFGGG 332 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G G G GG Sbjct: 310 GAGAGGGFGGGKG-GGFGGGFGGGKGGGVGGGAGGGFGGG 348 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG G G GGG G G GG Sbjct: 354 GGGFGGGKGGGFGGGVGGGHGAGGGGAGGGGGFGGGAGGG 393 Score = 39.5 bits (88), Expect = 0.004 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 272 GAGGGGGIGGGAGGGAGAGGGFGG--GKGGGFGGGGGGGGG 310 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G GG Sbjct: 291 GGFGGGKGGGFGGGGGGGGGAGAGGGFGGG--KGGGFGGG 328 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG GG G G G G G+ GG Sbjct: 331 GGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKGGGFGGGVGGG 372 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 171 GGAGGGAGGGLGGGSGGGGGLGG--GAGGGAGVGGGAGGG 208 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G+ GG Sbjct: 94 GLGGGVGVGGGIGHGGGVGGGFGG--GKGGGLGGGGGLGGG 132 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GGG G G GG Sbjct: 127 GGLGGGGGGGAGGGLGGGAGGGAGAGVGGGAGAGGGAGGG 166 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GGG GG G G GG G GG G GG G G G GG Sbjct: 139 GGLGGGAGGGAGAGVGGGAGAGGGAGGGGGLGGGAGGGAGGG 180 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG G G G GG GG GG G GGG G G GG Sbjct: 150 GAGVGGGAGAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGG 190 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G G Sbjct: 100 GVGGGIGHGGGVG-GGFGGGKGGGLGGGGGLGGGGGGGAG 138 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GG GG GG GG G GGG G GI G V Sbjct: 71 GGAGGGLGHGGGIGGGFGGGKGG--GLGGGVGVGGGIGHGGGV 111 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 194 GAGGGAGVGGGAGGGAGGGGGLGGGAGGGAGGGGGLGGGAGGG 236 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G G GG G GGG G+G Sbjct: 327 GGFGGGKGGGVGGGAGGGFGGGGGAGAGGGFGGGKG 362 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = -2 Query: 905 GXXGGGXXGGGXG-------XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 314 GGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGGGGGAGAGGGFGGG 360 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG G GG G G G G G Sbjct: 362 GGGFGGGVGGGHGAGGGGAGGGGGFGGGAGGGIGGG 397 Score = 36.7 bits (81), Expect = 0.025 Identities = 21/46 (45%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGR--GIXGGXXV 777 G GG GGG G GG GG G G GGG G+ G+ GG V Sbjct: 56 GKGGGVGVGGGGGFGGGAGGGLGHGGGIGGGFGGGKGGGLGGGVGV 101 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGX-GGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 88 GGGKGGGLGGGVGVGGGIGHGGGVGGGFGGGKGGGLGGGGG 128 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG GG GG G G G G G+ GG Sbjct: 147 GGAGAGVGGGAGAGGGAGG--GGGLGGGAGGGAGGGLGGG 184 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G GG G G GGG G+G Sbjct: 85 GGFGGGKGGGLGGGVGVGGGIGHGGGVGGGFGGGKG 120 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG GG G G Sbjct: 271 GGAGGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGG 309 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXX---GGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G GG G G GGG G GI GG Sbjct: 46 GGGVGIGFGGGKGGGVGVGGGGGFGGGAGGGLGHGGGIGGG 86 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G GGG G G GG Sbjct: 81 GGIGGGFGGGKGGGLGGGVGVGGGIGHGGG--VGGGFGGG 118 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G G Sbjct: 250 GAGVGGGAGGGAGAGGGLGAGGGA-GGGGGIGGGAGGGAG 288 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G GGG G G GG Sbjct: 44 GHGGGVGIGFGGGKGGGVGVGGGG-GFGGGAGGGLGHGGG 82 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G G G G GGG GG G G Sbjct: 155 GGAGAGGGAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGG 193 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 906 GXXGGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG G GG G G GGG GG G Sbjct: 55 GGKGGGVGVGGGGGFGGGAGGGLGHGGGIGGGFGGGKG 92 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G G G GGG G G G Sbjct: 343 GGFGGGGGAGAGGGFGGGKGGGFGGGVGGGHGAGGGGAG 381 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG GG G G Sbjct: 102 GGGIGHGGGVGGGFGGGKGGGLGGGGG-LGGGGGGG 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G G GGG AG Sbjct: 274 GGGGGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAG 312 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 906 GXXGGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG G GG G G GGG GGAG Sbjct: 211 GGGGLGGGAGGGAGGGGGLGGGAGGGHGGGGGLGGGAG 248 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 102 GGGIGHGGGVGGGFGGGKGGGLGGGGGLGGGGGGGAGG 139 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG G G G Sbjct: 282 GAGGGAGAGGGFG-GGKGGGFGGGGGGGGGAGAGGGFGG 319 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G G GGG AG Sbjct: 114 GFGGGKGGGLGGGGGLGGGGGGGAGGGLGGGAGGGAGAG 152 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G GG GG G Sbjct: 298 GGGFGGGGGGGGGAGAGGGFGGGKGGGFGGGFGGGKGG 335 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G G G G AG Sbjct: 224 GGGGGLGGGAGGGHGGGGGLGGGAGGGAGVGGGAGGGAG 262 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG GG G G GGG GGAG Sbjct: 309 GGAGAGGGFGGGKGGGFG--GGFGGGKGGGVGGGAG 342 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG G G G Sbjct: 323 GGFGGGFG-GGKG-GGVGGGAGGGFGGGGGAGAGGGFGG 359 >07_03_0558 + 19461369-19462448 Length = 359 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 125 GGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGG 164 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 60 GGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGG 100 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 102 GGGGGGGLGGGQG-GGFGGGAGAGGGAGGGLGGGGGFGGG 140 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 111 GGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGG 150 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 124 GGGAGGGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGG 160 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 163 GGAGGGVGGGGGFGGGGGGGLGG--GHGGGFGGGAGVGGG 200 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 303 GGAGGGVGGGGGFGGGGGGGLGG--GHGGGFGAGAGVGGG 340 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GGG G G+ GG Sbjct: 51 GFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGGLGGG 90 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 94 GVGGGGGFGGGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGG 136 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GG G G GG Sbjct: 138 GGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGG 177 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 176 GGGGGGGLGGGHG-GGFGGGAGVGGGAGGGVGGGGGFGGG 214 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 244 GGGGGGGLGGGHG-GGFGGGAGVGSGAGGGVGGGGGFGGG 282 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 168 GVGGGGGFGGGGGGGLGGGHGGGFGGGAGVGGGAGGGVGGGGG 210 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 203 GGVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGG 242 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 235 GGIGGGGGFGGGGGGGLGGGHGG--GFGGGAGVGSGAGGG 272 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 93 GGVGGGGGFGGGGGGGLGGGQGG--GFGGGAGAGGGAGGG 130 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G GG Sbjct: 135 GGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGG 174 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 167 GGVGGGGGFGGGGGGGLGGGHGG--GFGGGAGVGGGAGGG 204 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG G G GGG G G GG Sbjct: 204 GVGGGGGFGGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGG 246 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG GG G GGG G G GG Sbjct: 47 GEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGG 86 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 144 GLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGG 180 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ G Sbjct: 231 GGAGGGIGGGGGFGGGGGGGLGG--GHGGGFGGGAGVGSG 268 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G GGG G G GG Sbjct: 139 GGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGG 178 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G GGG G G GG Sbjct: 115 GGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGGG 154 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G G G GG Sbjct: 129 GGLGGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGG 168 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G+ GG Sbjct: 149 GGHGGGFGAGGGVGGGAGGGVGGGGGFGGG--GGGGLGGG 186 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR--GIXGG 786 G GGG GG G GG GG GG G G G G G+ GG Sbjct: 307 GGVGGGGGFGGGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGG 348 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG G GGG G G+ GG Sbjct: 75 GGHGGGFGGGGGLGGGASGGVGGGGGFGGG--GGGGLGGG 112 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G G G GG GG G G G G G GG V Sbjct: 154 GFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGV 197 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GG G G GG GG G GG G G G+ GG Sbjct: 181 GGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFGGGGGSGLGGG 222 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GGG G G GG Sbjct: 280 GGGGGGGLGGGHG-SGFGGGAGVGGGAGGGVGGGGGFGGG 318 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G G GG Sbjct: 316 GGGGGGGLGGGHG-GGFGAGAGVGGGAGGGVGGGGGFGGG 354 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG GG G G GGG G G Sbjct: 71 GGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGGGGG 106 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GGG G G GG Sbjct: 89 GGASGGVGGGGGFGGGGGGGLGG--GQGGGFGGGAGAGGG 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G GG GG G GGG G G Sbjct: 107 GGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGG 142 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 198 GGGAGGGVGGGGGFGG--GGGSGLGGGQGGGFGAGGG 232 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 221 GGQGGGFGAGGGAGGGIGG--GGGFGGGGGGGLGGGHGGG 258 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 236 GIGGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGG 278 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG GG G G G G G+ GG Sbjct: 270 GGGVGGGGGFGGGGGGGLGG--GHGSGFGGGAGVGGG 304 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G GGG G G GG Sbjct: 272 GVGGGGGFGGGGGGGLGGGHGSGFGGGAGVGGGAGGGVGGGGG 314 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 308 GVGGGGGFGGGGGGGLGGGHGGGFGAGAGVGGGAGGGVGGGGG 350 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G G G G G GG Sbjct: 80 GFGGGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFGGG 120 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG G GGG G G GG Sbjct: 199 GGAGGGVGGGGGFGGGGGSGLGG--GQGGGFGAGGGAGGG 236 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G GG Sbjct: 271 GGVGGGGGFGGGGGGGLGGGHGS--GFGGGAGVGGGAGGG 308 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G G GGG G G GG Sbjct: 55 GGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGG 94 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G G GG GG G GGG G G Sbjct: 212 GGGGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGG 248 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG GG GG G GGG G G+ GG Sbjct: 220 GGGQGGGFGAGGGAGGGIGGGGGFGGG--GGGGLGGG 254 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG G G GG Sbjct: 76 GHGGGFGGGGGLGGGASGGVGGGGGFGGGGGGGLGGGQGGG 116 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G GGG G G GG Sbjct: 114 GGGFGGGAGAGGGAGGGLGGGGGFGGGGGGGLGGGGGHGG 153 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG G G GG Sbjct: 150 GHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGG 190 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 189 GGFGGGAGVGGGAGGGVGG--GGGFGGGGGSGLGGGQGGG 226 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G GG G G GG Sbjct: 69 GGGGLGGGHG-GGFGGGGGLGGGASGGVGGGGGFGGG 104 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G GGG G G+ GG Sbjct: 253 GGHGGGFGGGAGVGSGAGGGVGGGGGFGGG--GGGGLGGG 290 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG GG GG G GGG G G+ GG Sbjct: 289 GGHGSGFGGGAGVGGGAGGGVGGGGGFGGG--GGGGLGGG 326 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 294 GFGGGAGVGGGAG-GGVGG--GGGFGGGGGGGLGGGHGGG 330 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G G GG G GGG G G Sbjct: 249 GGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGG 284 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = -2 Query: 893 GGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G G GG GG G GGG G G Sbjct: 324 GGGHGGGFGAGAGVGGGAGGGVGGGGGFGGGGG 356 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG GG G GG GG GG G GGG G G GG V Sbjct: 230 GGGAGGGIGGGGGFGGGGGG--GLGGG--HGGGFGGGAGV 265 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG GG G GGG G G Sbjct: 45 GFGEGEGFGGGGGFGGGGG--GGLGGGGGGLGGGHG 78 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G GG GG GG G GGG G Sbjct: 325 GGHGGGFGAGAGVGGGAGGGVGGGGGFGGGGGGG 358 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GG G G G GG GG GG G GGG G G+ GG Sbjct: 39 GRCHGGGFGEGEGFGGGGGFGGGGGGGLGGG---GGGLGGG 76 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG GG G GG G G GG GG G G S G Sbjct: 53 GGGGGFGGGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASGGVG 96 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G GG G GG GG GG G GGG G G GG V Sbjct: 266 GSGAGGGVGGGGGFGGGGGG--GLGGG--HGSGFGGGAGV 301 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG GG G G GGG G G Sbjct: 257 GGFGGGAGVGSGAGGGVGGGGGFGGGGGGGLGGGHG 292 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GG GG G G Sbjct: 65 GLGGGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGG 103 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G G G GG G GGG G G Sbjct: 35 GCKFGRCHGGGFGEGEGFGGGGGFGGGGGGGLGGGG 70 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G GG GG G G GGG GG G S G Sbjct: 225 GGFGAGGGAGGGIGGGGGFGGGGGGGLGGGHGGGFGGGAGVGSGAGG 271 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGXG-GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG G Sbjct: 146 GGGGGHGGGFGAGGGVGGGAGGGVGGGGGFGGGGGGGLGG 185 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G G GGG AG Sbjct: 86 GLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFGGGAGAG 124 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG G G G Sbjct: 198 GGGAGGGVGGGGGFGG-GGGSGLGGGQGGGFGAGGGAGG 235 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG G GGGG G GG GGG G Sbjct: 74 GGGHGGGFGGGGGLGGGASGGVGGGGGFGGGGGGGLGG 111 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G +GG GG G G GGG G G G Sbjct: 105 GGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFGGGGGG 143 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG EG GGG G GG GGG G Sbjct: 43 GGGFGEGEGFGGGGGFGGGGGGGLGGGGGGLGGGHGGG 80 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = -3 Query: 901 GGGGXXEGGXG---GGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG G GGG G GG GGG Sbjct: 68 GGGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGGGG 105 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG G G G Sbjct: 69 GGGGLGGGHGGGFGGGGGLGGGASGGVGGGGGFGGGGGG 107 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAGDXG 790 G GGG G G GG G G G GG GG G Sbjct: 85 GGLGGGASGGVGGGGGFGGGGGGGLGGGQGGGFGGGAGAG 124 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG G G G Sbjct: 132 GGGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVG 170 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GG G G GG GG G Sbjct: 133 GGGGFGGGGGGGLGGGGGHGGGFGAGGGVGGGAGGGVGG 171 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAGDXG 790 G GGG G G GG G G G GG GG G Sbjct: 159 GGVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGVG 198 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG G G G Sbjct: 247 GGGGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGGG 285 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G G GGG G Sbjct: 160 GVGGGAGGGVGGGGGFGGGGGGGLGGGHGGGFGGGAGVG 198 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGXGGG-GXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G G GG GGG G Sbjct: 214 GGGSGLGGGQGGGFGAGGGAGGGIGGGGGFGGGGGGGLGG 253 >07_03_0177 - 14770777-14772045 Length = 422 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G+ GG Sbjct: 77 GGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGG 116 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G+ GG Sbjct: 194 GLGGGGGLGGGGGLGGGIGKGGGLGGGFGKGGGLGGGGGLGGG 236 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GGG GGG G G GG GG G G G G G+ GG K Sbjct: 65 GGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGK 109 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G G Sbjct: 354 GFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSGIGGGFGKG 393 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G GG G GGG G G GG Sbjct: 64 GGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGG 100 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 94 GGGGGGGLGGGGGFG-KGGGVGGGFGKGGGFGKGGGFGGG 132 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G+ GG Sbjct: 232 GLGGGGGLGGGIGKGGGLGGGIGKGGGLGGGFGKGGGLGGG 272 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G+ GG Sbjct: 273 GGLGGGEDGGLGGGIGKGGGIGGGFGKGGGLGGGGGLGGG 312 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G G Sbjct: 360 GLGGGGGLGGGGGGGGGGFGGGGGSGIGGGFGKGGGFGFG 399 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 226 GLGGGGGLGGGGGLGGGIGKGGGLGGGIGKGGGLGGGFGKGGG 268 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G GI GG Sbjct: 314 GLGGGSGLGGGIGKGGGLGGSFGKGGGLGGGFGKGGGIGGG 354 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 60 GYGKGGGFGGGGGGGG-GGGFGGGGGFGGGGGGGLGGGGG 98 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G GG G GG G GGG G G GG + Sbjct: 344 GFGKGGGIGGGFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSGI 386 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G GGG G G+ GG Sbjct: 268 GLGGGGGLGGGE-DGGLGGGIGKGGGIGGGFGKGGGLGGG 306 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G GGG G G GG Sbjct: 83 GGFGGGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGG 122 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG G GGG G G+ GG Sbjct: 366 GLGGGGGGGGGGFGGGGGSGIGGGFGKGGG--FGFGVGGG 403 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGX-----GGGXXXGRGIXGGXXV 777 G GGG GGG G GG GG GG G GGG G G G V Sbjct: 66 GFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGGLGGGGGFGKGGGV 113 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG GG G GGG G GI GG Sbjct: 257 GGLGGG-FGKGGGLGGGGGLGGGEDGGLGGGIGKGGGIGGG 296 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G GG G GGG G G GG Sbjct: 266 GGGLGGGGGLGGGEDGGLGGGIGKGGGIGGGFGKGGG 302 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GGG G G G Sbjct: 87 GGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGGFGKG 126 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G GG Sbjct: 302 GLGGGGGLGGGGGLGGGSGLGGGI-GKGGGLGGSFGKGGG 340 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG G GG G GGG G G G Sbjct: 62 GKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGGGGGGG 100 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GGG GGG G GG GG G G GGG G G G + K Sbjct: 200 GLGGGGGLGGGIGKGGGLGGGFGKGGGLGGGGGLGGGGGLGGGIGK 245 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 GGG GGG GG GG GG G GG G G G GG Sbjct: 358 GGGLGGGGGLGGGGGGGGGGFGGGGGSGIGGGFGKGGG 395 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG GG G GGG G G Sbjct: 56 GLGGGYGKGGGFGGGG-GGGGGGGFGGGGGFGGGGG 90 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-G--GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG GG G GGG G G+ GG Sbjct: 178 GIGKGGGLGGGFGKSGGLGGGGGLGGGGGLGGGIGKGGGLGGG 220 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-G--GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG GG G GGG G G+ GG Sbjct: 210 GIGKGGGLGGGFGKGGGLGGGGGLGGGGGLGGGIGKGGGLGGG 252 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G G GG Sbjct: 242 GIGKGGGLGGGIGKGGGLGGGFGKGGGLGGGGGLGGGEDGG 282 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 4/43 (9%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G G G GG GG G GGG G G+ G Sbjct: 291 GGIGGGFGKGGGLGGGGGLGGGGGLGGGSGLGGGIGKGGGLGG 333 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/39 (53%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGG-GXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G G GG GG G GGG G G GG Sbjct: 312 GGGLGGGSGLGGGIGKGGGLGGSFGKGGGLGGGFGKGGG 350 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GG G GGG G G GG Sbjct: 100 GLGGGGGFGKGGGVGGGFGKGGGF-GKGGGFGGGFGKGGG 138 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/43 (48%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG GG G GGG G G+ GG Sbjct: 118 GKGGGFGKGGGFGGGFGKGGGIGGGIGHGAGGGFGKGGGLGGG 160 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 146 GAGGGFGKGGGLG-GGIGPGIGGGYGKGGGLGGGIGKGGG 184 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG G GGG G G GG Sbjct: 155 GGLGGGIGPGIGGGYGKGGGLGGGIGKGGGLGGGFGKSGG 194 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GGG G G+ GG Sbjct: 324 GIGKGGGLGGSFGKGGGLGGGFGKGGGIGGGFGKGGGLGGG 364 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G G G GG G GGG G GI G Sbjct: 379 GGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGGGGGGIGG 420 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG G G GGG G G GG Sbjct: 338 GGGLGGGFGKGGGIGGGFGKGGGLGGGGGLGGGGGGG 374 Score = 36.7 bits (81), Expect = 0.025 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 373 GGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGG 413 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG G GGG G G+ GG Sbjct: 137 GGIGGGIGHGAGGGFGKGGGLGGGIGPGIGGGYGKGGGLGGG 178 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GG GG G GG G GG G G GI GG Sbjct: 127 GGFGGGFGKGGGIGGGIGHGAGGGFGKGGGLGGGIGPGIGGG 168 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GGG G G G G GG G G GG G G GG Sbjct: 371 GGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGG 412 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GG GGG G GG GG G G GGG G G G + K Sbjct: 168 GYGKGGGLGGGIGKGGGLGGGFGKSGGLGGGGGLGGGGGLGGGIGK 213 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G GG G G GGG GG G G Sbjct: 58 GGGYGKGG-GFGGGGGGGGGGGFGGGGGFGGGGGGG 92 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG +GG G GG G G GGG GG G Sbjct: 349 GGIGGGFGKGG-GLGGGGGLGGGGGGGGGGFGGGGG 383 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGG-XXGGGXG-XGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG G G GGG G G Sbjct: 111 GGVGGGFGKGGGFGKGGGFGGGFGKGGGIGGGIGHGAG 148 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG G GG G G GGG GG G G Sbjct: 339 GGLGGGFGKGG-GIGG-GFGKGGGLGGGGGLGGGGGGGG 375 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG GG G G GGG GG G G Sbjct: 281 GGLGGGIGKGGGIGGGFGKGGG---LGGGGGLGGGGGLG 316 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GGG G G G Sbjct: 301 GGLGGGGGLGGGGGLGGGSGLGGGIGKGGGLGGSFGKGG 339 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -1 Query: 906 GXXGGGXXRGGXG----XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 370 GGGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGG 412 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = -2 Query: 893 GGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 G G G G G G GG GG G GGG G G Sbjct: 50 GKGLGAGLGGGYGKGGGFGGGGGGGGGGGFGGG 82 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG GG G G GGG GG D G Sbjct: 247 GGLGGGIGKGGGLGGGFGKGGG---LGGGGGLGGGEDGG 282 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG G G G Sbjct: 267 GGLGGGGGLGGGEDGGLGGGIGKGGGIGGGFGKGGGLGG 305 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G GG GGG G Sbjct: 224 GGGLGGGGGLGGGGGLGGGIGKGGGLGGGIGKGGGLGGG 262 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GG+G G Sbjct: 286 GIGKGGGIGGGFGKGG-GLGGGGGLGGGGGLGGGSGLGG 323 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +GG GGG G GG GGG G Sbjct: 58 GGGYGKGGGFGGGGGGGGGGGFGGGGGFGGGGGGGLGG 95 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G GG GGG Sbjct: 363 GGGGLGGGGGGGGGGFGG--GGGSGIGGGFGKGGG 395 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -3 Query: 901 GGGGXXEGGXG---GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG G Sbjct: 373 GGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGGG 414 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG GG GGGG G GG GGG G Sbjct: 193 GGLGGGGGLGGGGGLGGGIGKGGGLGGGFGKGGGLGGG 230 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 306 GGGLGGGGGLGGGSGLGGGIGKGGGLGGSFGKGGGLGGG 344 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGX-GGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG +GG GGG G GG GGG G Sbjct: 103 GGGGFGKGGGVGGGFGKGGGFGKGGGFGGGFGKGGGIGGG 142 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G G G G G G Sbjct: 368 GGGGGGGGGGFGGGGGSGIGGGFGKGGGFGFGVGGGGFG 406 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G G G GG GG G G Sbjct: 376 GGFGGGGGSGIGGGFGKGGGFGFGVGGGGFGGGGGGGGG 414 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 P +P P PPP P PP PP PP P PP PPP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP P PPP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 >08_01_0059 - 394001-394708 Length = 235 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPP 897 PP PRP PPP P PP PP P PPP PPP Sbjct: 36 PPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 73 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 PP PR PP P PP P PP P PPP P P P Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAP 45 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP PP P PP PPP P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTP 40 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP PP PP P P PPP P Sbjct: 13 PPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAP-PPPSHP 51 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P P P PP P PP P PP PPP P Sbjct: 30 PPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSP 71 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPP--PXXPPP 897 PP PR PP P PP P P P P PP P PPP Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPP 56 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP--PXPXPPPXXPPP 897 P P P PPP P P PP P P PPP PP Sbjct: 25 PPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPP 62 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PPP PP P PPPP P PPPP Sbjct: 14 PATPPPPPRRAPP----PPSPPIRPPPPPTPRPYAPPPP 48 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP-XPPSXXPPPP 902 P PPP P P PPP PP+ PPPP Sbjct: 30 PPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P P P PP PP P Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAP 64 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/39 (48%), Positives = 20/39 (51%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PPP P PP P PP P PP PPP P Sbjct: 1177 PSLP-PPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P PPP P P PP P P P P PPP P Sbjct: 1168 TPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPP 1210 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP PP P P PPP PPP P Sbjct: 1137 PPPPPLPEGPPPLPSDSPPCQPPLP--PSPPPATPPPPPP 1174 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P P P PPP P P PP PP P PPP PP P Sbjct: 1161 PPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLP 1202 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 PP +P PPP P PP P PP P P PPP P Sbjct: 1129 PPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATP 1169 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P PP PP P P P PPP Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPP-PPPLPSGPPP 1194 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P PP P PP P PP P P PPP P Sbjct: 1146 PPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPP 1186 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 P P PP P PP P P P PPP P PP P Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQP 1196 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P PPP P P PP P P P P PP P Sbjct: 1122 LPPLPDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQP 1158 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PPP P PP P P P PPP P Sbjct: 1183 PPPPPLPSG-PPPQPAPPPL--PIQPPPIPPPPVP 1214 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P P PPP P PP PP PP P P Sbjct: 1189 PSGPPPQPAPPPLPIQPPPIPP-PPVPSSP 1217 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP PP P PP PPP P Sbjct: 1181 PPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSP 1217 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP-PXXP 906 P P P P P PP PP P P P P PP P P Sbjct: 1166 PATPPPPPPLSPSLPPPPP-PPPLPSGPPPQPAPPPLPIQP 1205 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PS PP P Sbjct: 1164 PPPATPPPPPPLSPSLPPP--PPPPPLPSGPPPQP 1196 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 P PP PP P PPP P PS PPPP Sbjct: 1143 PEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPP 1184 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP-PXPPSXXPPPP 902 P+ PPP PP P PPP P P PPPP Sbjct: 1177 PSLPPPP----PPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P PPP PP P PP PP PP PPPP Sbjct: 1133 PLDAPPP----PPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPP 1172 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PP P PP P Sbjct: 1181 PPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSP 1217 >07_03_0560 + 19479597-19480667 Length = 356 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 196 GGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGG 235 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 126 GGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGG 165 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 284 GGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGG 323 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 74 GGGGGGGLGGGGGFGGGGGA-GGGGGLGGGGGKGGGFGGG 112 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 118 GGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGG 159 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 86 GFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGGLGGG 127 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 229 GGGMGGGAGGGGGLGGGGGGGMGGGGGGGMGGGAGGG 265 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 195 GGGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGG 231 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G+ GG Sbjct: 130 GGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGG 169 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G+ GG Sbjct: 206 GGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGG 245 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 201 GAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGG 241 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 215 GFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGG 255 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 80 GLGGGGGFGGGGGAGG-GGGLGGGGGKGGGFGGGVGGGGG 118 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG GG G GGG G G GG Sbjct: 98 GLGGGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGG 139 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 235 GAGGGGGLGGGGG-GGMGGGGGGGMGGGAGGGFGGGAGGG 273 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G+G GG Sbjct: 243 GGGGGGGMGGGGG-GGMGGGAGGGFGGGAGGGAGQGGSGG 281 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG GGG G G GG Sbjct: 68 GGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLGGGGGKGG 107 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGGXXV 777 GGG GGG G GG GG GG G GGG G G G V Sbjct: 116 GGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGV 156 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G G G G G GG Sbjct: 230 GGMGGGAGGGGGLGGGGGGGMGGGGGGGMGGGAGGGFGGG 269 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/41 (53%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 264 GGFGGG-AGGGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGG 303 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G+ GG Sbjct: 277 GGSGGLGGGGGGGLGGGGGAGGGLGGGAGGGLGHGGGLGGG 317 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 251 GGGGGGGMGGGAG-GGFGGGAGGGAGQGGSGGLGGGGGGG 289 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 92 GAGGGGGLGGGGGKG--GGFGGGVGGGGGGEGGGLGGGGG 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 107 GGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVGGG 143 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G GGG G G+ GG Sbjct: 288 GGLGGGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLGGG 327 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 155 GVGGGSGTGGGLGGGGGGGFGGDGGGGLGGGGGKEGGFGAGGG 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G+ GG Sbjct: 244 GGGGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGG 285 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G G GGG G G GG Sbjct: 260 GGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGG 299 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 139 GVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDGG 179 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GG GG G GGG G G GG Sbjct: 168 GGGGGGFGGDGGGGLGGGGGKEGG-FGAGGGVGGGAGGGGG 207 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG GG GG G GGG G G GG Sbjct: 185 GGGKEGGFGAGGGVGGGAGGGGGMGGGGGGGFGGGGG 221 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G G G GG Sbjct: 200 GGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGGG 239 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG G GGG G G GG Sbjct: 259 GGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGG 298 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 111 GGVGGG--GGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGG 148 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G GGG G G GG Sbjct: 256 GGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGGGGG 295 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG G G GGG G G GG Sbjct: 83 GGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGG 122 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G GGG G G GG Sbjct: 176 GDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGGGGGGG 215 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G GGG G G GG Sbjct: 210 GGGGGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGG 249 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G G GG G GG G GGG G G G Sbjct: 143 GGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDGGGG 181 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX--GGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG GG G GGG G G Sbjct: 149 GFGAGGGVGGGSGTGGGLGGGGGGGFGGDGGGGLGGGG 186 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G G GG G GG G GGG G G G Sbjct: 219 GGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGG 257 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 58 GRCRGG--GGGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGG 96 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G G GG Sbjct: 187 GKEGGFGAGGGVG-GGAGGGGGMGGGGGGGFGGGGGKGGG 225 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GGAG G Sbjct: 240 GGLGGGGGGGMGGGGGGGMGGGAGGGFGGGAGGGAGQGG 278 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXG--XGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG GG GG G GGG G G Sbjct: 268 GGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGGLGGGAG 305 Score = 35.9 bits (79), Expect = 0.044 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GG G GG GG GG G GG G G G GG Sbjct: 269 GAGGGAGQGGSGGLGGGGG--GGLGGGGGAGGGLGGGAGGG 307 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GG G G Sbjct: 62 GGGGGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLG 100 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG--GXGXXXGXXXXXGGGXXGGAG 799 G GGG GG G G G G G GGG GGAG Sbjct: 234 GGAGGGGGLGGGGGGGMGGGGGGGMGGGAGGGFGGGAG 271 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXX-----XGRGIXGG 786 G GGG GG G G GG GG G GGG G G+ G Sbjct: 294 GGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLGGGGFGVGVGVGVG 338 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GG G G Sbjct: 85 GGFGGGG--GAGGGGGLGGGGGKGGGFGGGVGGGGGGEG 121 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG GG GGG AG Sbjct: 115 GGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAG 153 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG GG G G GGG GG G G Sbjct: 186 GGKEGGFGAGGGVGGGAGGGGGMGGGGGGGFGGGGGKGG 224 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG GG G G GGG GG G G Sbjct: 214 GGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGG 254 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG GG G G GGG GG G Sbjct: 224 GGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGGMG 259 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGDXGR 787 G G G GG G G G G G G G GGAG GR Sbjct: 316 GGLGHGGGLGGGGFGVGVGVGVGVGFGGGAGAGGGAGGGGR 356 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 112 GVGGGGGGEGG-GLGG-GGGGGLGGGGGGGVGGGGGQGG 148 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G GG GGG G Sbjct: 104 GKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVGG 142 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG GG G G GGG GG G G Sbjct: 138 GGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDG 178 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGX-XGGAGDXG 790 G GG GG G GG G G GGG GG G G Sbjct: 102 GGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVG 141 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G GG GGG G Sbjct: 173 GFGGDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGGG 211 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G G G G G G GG G G Sbjct: 135 GGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGG 170 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G G G GG G G GGG GG G G Sbjct: 63 GGGGFGGDGGFGGGGGGGLGGGGGFGGGGGAGGGGGLGG 101 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG GG G G Sbjct: 84 GGGFGGGGGAGGGGG--LGGGGGKGGGFGGGVGGGG 117 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG G G AG Sbjct: 237 GGGGGLGGGGGGGMGGGGGGGMGGGAGGGFGGGAGGGAG 275 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGG 816 G GGG G G G G G GG G G GGG Sbjct: 322 GGLGGGGFGVGVGVGVGVGFGGGAGAGGGAGGG 354 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG G G GG G G GGG G G Sbjct: 114 GGGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGG 149 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG G G GG G G G G GG G Sbjct: 164 GGLGGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVG 199 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 901 GGGGXXEGGX--GGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GGG G Sbjct: 83 GGGGFGGGGGAGGGGGLGGGGGKGGGFGGGVGGGGGGEGGG 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 147 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGDGGGGLGG 184 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 223 GGGFGAGGGMGGGAGGGGGLGGGGGGGMGGGGGGGMGG 260 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +GG GGGG G GG GGG G Sbjct: 64 GGGFGGDGGFGGGG-GGGLGGGGGFGGGGGAGGGGGLGG 101 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GG G G GG GGG G Sbjct: 254 GGGGMGGGAGGGFGGGAGGGAGQGGSGGLGGGGGGGLGG 292 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAG 799 G G G GG GG G G G GG GG G Sbjct: 292 GGGGAGGGLGGGAGGGLGHGGGLGGGLGHGGGLGGGG 328 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 45 GGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGG 84 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 40 GGGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGG 79 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGG 80 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G G GGG G GG GG GG G GGG G GG V Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGGSEV 89 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GGG G G G GG GG GG G GG R + Sbjct: 58 GGGGGGGGGSGGGCGGGGGGGGGSSGGGGSEVLERRV 94 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXG-GAGDXGRXXSXXXGXXXXVEXR 742 GGG GG G GG G G GG G G G G S G +E R Sbjct: 41 GGGGGGGGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSGGGGSEVLERR 93 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 46.0 bits (104), Expect = 4e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PP PPP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPPPLPP 454 Score = 45.2 bits (102), Expect = 7e-05 Identities = 18/34 (52%), Positives = 19/34 (55%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P P PPP P PP PP PP PPP PPP Sbjct: 424 LPPPPPLPPPPPPPPPPPPPLPPN-MPPPLPPPP 456 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T PP P P PPP P PP PP P P PPP P Sbjct: 422 TELPPPPPLPPPPPPPPP-PPPPLPPNMPPPLPPPPEP 458 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPPP P P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPPPEPELNGAP 464 >03_02_0765 + 11000724-11002496 Length = 590 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 292 GGLGGGTGGGGGLGGGAGGGLGGGAGAGGGLGGGAGAGGG 331 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 332 GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGAGGG 371 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 372 GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGTGGG 411 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 412 GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGGGAGAGGG 451 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 252 GGLGGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGGTGGG 291 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 207 GAGGGGGLGGGAG-GGLGGGAGGGGGAGGGLGGGAGGGGG 245 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G+ GG Sbjct: 76 GGFGGGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGGLGGG 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G+ GG Sbjct: 148 GGAGGGLGGGAGGGGGLGGGAGG--GLGGGAGGGGGVGGG 185 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 220 GGLGGGAGGGGGAGGGLGGGAGGGGGLGGG--AGGGLGGG 257 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G+ GG Sbjct: 230 GGAGGGLGGGAGGGGGLGGGAGG--GLGGGAGGGGGLSGG 267 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G GG GG GG G GG G G G+ GG Sbjct: 315 GAGAGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGG 355 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G GG GG GG G GG G G G+ GG Sbjct: 355 GAGAGGGLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGG 395 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G GG GG GG G GG G G G+ GG Sbjct: 395 GAGAGGGLGGGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGG 435 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G+ GG Sbjct: 110 GGLGGGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGG 149 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG GG GG G GGG G G Sbjct: 216 GGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAG 251 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G G G G G+ GG Sbjct: 248 GGAGGGLGGGAGGGGGLSGGAGGGLGGGAGAGGGGGLGGG 287 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G GG Sbjct: 38 GGGGFGGGGGFGGGGGL-GGGGGAGGGFGGGLGHGGG 73 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G+ GG Sbjct: 41 GFGGGGGFGGGGGLGGGGGAGG---GFGGGLGHGGGLGGG 77 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G G G G G GG Sbjct: 114 GGFGGGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGGAGGG 153 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 302 GGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGG 341 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 342 GGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGGAGGG 381 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 382 GGLGGGAGGGLGGGAGAGGGLGGGAGTGGGGGLGGGAGGG 421 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 422 GGLGGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGGAGGG 461 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG GG GG G GGG G+G Sbjct: 490 GGLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGGGKG 525 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 62 GGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGGGAGGG 101 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 152 GGLGGGAGGGGGLGGGAGGGLGG--GAGGGGGVGGGLGGG 189 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 175 GAGGGGGVGGGLG-GGAGGGLGSGAGGGGGLGGGAGGGGG 213 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G+ GG Sbjct: 202 GGLGGGAGGGGGLGGGAGGGLGG--GAGGGGGAGGGLGGG 239 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G+ GG Sbjct: 331 GGGLGGGAGGGGGLGGGAGG--GLGGGAGAGGGLGGG 365 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G+ GG Sbjct: 371 GGGLGGGAGGGGGLGGGAGG--GLGGGAGAGGGLGGG 405 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG G GG G GGG G G+ GG Sbjct: 466 GGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGGGGLGGG 505 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 157 GAGGGGGLGGGAG-GGLGGGAGGGGGVGGGLGGGAG 191 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG GG GG G GGG G G Sbjct: 234 GGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAG 269 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 277 GAGGGGGLGGGTGGGGGLGGGTGGGGGLGGG--AGGGLGGG 315 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G GGG G G GG Sbjct: 282 GGLGGGTGGGGGLGGGTGGGGGLGGGAGGGLGGGAGAGGG 321 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/41 (53%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 287 GTGGGGGLGGGTGGGGGLGGGAGG--GLGGGAGAGGGLGGG 325 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 72 GGLGGGFGGGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGG 111 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G G GG Sbjct: 100 GGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGGGGG 139 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G G+ GG Sbjct: 188 GGAGGGLGSGAGGGGGLGGGAGGGGGLGGG--AGGGLGGG 225 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG G GGG G G+ GG Sbjct: 257 GAGGGGGLSGGAGGGLGGGAGAGGGGGLGGGTGGGGGLGGG 297 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G G+ GG Sbjct: 270 GGLGGG--AGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGG 307 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 411 GGGLGGGAGGGGGLGGGAGG--GLGGGAGAGGGFGGG 445 Score = 41.5 bits (93), Expect = 9e-04 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GGG G G GG Sbjct: 489 GGGLGGGAGGGGGLGGGAGG--GLGGGAGAGGGFGGG 523 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G G G G G GG Sbjct: 504 GGAGGGLGGGAGAGGGFGGGKGGGFGGGLGGSSGSGFGGG 543 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G+ G Sbjct: 105 GLGHGGGLGGGFG-GGKGGGLGGGGGLGGGAGGGGGLGSG 143 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G G G G G GG Sbjct: 162 GGLGGGAGGGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGG 201 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG G GGG G G GG Sbjct: 170 GGLGGGAGGGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGG 211 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG GG G GGG G G GG Sbjct: 212 GGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGGGLGGGAGGG 253 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GG G GGG G G GG Sbjct: 269 GGGLGGGAGAGGGGGL-GGGTGGGGGLGGGTGGGGG 303 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 321 GLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 361 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 361 GLGGGAGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 401 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 401 GLGGGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 441 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 441 GFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGG 481 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G G+ GG Sbjct: 476 GGFGGGAGAGTGGGGGLGGGAGGGGGLGGG--AGGGLGGG 513 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 80 GGKGGGLGGGGGLGGGGGAGGGFGGGLGHGGG--LGGGFGGG 119 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 123 GLGGGGGLGGGAGGGGGLGSGGGLGGGAGGGLGGGAGGGGG 163 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G G GG GG G GG G G G GG Sbjct: 153 GLGGGAGGGGGLGGGAGGGLGGGAGGGGGVGGGLGGGAGGG 193 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G+ GG Sbjct: 180 GGVGGG-LGGGAG-GGLGSGAGGGGGLGGGAGGGGGLGGG 217 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G G GG GG G GG G G G GG Sbjct: 203 GLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGG 243 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG GG GG G G GGG G+G Sbjct: 51 GGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKG 83 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG GG GG G G GGG G+G Sbjct: 89 GGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKG 121 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G+ GG Sbjct: 128 GGLGGG-AGGGGGLGSGGGLGGGAGGGLGGGAGGGGGLGGG 167 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G+ GG Sbjct: 139 GLGSGGGLGGGAG-GGLGGGAGGGGGLGGG--AGGGLGGG 175 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX---GXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 239 GAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLGGGAGAGGG 281 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG G GG G GGG G G GG Sbjct: 541 GGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGG 577 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG GG G GGG G G Sbjct: 435 GAGAGGGFGGGAGAGG-GGGLGGGAGGGGGLDGGAG 469 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG GG G G GGG G G GG Sbjct: 480 GGAGAGTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGG 519 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRG 798 G GGG G G G GG GG GG G GGG G G Sbjct: 133 GAGGGGGLGSGGGLGGGAGGGLGGGAGGGGGLGGGAG 169 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GGG G G GG GG G GG G G+ GG Sbjct: 235 GLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSGGAGGGLGGG 275 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G GGG G G GG Sbjct: 452 GGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGG 491 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G G GG GG G GGG G G Sbjct: 471 GAEAGGGFGGGAGAGTGGGGGLGGGAGGGGGLGGGAG 507 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 495 GAGGGGGLGGGAG-GGLGGGAGAGGGFGGG--KGGGFGGG 531 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G G G G GG G G G G G GG V Sbjct: 543 GFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGGGGFGGGGGV 586 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G G G G G+ GG Sbjct: 118 GGKGGGLGGGGGLGGGAGGGGGLGSGGGLGGGAGGGLGGG 157 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G G GG Sbjct: 271 GLGGGAGAGGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGGG 311 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG G G GGG G G GG Sbjct: 462 GGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGGGG 501 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG GG G G GGG G G GG Sbjct: 192 GGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGG 231 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG GGAG G Sbjct: 206 GGAGGGGGLGGGAGGGLGGGAGGGGGAGGGLGGGAGGGG 244 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G GGG G G GG Sbjct: 224 GGAGGGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGG 263 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G GGG G G GG Sbjct: 37 GGGGGFGG-GGGFGGGGGLGGGGGAGGGFGGG 67 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G GG G G G G G GG Sbjct: 221 GLGGGAGGGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGG 261 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G G G G G+ GG Sbjct: 301 GGGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGG 337 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G G G G G+ GG Sbjct: 341 GGGLGGGAGGGLGGGAGAGGGLGGGAGAGGGGGLGGG 377 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G G G G G+ GG Sbjct: 381 GGGLGGGAGGGLGGGAGAGGGLGGGAGTGGGGGLGGG 417 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G G G G G+ GG Sbjct: 421 GGGLGGGAGGGLGGGAGAGGGFGGGAGAGGGGGLGGG 457 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GG G GGG G G+ GG Sbjct: 430 GGLGGG-AGAGGGFGG-GAGAGGGGGLGGGAGGGGGLDGG 467 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 513 GAGAGGGFGGGKG-GGFGGGLGGSSGSGFGGGFGAGGGAGGG 553 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG GG GGG G G GG Sbjct: 184 GGLGGGAGGGLGSGAGGGGGLGGGA---GGGGGLGGGAGGG 221 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXG-GXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G+ GG Sbjct: 52 GGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGG 95 Score = 36.7 bits (81), Expect = 0.025 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXG-GXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G+ GG Sbjct: 90 GGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGG 133 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG G GG G G G G G GG Sbjct: 122 GGLGGGGGLGGGAGGGGGLGSGGGLGGGAGGGLGGGAGGG 161 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG G GG GGG G G G Sbjct: 451 GGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAGAGTG 487 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G G G G G Sbjct: 508 GGLGGGAGAGGGFGGGKGGGFGGGLGGSSGSGFGGGFGAG 547 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG-XGGGXXXGRGIXGG 786 G GG GGG G G GG GG G G G G G GG Sbjct: 509 GLGGGAGAGGGFGGGKGGGFGGGLGGSSGSGFGGGFGAGGG 549 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G G G G GG G G GGG G G+ G Sbjct: 549 GAGGGAGAGFGGGAGAGGGGGLGAGGGGGGGFGGGGGVGG 588 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G G Sbjct: 500 GGLGGGAGGGLGGGAGAGGGFGG--GKGGGFGGGLGGSSG 537 Score = 35.1 bits (77), Expect = 0.077 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGG-XGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G GG G GGG G G G Sbjct: 518 GGFGGGKGGGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFG 559 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG GG G G G G G G+ G Sbjct: 534 GSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAG 573 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG G G GG Sbjct: 67 GLGHGGGLGGGFGGGKGGGLGGGGGLGGGGG--AGGGFGGG 105 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG GG G G Sbjct: 199 GGGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGAGG 234 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXG--GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG GG G GG G GG Sbjct: 439 GGGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGG 477 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG G G G GG G G G G G+ G Sbjct: 499 GGGLGGGAGGGLGGGAGAGGGFGGGKGGGFGGGLGG 534 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GGAG G Sbjct: 305 GGGAGGGLGGGAGAGG-GLGGGAGAGGGGGLGGGAGGGG 342 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GGAG G Sbjct: 345 GGGAGGGLGGGAGAGG-GLGGGAGAGGGGGLGGGAGGGG 382 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GGAG G Sbjct: 385 GGGAGGGLGGGAGAGG-GLGGGAGTGGGGGLGGGAGGGG 422 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GGAG G Sbjct: 425 GGGAGGGLGGGAGAGG-GFGGGAGAGGGGGLGGGAGGGG 462 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG GG G G GGG GG G Sbjct: 494 GGAGGGGGLGGGAGGGLGGGAGAGGGFGGGKGGGFG 529 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G G G GG Sbjct: 522 GGKGGGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGG 561 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G G GG G G G G G GG Sbjct: 189 GAGGGLGSGAGGGGGLGGGAGGGGGLGGGAGGGLGGGAGGG 229 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG GG G G Sbjct: 228 GGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGLSG 266 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GGAG G Sbjct: 244 GGLGGGAG-GGLG-GGAGGGGGLSGGAGGGLGGGAGAGG 280 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG G G AG Sbjct: 279 GGGGGLGGGTGGGGGLGGGTGGGGGLGGGAGGGLGGGAG 317 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = -1 Query: 906 GXXGGGXXRGGXG-----XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GGAG G Sbjct: 407 GTGGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGGGAGAGG 450 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GG G G G G G GG Sbjct: 526 GGFGGGLGGSSGSGFGGGFGAGGGAGGGAGAGFGGGAGAGGG 567 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG GG G G GGG GG G Sbjct: 138 GGLGSGGGLGGGAGGGLGGGAGGGGGLGGGAGGGLG 173 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG G G G Sbjct: 286 GGTGGGGGLGGGTGGGGGLGGGAGGGLGGGAGAGGGLGG 324 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GG G G Sbjct: 147 GGGAGGGLGGGAG-GGGGLGGGAGGGLGGGAGGGGGVGG 184 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG GG G G Sbjct: 178 GGGGVGGGLGGGAGGGLGSGAGGGGGLGGGAGGGGGLGG 216 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G GG G G GGG GGAG G Sbjct: 370 GGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGTGG 410 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 906 GXXGGGXXRGG-XGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG G GG G GGG GGAG Sbjct: 447 GAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGGGAG 483 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G GGG GGAG G Sbjct: 485 GTGGGGGLGGGAGGGG-----GLGGGAGGGLGGGAGAGG 518 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG G G G Sbjct: 487 GGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGFGG 522 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 266 GGAGGGLG-GGAGAGGGGGLGGGTGG-GGGLGGGTGGGG 302 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG G G G Sbjct: 329 GGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGG 364 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G GG G G GGG GGAG G Sbjct: 330 GGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGGGAGAGG 370 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG G G G Sbjct: 369 GGGGGLGGGAGGGGGLGGGAGGGLGGGAGAGGGLGG 404 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG G G G Sbjct: 440 GGFGGGAGAGGGGGLGGGAGGGGGLDGGAGGGAEAGGGFGG 480 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRG-GXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G GG G G GG GG G G Sbjct: 144 GGLGGGAGGGLGGGAGGGGGLGGGAGGGLGGGAGGGGGVG 183 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -1 Query: 906 GXXGGGXXRG-GXGXG-GXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG G G G G G G G GGG GG G G+ Sbjct: 548 GGAGGGAGAGFGGGAGAGGGGGLGAGGGGGGGFGGGGGVGGK 589 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GG G Sbjct: 50 GGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGG 88 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GG G Sbjct: 88 GGGGLGGGGGAGGGFGGGLGHGGGLGGGFGGGKGGGLGG 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GG G Sbjct: 136 GGGGLGSGGGLGGGAGGGLGGGAGGGGGLGGGAGGGLGG 174 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GGGG G GG GGG AG Sbjct: 450 GGGGLGGGAGGGGGLDGGAGGGAEAGGG---FGGGAGAG 485 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG---GXGXXXGXXXXXGGGX--XGGAGDXG 790 G GGG GG G G G G G GGG GGAG G Sbjct: 457 GAGGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGGG 500 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG G G G Sbjct: 66 GGLGHGGGLGGGFGGGKGGGLGGGGGLGGGGGAGGGFGG 104 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXG--XXXXXXXXGGXXXXGGG*XAG 785 GGGG +GG GGG G GG GGG G Sbjct: 459 GGGGGLDGGAGGGAEAGGGFGGGAGAGTGGGGGLGGGAGGG 499 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GG G Sbjct: 541 GGGFGAGGGAGGGAGAGFGGGAGAGGGGGLGAGGGGGG 578 >03_01_0515 - 3864796-3865425 Length = 209 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP P PPP PPP Sbjct: 73 PPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPP 109 Score = 44.8 bits (101), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP P PPP PPP P Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P PP PP P PP PPP P Sbjct: 62 PPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PPP PP PP PP P P PPP Sbjct: 85 PPPLPPP---PPPPAASPPPPPPSPPPPSPVKSSPPP 118 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP P PP P P PPP P Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP P PPPP Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP+ PPPP Sbjct: 68 PLMPPPP----PPPSVTSSPPPPPLPPPPPPPAASPPPP 102 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPX----PPPXXPPPXXP 906 PP P P PP P P PP PP P PPP PP P Sbjct: 49 PPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPP 93 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP P P PPP P Sbjct: 39 PPSPPTEASPPPLAP--PPSVTSSPPPPAAGPLMPPPPPP 76 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXX--PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PPS PP P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P PPPP S PPPP Sbjct: 49 PPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPP 87 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP------PXPPSXXPPPP 902 P PP PP P PPP P PP PPPP Sbjct: 50 PLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPP 94 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PPP PPP Sbjct: 29 PAPSPEAEASPPSPPTEASPPPLAPPP 55 >03_01_0023 + 198414-198968 Length = 184 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G GG Sbjct: 36 GGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGG 75 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 42 GGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGG 81 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GG G G G Sbjct: 39 GGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGG 77 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G G GG Sbjct: 57 GSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGG 96 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G GG Sbjct: 38 GGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGG 77 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G G GGG G G GG Sbjct: 46 GGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGG 86 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G G G G G GG Sbjct: 55 GGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGG 94 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GGG G GG G GG G G GG G G GG Sbjct: 45 GGGGGGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGG 85 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG GG G GG G G GGG GG G GR Sbjct: 60 GGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGGR 99 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GG G G GG Sbjct: 51 GRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGG 90 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 59 GGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGGGGGGG 98 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG GG GG G GG G G GG Sbjct: 49 GGGRGGGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGG 88 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G G GG GG G GG G G GG Sbjct: 54 GGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGGGSGG 93 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G G GG G G GGG G G G S G Sbjct: 26 GCQCGSCPSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGG 72 >07_03_0559 + 19475893-19476783 Length = 296 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 120 GGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGG 160 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GGG G G+ GG Sbjct: 125 GGFGGGSGGGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGG 164 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/39 (53%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 116 GGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGVGGG 154 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 112 GSGAGGGLGGGGG-GGFGGGSGGGVGGGGGQGGGFGAGGG 150 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG GG GG G GGG G G Sbjct: 89 GGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGG 124 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G GG Sbjct: 163 GGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGG 202 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 68 GGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGGCEGGGFGGG 108 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G GGG G G+ G Sbjct: 158 GGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGG 195 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGX-GGGXXXGRGIXGGXXV 777 G GG GGG G GG GG GG G GGG G G G V Sbjct: 108 GVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGGGV 151 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGGXXV 777 G GG GGG G GG GG GG G GGG G G G V Sbjct: 150 GVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGV 193 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/37 (54%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG GG G GGG G G+ GG Sbjct: 64 GGGFGGGGGFRGGGGGGLGGGGGFGGG--GGGGLGGG 98 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GGG G G G GG GG G G GG G G+ GG Sbjct: 80 GLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGG 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 176 GIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGG 216 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/44 (47%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G GG GG G G GGG G G GG + Sbjct: 134 GVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGI 177 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX--GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 144 GFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKGG 185 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG GG GGG G G+ GG Sbjct: 75 GGGGGGLGGGGGFGGGGGGGLGGGGCEGGG--FGGGVGGG 112 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G GGG G G GG Sbjct: 79 GGLGGGGGFGGGGGGGLGGGGCEGGGFGGGVGGGSGAGGG 118 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G G G GG GG G GGG G G Sbjct: 204 GSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGG 242 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG G GGG G Sbjct: 210 GFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGGGG 244 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GG GG GG GG G G GG G G GG Sbjct: 103 GGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGG 143 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G GG G G+ G Sbjct: 167 GGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSG 206 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GGG G G+ GG Sbjct: 191 GGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAG-GVMGG 229 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G G GG Sbjct: 65 GGFGGGGGFRGGGGGGLGG-GGGFGGGGGGGLGGGGCEGG 103 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG G GGG G G+ GG Sbjct: 201 GGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGG 240 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G GGG G G GG Sbjct: 93 GGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGGGSGGG 134 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG GGG G G GG Sbjct: 180 GGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGG 219 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G GG G GG G GGG G G G Sbjct: 190 GGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAGG 225 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG G G G G G G GG Sbjct: 195 GAAGGGGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGG 234 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G GG G G GG Sbjct: 200 GGGMGSGGGGGFGGGGGKGGGFGAGGVMGGGAGGGGG 236 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG--GXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G G GG GG G GGG G G Sbjct: 171 GGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGG 208 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G GGG G GG GG GG G GGG G G GG Sbjct: 58 GRCHGGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGG 94 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG RGG G GG G G GGG GG + G Sbjct: 66 GFGGGGGFRGG-GGGGLGGGGGFGGGGGGGLGGGGCEGG 103 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G GG G G GGG GG G G Sbjct: 111 GGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQGGGFGAGG 149 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG G GG G GGG G G G Sbjct: 185 GGFGAGGGVGGAAGGGGGMGSGGGGGFGGGGGKGGGFGAG 224 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G G G G G GG Sbjct: 206 GGGGGFGGGGGKGGGFGAGGVMGGGAGGGGGLGGGGG 242 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GGG G Sbjct: 91 GGGGLGGGGCEGGGFGGGVGGGSGAGGGLGGGGGGGFGG 129 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG GG G G GGG GG G G Sbjct: 133 GGVGGGGGQGGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGG 173 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 897 GGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G GG G G GGG GG G G Sbjct: 62 GGGGGFGGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGG 99 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG G G G G GG GG G G Sbjct: 175 GGIGGGGGKGG-GFGAGGGVGGAAGGGGGMGSGGGGGFG 212 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG GG G G GGG GG+G Sbjct: 99 GCEGGGF--GGGVGGGSGAGGGLGGGGGGGFGGGSG 132 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG G G GG G G G G GG G Sbjct: 159 GGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVG 194 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 142 GGGFGAGGGVGGGSGTGGGLGGGGGGGFGGGGGGGIGG 179 >06_03_1326 - 29355467-29355817 Length = 116 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 3 GKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGG 42 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG G GG G GGG G+G Sbjct: 11 GGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKG 46 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G G GG GG G GGG G G G Sbjct: 15 GGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSG 53 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG G G GG G G GG Sbjct: 26 GGGSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGG 62 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G GG GG GGG G G GG Sbjct: 9 GGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGG 48 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG GGG G GG Sbjct: 28 GSGGGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGG 68 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G GG G GG G GGG Sbjct: 53 GKYGGGYSGGHAGGGGGAGKSGGYHGGGGG 82 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG GG G GG G G GGG GG G S G Sbjct: 10 GGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGGKGGGEGGSGKYG 56 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--------XGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G GG Sbjct: 32 GGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAGKSGGYHGG 79 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -1 Query: 879 GGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG G GG G G GGG GG G G S G Sbjct: 2 GGKGGGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGG 39 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G GG GG G G G Sbjct: 57 GGYSGGHAGGGGGAGKSGGYHGGGGGDSMKAPGGDG 92 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GGGG GG GGG G Sbjct: 6 GGGGGGGKGGGGGGGGGKGGGGGSGGGGRSGGGGGGGGG 44 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGG--XXXXGGG*XAG 785 GGG GG GGGG G GG GGG AG Sbjct: 31 GGGRSGGGGGGGGGKGGGEGGSGKYGGGYSGGHAGGGGGAG 71 >09_04_0506 - 18188785-18190599 Length = 604 Score = 44.8 bits (101), Expect = 1e-04 Identities = 22/40 (55%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GGG GRG G Sbjct: 307 GNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGGMGGRGQAG 346 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GG G G GG Sbjct: 302 GAQVGGNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGGMGG 341 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G GG GG GG G GGG GRG G Sbjct: 298 GGPGGAQVGGNYGGGRGGGGGGPGGGGGGGGGGNWGRGGGG 338 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG GG G GGG G G GG Sbjct: 293 GGGAAGGPGGAQVGGNYGGGRGGGGGGPGGGGGGGG 328 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G GGG G G GG Sbjct: 290 GGRGGGAAGGPGGAQVGGNYGGGRGGGGGGPGGGGGGGGG 329 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G G G GG Sbjct: 318 GGPGGGGGGGGGGNWGRGGGGMGGRGQAGNMRNRMGPVGG 357 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PPP P PP PP PPP PP P Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPPLQAPPPPP 81 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 9/46 (19%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---------XPPPXXPPP 897 PP P+ PPP PP PP P PP PPP Sbjct: 54 PPPPPQQQQQPPPISQQPPPLQAPPPPPQQQQQQQQLQAPPSLPPP 99 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG GG GG G G GGG GG G+ GR G Sbjct: 301 GGAQVGGNYGGGRGGGGGGPGGGGGG--GGGGNWGRGGGGMGG 341 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P PP P P PPP Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPPLQAPPPP 80 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 11/50 (22%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP-----------XPPSXXPPPP 902 P PPP P P PPPP PPS PPPP Sbjct: 52 PQPPPPPQQQQQPPPISQQPPPLQAPPPPPQQQQQQQQLQAPPSLPPPPP 101 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P PP P PP PPP Sbjct: 111 PGVAAVPPAPVPDRPNPVHLPPQPQPPVAAAPPP 144 >07_01_0080 + 587674-588510 Length = 278 Score = 44.8 bits (101), Expect = 1e-04 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 RP PPP P PP PP P PPP PPP Sbjct: 90 RPPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P P PP P PPP PPP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 43.2 bits (97), Expect = 3e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP P PPP PPP P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P P PP P PP PP PP P PP Sbjct: 93 PPPPPPPSSGSPPPPPPPP--PPPPPPPPPP 121 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP + P P PP P P PPP PPP P Sbjct: 76 TSTPPRLGGDGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPPP 118 Score = 35.5 bits (78), Expect = 0.059 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP P P P P PP PP PP P P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP PP PPPP Sbjct: 93 PPPPPPPSSGSPP----------PPPPPPPPPPPPPPPP 121 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 PPP P P PPPP PP Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 >01_01_0570 - 4231100-4232560 Length = 486 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 77 GGTGGGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFGG 116 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/44 (50%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G GG GG G G GGG G G+ GG V Sbjct: 201 GGAGGGVGGGGELGGGGMGGGSGFGGGAGGGFGAGGGVGGGIGV 244 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/41 (51%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G G+ GG Sbjct: 211 GELGGGGMGGGSGFGGGAGGGFGAGGGVGGGIGVGGGMGGG 251 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GG G GG GG G G GGG G G+ GG V Sbjct: 106 GGMGGSGGFGGGGGGGVGGGVGAGFGSGGGVGAGGGLRGGGGV 148 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G+ GG Sbjct: 206 GVGGGGELGGGGMGGGSGFGGGAGGGFGAGGGVGGGIGVGGG 247 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G GGG G G GG Sbjct: 139 GGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGG 175 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GGG G G GG Sbjct: 192 GMGGGGGFGGGAGGGVGGGGELGGGGMGGGSGFGGGAGGG 231 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 181 GVGGGGRFGGG-GMGGGGGFGGGAGGGVGGGGELGGGGMGGG 221 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G GG G GGG G G GG Sbjct: 141 GLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGG 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX---GGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G GG Sbjct: 149 GAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVGGGGRFGGG 191 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G GGG G G+ G Sbjct: 90 GGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGGVGAG 129 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G G GG G G GGG G G+ GG Sbjct: 146 GGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVGGG 185 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX--GGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 196 GGGFGGGAGGGVGGGGELGGGGMGGGSGFGGGAGGGFGAGGG 237 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G+ GG Sbjct: 85 GGLGGG-GGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGG 125 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GG GR GG Sbjct: 270 GGAGGGVGGGGGGGMGGGGGFGGGGGVGGN--TGRDFDGG 307 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G G GG G G GG Sbjct: 81 GGAAGGLGGGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGG 121 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G+ GG Sbjct: 171 GFGGGAGAGGGVGGGGRFGGGGMGGGGGFGGG--AGGGVGGG 210 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG GG G GGG G G GG Sbjct: 359 GWSGGAGGGFGTGGGSGFGGGLGGGGGIGGGLGVGGGTGGG 399 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G G GGG G G GG Sbjct: 63 GGEGGGVGVGGGVGGGTGGGAAGGLGGGGGGGGGLGGSGG 102 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG GGG G G GG Sbjct: 191 GGMGGGGGFGGGAGGGVGGGGELGGGGMGGGSGFGGG 227 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GG GGG G G+ GG Sbjct: 159 GAGGGGGIGAGGGFGGGAGAGGGV--GGGGRFGGGGMGGG 196 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GGG G G GG Sbjct: 165 GIGAGGGFGGGAGAGGGVGGGGRFGGGGMGGGGGFGGGAGGG 206 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG GGG G GG Sbjct: 186 GRFGGGGMGGGGGFGGGAGGGVGGGGELGGGGMGGGSGFGG 226 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G+ GG Sbjct: 277 GGGGGGGMGGGGGFGGGGGV-GGNTGRDFDGGKGNGLNGG 315 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG GG G GGG G G GG Sbjct: 96 GLGGSGGLGGG-GMGGSGGFGGGGGGGVGGGVGAGFGSGGG 135 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G GGG G G+ G Sbjct: 112 GGFGGGGGGGVGGGVGAGFGSGGGVGAGGGLRGGGGVGAG 151 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G GGG G + GG Sbjct: 179 GGGVGGGGRFGGGGMGGGGGFGGGAGGGVGGGGELGGG 216 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG G GG G GGG G GI G Sbjct: 133 GGGVGAGGGLRGGGGVGAGGGGGFGGGAGGGGGIGAG 169 Score = 37.5 bits (83), Expect = 0.015 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GG G GG GG GG G GGG G G GG V Sbjct: 254 GGIGGGAGGGMGGDIGGGAGGGVGG--GGGGGMGGGGGFGGGGGV 296 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G G G G I GG Sbjct: 231 GFGAGGGVGGGIGVGGGMGGGASGGIGGGAGGGMGGDIGGG 271 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G G G G G GG Sbjct: 131 GSGGGVGAGGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGG 171 Score = 36.3 bits (80), Expect = 0.033 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G G G+ GG Sbjct: 369 GTGGGSGFGGGLGGGGGIGGGLGVGGGTGGGSGANEGAGMGGG 411 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G GGG G GG G GG G GGG G G GG + Sbjct: 125 GVGAGFGSGGGVGAGG-GLRGGGGVGAGGGGGFGGGAGGGGGI 166 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGG---GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G G GGG G G GG Sbjct: 154 GGFGGGAGGGGGIGAG-GGFGGGAGAGGGVGGGGRFGGGGMGG 195 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GG G GG GG GG G G GG G G GG Sbjct: 246 GGMGGGASGGIGGGAGGGMGGDIGGGAGGGVGGGGGGGMGGGGG 289 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G G GG GG GG G G GGG G G+ G V Sbjct: 306 GGKGNGLNGGDGASGGIGG--GASGGFGGGAGIGEGVGNGFGV 346 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G G G G G GG GG G GGG G G+ GG + Sbjct: 345 GVGAGAGTGLGSGFGWSGGAGGG-FGTGGGSGFGGGLGGGGGI 386 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G G G GG G GGG G G+ GG Sbjct: 355 GSGFGWSGGAGGGFGTGGGSGFGGGLGGGGGIGGGLGVGGG 395 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG GG G G G G G+ GG Sbjct: 245 GGGMGGGASGGIGGGAGGGMGGDIGGGAGGGVGGGGGGGMGGG 287 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G G GG GG G GGG G G GG Sbjct: 57 GGVGVGGGEGGGVGVGGGVGG--GTGGGAAGGLGGGGG 92 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG GG G G GGG G G G Sbjct: 225 GGGAGGGFGAGGGVGGGIGVGGGMGGGASGGIGGGAG 261 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG GG G G Sbjct: 56 GGGVGVGGGEGGGVGVGGGVGGGTGGGAAGGLGGGG 91 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG GG G G GG GGAG Sbjct: 226 GGAGGGFGAGGGVGGGIGVGGGMGGGASGGIGGGAG 261 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G G G G GG Sbjct: 225 GGGAGGGFGAGGGVGGGIGVGGGMGGGASGGIGG-GAGGG 263 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXG--GXXGXGGGXXXGRGI 795 G GG G GGG GG G G G G GGG G G+ Sbjct: 417 GAGGGLGVGGGGGAGGGIGASRGARGGSGAGGGAGMGGGV 456 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 906 GXXGGG---XXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG G GG G G GGG GG G Sbjct: 89 GGGGGGGGLGGSGGLGGGGMGGSGGFGGGGGGGVGGGVG 127 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G G G G GGG G G G Sbjct: 135 GVGAGGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGG 174 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG GG G GGG RG GG Sbjct: 405 GAGMGGGISSGAGAGGGLGVGGGGGAGGGIGASRGARGG 443 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G G G G G G G G Sbjct: 320 GGIGGGASGGFGGGAGIGEGVGNGFGVGAGAGTGLG 355 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGG-GXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG G GG GG G G GGG GG G G Sbjct: 259 GAGGGMGGDIGGGAGGGVGGGGGGGMGGGGGFGGGGGVGG 298 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXX-GGXXGXGGGXXXGRGIXG 789 G GGG GGG G G GG GG G GGG G G Sbjct: 423 GVGGGGGAGGGIGASRGARGGSGAGGGAGMGGGVGARAGGGG 464 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G G G G G GGG GG G G Sbjct: 161 GGGGGIGAGGGFGGGAGAGGGVGGGGRFGGGGMGGGGGFG 200 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G G G GG Sbjct: 282 GGMGGG--GGFGGGGGVGGNTGRDFDGGKGNGLNGGDGASGG 321 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG G G G G GG GG G G G+ GG Sbjct: 415 GAGAGGGLGVGGGGGAGGGIGASRGARGGSGAGGGAGMGGG 455 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G G G G G GGAG G Sbjct: 419 GGGLGVGGGGGAGGGIGASRGARGGSGAGGGAGMGG 454 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAGDXG 790 G GGG GG GG G G G GG GG G Sbjct: 216 GGMGGGSGFGGGAGGGFGAGGGVGGGIGVGGGMGGGASGG 255 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG GAG G Sbjct: 384 GGIGGGLGVGGGTGGGSGANEGAGM--GGGISSGAGAGG 420 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G G GG GAG G Sbjct: 115 GGGGGGGVGGGVGAGFGSGGGVGAGGGLRGGGGVGAGGGG 154 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 8/42 (19%) Frame = -2 Query: 896 GGGXXGG-----GXGXGG---XGGXXGGXXGXGGGXXXGRGI 795 GGG GG G G GG G GG G GGG G GI Sbjct: 393 GGGTGGGSGANEGAGMGGGISSGAGAGGGLGVGGGGGAGGGI 434 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG---XGGGXXXG 804 G GG GGG G GG G G G GGG G Sbjct: 439 GARGGSGAGGGAGMGGGVGARAGGGGEHKRGGGKHHG 475 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GG GG G G Sbjct: 58 GVGVGGGEGGGVGVGG-GVGGGTGGGAAGGLGGGGGGGG 95 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G GG G G G G GG G G Sbjct: 120 GGVGGGVGAGFGSGGGVGAGGGLRGGGGVGAGGGGGFGG 158 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G G G G GGG GG G G Sbjct: 164 GGIGAGGGFGG-GAGAGGGVGGGGRFGGGGMGGGGGFGG 201 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGG G GG GGG G Sbjct: 163 GGGIGAGGGFGGGAGAGGGVGGGGRFGGGGMGGGGGFGG 201 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G G G G G G GG Sbjct: 324 GGASGG-FGGGAGIGEGVGNGFGVGAGAGTGLGSGFGWSGG 363 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGX---GXXXGXXXXXGGGXXGGAG 799 G GG GG G GG G G GGG GG+G Sbjct: 363 GAGGGFGTGGGSGFGGGLGGGGGIGGGLGVGGGTGGGSG 401 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP PP PP PPP PPP P Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXPPPXXPPP 897 PP PPP P PP PP PP P PPP PPP Sbjct: 96 PPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+ PPP P PP P PPP PPP P Sbjct: 82 PPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAP 121 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP P P PPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP PP P PP PPP PPP P Sbjct: 32 PPQQPAYGHMPPPQGAPPPFLAPPPP---PPPGPPPPHQP 68 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P Y P PP P PPPP PP PPPP Sbjct: 86 PQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPP 124 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 P +P PPP PP PP P PPP PPP P Sbjct: 86 PQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPP 126 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP PP PP PP P P P P Sbjct: 41 MPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPP 77 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP P P PP PP P Sbjct: 48 PPPFLAPPPPPPPGPP-PPHQPQFNFGPGPPQQQQPPPPP 86 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P P P PPP PP PP P PPP P Sbjct: 6 PYAPHP---PPPQGGFPPQPPPMNPYGPPPPQQP 36 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P PP PPP PP P Sbjct: 19 PPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPP 58 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 109 PPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXX---PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPP Sbjct: 92 PPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPPP 133 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP PP P PPP S PPPP Sbjct: 76 PPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPP 109 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P PPP P P P Sbjct: 27 PYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PP PP PP PPP Sbjct: 76 PPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPP 112 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPP PPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 PP P PP P P PP P P PPP PP Sbjct: 11 PP--PPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPP 49 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-----PPXXPPXPPXP---XPPPXXPPP 897 PP P P PP P PP PP P PP PPP Sbjct: 54 PPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPP 98 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 P P P PP P PP P PP P P PPP Sbjct: 9 PHPPPPQGGFPPQP--PPMNPYGPPPPQQPAYGHMPPP 44 >06_01_0178 + 1386981-1387505 Length = 174 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G G GG Sbjct: 34 GASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGG 74 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GG G G GG Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGG 76 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/42 (52%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G G GGG G+G GG Sbjct: 43 GGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGG 84 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR-GIXGG 786 G GGG GG G GG GG G G GGG GR G GG Sbjct: 47 GGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGG 87 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G GG GG GG G GGG G+G GG Sbjct: 27 GGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGG 62 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G G G GGG G GG G GG G GG G GRG GG Sbjct: 84 GAGGHGGAGGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGG 124 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGR-GIXGG 786 G GGG GGG G GG GG G G GGG GR G GG Sbjct: 68 GAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGG 109 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G G G GG Sbjct: 30 GGRGGASGGGGGGGGGGGGGGGGGAG-GKGGKGGAGGHGG 68 Score = 39.1 bits (87), Expect = 0.005 Identities = 23/46 (50%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGG-----XGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G GRG GG Sbjct: 67 GGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDGG 112 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G GG G GG Sbjct: 33 GGASGGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGG 72 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG G G GG G G GG Sbjct: 59 GKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGG 98 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG G GG G GG G GG G G G Sbjct: 62 GAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGG 100 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG G G G GRG GG Sbjct: 97 GGGGKGRKGGRGGDGGSGGAGGRGGDGGSGGQGGRGGDGG 136 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GGGG GG GGGG G GG GGG G R Sbjct: 38 GGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGR 81 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GG G GG Sbjct: 58 GGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGG 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG G G G G G GG Sbjct: 92 GGGGGGGGGKGRKGGRGGDGGSGGAGGRGGDGGSGG 127 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG GG G G GGG G G G Sbjct: 24 GGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGG 62 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G G GG G GG GG GG G GGG Sbjct: 109 GDGGSGGAGGRGGDGGSGGQ-GGRGGDGGG 137 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G RG G GG G G GGG GG G G Sbjct: 13 GEPGQPGGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGG 51 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GG GG GGGG G GG GGG G R Sbjct: 61 GGAGGHGGAGGGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGR 103 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGG-XGXGGXGXXXGXXXXXGG-GXXGGAGDXG 790 G GG +GG G GG G G GG G GGAG G Sbjct: 49 GGGGGAGGKGGKGGAGGHGGAGGGGGGGGGKGRKGGAGGHG 89 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G G G GG+G G Sbjct: 80 GRKGGAGGHGGAG-GGGGGGGGKGRKGGRGGDGGSGGAG 117 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G RGG G G G GGG GG G G+ G Sbjct: 22 GRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAGGKGGKGGAG 64 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -3 Query: 895 GGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG GG GG G G GG GGG AG Sbjct: 19 GGRGRGGRGGRGGRGGASGGGGGGGGGGGGGGGGGAG 55 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRG-GXGXGGXGXXXGXXXXXGG-GXXGGAGDXG 790 G GGG +G G GG G G GG G GG G G Sbjct: 71 GGGGGGGGKGRKGGAGGHGGAGGGGGGGGGKGRKGGRGGDG 111 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/45 (46%), Positives = 22/45 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GGG GG G GG G GG G GGG G G GG V + Sbjct: 154 GGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGGDGVAR 198 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G GGG G G GG Sbjct: 153 GGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGG 192 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G G GGG G G GG Sbjct: 148 GGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGG 188 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G G GGG G G GG Sbjct: 150 GGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGG 189 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GGG G GG G GG G G GG G G GG Sbjct: 144 GRLGGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGG 185 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GGG G G GG Sbjct: 147 GGGGGGGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGG 186 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG GG G G G G GGG GG R G Sbjct: 159 GDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGGDGVARDDDAPKG 205 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GG G G GG GGG G Sbjct: 152 GGGGGGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGG 190 >12_02_1174 - 26696869-26698191 Length = 440 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PPP P PP PP PP PP P P P Sbjct: 142 PPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPP 182 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP PP PP PP P PP PP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPX-PPXPXPPPXXPPPXXP 906 PP +P P PPP P P PP P P PPP PP P Sbjct: 149 PPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPP 191 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PR P P PP P PP PPP PPP P Sbjct: 125 PPPPPRTRTRVEP-PHRPPPVKPQPPPSLPPPPPPPPPPP 163 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPPXXP 906 PP +P P PPP P PP P P P P P PPP P Sbjct: 213 PPTLP-PPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAP 254 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPP 897 PP PRP PP P PP PP P PPP PP Sbjct: 161 PPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPP 199 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPPP PPS PP Sbjct: 137 PPHRPPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPP 173 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPPP Sbjct: 187 PPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPP 225 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP R PP P P PP P P PPP PPP P Sbjct: 127 PPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPRP 167 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 PP RP PP P PP PP P PPP PP P Sbjct: 192 PPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVPPRTP 233 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P P PPP PPP P Sbjct: 116 PPALSPVPPPPPPPRTRTRVEPPHRPP-PVKPQPPPSLPPPPPP 158 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPXP-PXPXPPPXXPPPXXP 906 PP P P PPP P PP P P P P P PPP P Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX-PPSXXPPPP 902 P PPP PP P PPP PPS PPPP Sbjct: 156 PPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX----PPXPXP--PPXXPPPXXP 906 PP +P PPP P PP P P P P PP PPP P Sbjct: 181 PPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP P P PP P Sbjct: 177 PKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPP 218 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 PP + P P P P P PP PP PP PP P Sbjct: 167 PPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQP 208 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 PP + P+P P P PP PP PP PP P P P Sbjct: 172 PPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPP 213 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPX---PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P P P P P PPP P Sbjct: 187 PPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPPTVP 229 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 P + P PPP P P P P P PPP P P P Sbjct: 237 PAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPP 277 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 PA P P PP P PP P PPS PPPP Sbjct: 117 PALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPP 157 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/50 (30%), Positives = 17/50 (34%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P V P+ PP PP P P P PP+ PP P Sbjct: 172 PPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSP 221 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PPP P PP P PP P P P Sbjct: 284 TAVTPPEPTKPKPPPPSPPPPPQQPSQRYWTPPPAITPEPAKP 326 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP P PPPP Sbjct: 242 PKPQPPPPPPRAPVKMPRVLEPKPSPPPPSP---LPPPP 277 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P P PPP PP P Sbjct: 268 PPPSPLP---PPPEDYWSPTAVTPPEPTKPKPPPPS-PPPPP 305 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P P PPS PP P Sbjct: 153 PPPPPPPPPP-PPPRPPSVKPPVVQPKPQPPPSLQPPSP 190 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PP P P PP P Sbjct: 263 PKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSP 301 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 4/35 (11%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPP 897 P PP P P PP PP P P PPP Sbjct: 283 PTAVTPPEPTKPKPPPPSPPPPPQQPSQRYWTPPP 317 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS--XXPPPP 902 P Y P PP P PPPP PS PPP Sbjct: 277 PEDYWSPTAVTPPEPTKPKPPPPSPPPPPQQPSQRYWTPPP 317 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP-XPPSXXPP 896 P PP P P PPPP PPS PP Sbjct: 167 PPSVKPPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPP 204 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA P PP P P P PP P PP Sbjct: 237 PAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPP 275 >10_08_0880 + 21267034-21267537 Length = 167 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG GG GG G GGG G G GG Sbjct: 34 GGGGHGHYGGGGSSGGGGGYGGGSGGYGGGGSSGGGYGGG 73 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G GG GGG G G Sbjct: 43 GGGSSGGGGGYGGGSGGYGGGGSSGGGYGGGGG 75 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GG G GG G GG G GG G Sbjct: 50 GGGYGGGSGGYGGGGSSGGGYGGGGGSSTSG 80 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G GG GG G GGG Sbjct: 45 GSSGGGGGYGGGSGGYGGGGSSGGGYGGGGG 75 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG G G GG GG G GG G G G GG Sbjct: 31 GSGGGGGHGHYGGGGSSGGGGGYGGGSGGYGGGGSSGG 68 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG G GG G GG G GG Sbjct: 33 GGGGGHGHYGGGGSSGGGGGYGGGSGGYGGGGSSGGG 69 >06_02_0175 - 12624608-12625297 Length = 229 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G Sbjct: 97 GSSGGGGGGGGGGGGGGGGGGGGGGGGGGGRRCWWGCGNG 136 Score = 42.3 bits (95), Expect = 5e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG G GG GG GG G GGG G Sbjct: 95 GGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 GG GGG G GG GG GG G GGG GR Sbjct: 96 GGSSGGGGGGGGGGGGGGGGGGGGGGGGGGGR 127 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG GG GG G GGG G G Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G GG GG GG G GGG Sbjct: 96 GGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG GG G GGG G G GG Sbjct: 86 GWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG G GGG G G GG Sbjct: 90 GTDSGGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GGG G GG GG GG G GR Sbjct: 103 GGGGGGGGGGGGGGGGGGGGGGGGRRCWWGCGNGR 137 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG---XXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G G G +G Sbjct: 104 GGGGGGGGGGGGGGGGGGGGGGGRRCWWGCGNGRRRHKG 142 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 10/50 (20%) Frame = -2 Query: 905 GXXGGGXXGG-----GXGXG-----GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG GG G GGG G G GG Sbjct: 69 GGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGGGGGGGGGGGGGG 118 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGG 800 GGG GG GGGG G GG GG Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G G GG G Sbjct: 109 GGGGGGGGGGGGGGGGGGRRCWWGCGNGRRRHKGGKEGG 147 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG----XGGGXXXGRGIXGG 786 GGG GGG GG G G GGG G G GG Sbjct: 66 GGGGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGGGGGG 106 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/37 (51%), Positives = 20/37 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GGG GGG G GG GG GG G GG G G+ Sbjct: 11 GRGGGGGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGM 47 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GGG G GG GG GG GGG GR Sbjct: 15 GGGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGMGR 49 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXS 778 GGG GG G GG G GGG GG GR S Sbjct: 13 GGGGGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGMGRRGS 52 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G RG G GG G G GGG G GD G S G Sbjct: 2 GKKGKGRHRGRGGGGGGGGGGGG----GGGGGGVGGDRGGGGSGGGG 44 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PRP P PP PP P P PPP PPP P Sbjct: 70 PPPPPRPPSFAPENAL-PPSSPPPPSPPPPPPSSPPPVPP 108 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP 861 PP P P PPP P PP PP P Sbjct: 86 PPSSPPPPSPPPPPPSSPPPVPPSP 110 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP-PXPPSXXPPPP 902 P PPP P P PPP P PP PPP Sbjct: 66 PGSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPP 105 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PP P P PP PP P P PP P Sbjct: 76 PPSFAPENALPPSSPPPPSPPPPPPSSPPPVPPSPTAAP 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P P P PPPP P S P PP Sbjct: 70 PPPPPRPPSFAPENALPPSSPPPPSPPPPPPSSPPPVPP 108 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPP 897 T P +P PPP P PP PP PP P PPP PPP Sbjct: 336 TSPSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PPP P P PP P PPP P Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP P P PP P PPP P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 + P P PP PP PP P PPP PP Sbjct: 335 VTSPSPRPVQPSNAPPPPPPPPPPPPPPP--PP 365 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPP 894 PP P P P P PP PP P P P PP Sbjct: 359 PPPPPPPKLNTAPKPPPPPPPPPSVPSNNNLPKPAEPP 396 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P V P PPP PP P PPPP PPS Sbjct: 340 PRPVQPSNAPPPPPPPPPPPP-PPPPPKLNTAPKPPPPPPPPPS 382 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P PPP PP P PPPP PS Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVPS 385 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP---PPXXP 906 PP P+P PP P P PP PP PPP P PP P Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PP P PPP P PP PP P P PPP P P P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PPP P P PP P P PPP PP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPX---PXPPPXXPPPXXP 906 P P PPP P PP PP P PPP PPP P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP P PPP P P Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPP 365 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 P P PPP PP P PP P P PP PPP P Sbjct: 321 PAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGP 362 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP------XXPPPXXP 906 PP P+ PPP PP PP P P PPP PPP P Sbjct: 337 PPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPPP 382 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 + P PPP P PP PP P P PPP P Sbjct: 308 VASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGP 344 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP P P PPP P Sbjct: 330 PPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P + PA PPP P PPPP P PPPP Sbjct: 300 PQSIAAAAVASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPP Sbjct: 332 PKAAPPP----PPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P I P P PP P PP P PP PPP P Sbjct: 300 PQSIAAAAVASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPP 341 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPP PP P PP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPP 365 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 P P P PP P PP PP PP PPP Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPP 355 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P+ PPP P P PP P PP Sbjct: 355 PPPPPKGPSPPPPPPPGGKKGGPPPPPPKGGASRPP 390 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXP--PSXXPPPP 902 A PPP PP P PPPP P PPPP Sbjct: 323 AAAPPPP---PPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP PPP Sbjct: 341 PKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPP 379 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP PPPP Sbjct: 344 PPPPPPAKGPPPPPPPKGPSPP--PPPPPGGKKGGPPPP 380 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 PP P PPP P PP P P PP PP P Sbjct: 354 PPPPPPKGPSPPPPP--PPGGKKGGPPPPPPKGGASRPPAAP 393 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 43.2 bits (97), Expect = 3e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P PP PP P PPP PPP Sbjct: 22 PPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVPPP 58 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 6/36 (16%) Frame = +1 Query: 817 PPPXPXXP-PXXPPXP-----PXPXPPPXXPPPXXP 906 PPP P P PP P P PPP PPP P Sbjct: 21 PPPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVP 56 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P PP PP P PPP P Sbjct: 10 PEWLNSPLWSAPPPSSSSP-SPPVPPDPYGADLSPPPPPP 48 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P P PP P PPP PP+ PP Sbjct: 22 PPSSSSPSPPVPPDPYGADLSPPPPPPPKPPPTVPPP 58 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRGIXGG 786 GG GGG G GG GG GG G GGG GRG GG Sbjct: 97 GGGYGGGYGGGGGGGGYGGYGGYGGGGYEGYGRGYGGG 134 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 70 GGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGG 109 Score = 38.3 bits (85), Expect = 0.008 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG GG G GGG G G GG Sbjct: 82 GGGNGGGYGGGYGGYGGGYGGGYG-GGGGGGGYGGYGG 118 Score = 36.3 bits (80), Expect = 0.033 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXG--XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 82 GGGNGGGYGGGYGGYGGGYGGGYGG--GGGGGGYGGYGGYGG 121 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG--------GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G GG G GGG G G GG Sbjct: 106 GGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGGGGYGGGGYPGGGYYGG 153 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G G GGG G G GG Sbjct: 105 GGGGGGGGYGGYGGYGGGGYEGYGRGYGGGGGGG-GYGGG 143 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 906 GXXGGGXXRG---GXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G GG G G GGG GG G G Sbjct: 117 GGYGGGGYEGYGRGYGGGGGGGGYGGGGYPGGGYYGGGGGGG 158 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG G GG G GGG Sbjct: 130 GYGGGGGGGGYGGGGYPGGGYYGGGGG 156 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G G GG G G GGG G G G Sbjct: 74 GGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGG 112 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G G GG G G Sbjct: 102 GGYGGGG--GGGGYGGYGGYGGGGYEGYGRGYGGGGGGG 138 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPR--PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P P PP PPP PPP P Sbjct: 71 PPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSP 112 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PPP PP PP PP PPP PPP P Sbjct: 82 PPPPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALP 122 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PPP P PP P P PP PPP Sbjct: 92 PPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP P P PP PP P Sbjct: 87 PKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTP 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPR--PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P P P PP PP P PPP PPP P Sbjct: 60 TPTPPVAPAKAPPVAPAVAPVTPP--PPTPKKAPPPPVTPPPVTP 102 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP P PP P PPP P P Sbjct: 97 PPPVTPPPVTPPPVSPPPATPPPALPPSTPPPVAAPAEAP 136 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP--PP 902 P PPP PP P PPP PP PP PP Sbjct: 87 PKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPP 127 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP PP PP P P P P P Sbjct: 102 PPPVTPPPVSPPP-ATPPPALPPSTPPPVAAPAEAPAALP 140 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PP PP P PPP PPS PP Sbjct: 92 PPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPX------PPXPXPPPXXPPP 897 PP P P PP P P PP PP P PP PPP Sbjct: 103 PPVTPPPVSPPPATPPPALPPSTPPPVAAPAEAPAALPPATTPPP 147 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T P P P P P P P P P P PPP Sbjct: 54 TPAPTATPTPPVAPAKAPPVAPAVAPVTPPPPTPKKAPPP 93 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P PP P Sbjct: 38 PTPVPTAPAKSPPAPATPAPTATPTPPVAP 67 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P PP P Sbjct: 122 PPSTPPPVAAPAEAPAALPPATTPPPVAEAPAELPPAEAP 161 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PA PP P PPP PP PPP Sbjct: 67 PAKAPPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPP 104 >06_02_0120 + 12055076-12055175,12055322-12055725 Length = 167 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G GG Sbjct: 122 GYGGGSGYGGGYG-GGYGGGYGGGSGYGGGGGYGGGSGGG 160 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG GG G G G G G GG Sbjct: 116 GGYGSPGYGGGSGYGGGYGGGYGGGYGGGSGYGGGGGYGGG 156 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG G G GGG G G GG Sbjct: 98 GGGSGPGYGGGYGSPGYGGGYGSP-GYGGGSGYGGGYGGG 136 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GG G G GG G G GGG G Sbjct: 131 GGYGGGYGGGYGGGSGYGGGGGYGGGSGGGGQHG 164 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG G G GGG G G G Sbjct: 107 GGYGSPGYGGGYGSPGYGGGSGYGGGYGGGYGGGYGGGSG 146 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG G G GG G G GGG GG+G G Sbjct: 115 GGGYGSPGYG-GGSGYGGGYGGGYGGGYGGGSGYGG 149 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G G GG G GGG G G Sbjct: 106 GGGYGSPGYGGGYGSPGYGGGSGYGGGYGGGYG 138 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG--GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G GGG GRG GG Sbjct: 101 GGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGG 142 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G GG Sbjct: 99 GGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGG 135 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G GG Sbjct: 90 GGGGGGYGGGGGGYGGGRGGGGYGGGGGGGYGRREGGYGG 129 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG GG GG G GGG RG Sbjct: 114 GGGGGGYGRREGGYGGGGGYGGGRGGGGGGYGGSRG 149 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG G G GG G Sbjct: 126 GYGGGGGYGGGRG-GGGGGYGGSRGGGYGGDSGG 158 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG G GGG G GG Sbjct: 113 GGGGGGGYGRREGGYGGGGGYGGGRG-GGGGGYGGSRGGG 151 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G G GGG G Sbjct: 98 GGGGGYGGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGG 136 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 105 GGRGGGGY-GGGGGGGYGRREG-GYGGGGGYGGGRGGGG 141 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G RGG G GG G G GG GG G G Sbjct: 99 GGGGYGGGRGGGGYGGGGG--GGYGRREGGYGGGGGYGG 135 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXG 804 GG GGG G GG GG GG G G G G Sbjct: 125 GGYGGGGGYGGGRGGGGGGYGGSRGGGYGGDSG 157 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G G GG GG G GGG G G+ G Sbjct: 278 GGGGGGKGGGGGGGGNTGGGIGGSTG-GGGRGAGAGVGG 315 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG GG GG G GGG G G G Sbjct: 300 GSTGGGGRGAGAGVGGITGGGDGGFPGGGGGGFSGGGGGG 339 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G GG GG G GGG G G G Sbjct: 310 GAGVGGITGGGDG-GFPGGGGGGFSGGGGGGFPGGGCGG 347 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG GG G G GG GG G GG G+ GG V Sbjct: 328 GGGGFSGGGGGGFPGGGCGGITGGDGGGVV--GVDGGGVV 365 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G GGG G G+ G Sbjct: 218 GGGGGGFTGGRGGGLTGGGGEGNTGGGGGGGGNCGLGLGFG 258 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG G GGG G G G Sbjct: 86 GGGNTGGGGGEVTGGGGGGVAEGTGIGGGGGGGDGGNG 123 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G G GG G G Sbjct: 287 GGGGGGNTGGGIGGSTGGGGRGAGAGVGGITGGGDG 322 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G GG GG GG G G G G G G Sbjct: 101 GGGGVAEGTGIGGGGG--GGDGGNGAGVGCGVGCVG 134 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG GG G GG G GG G G G Sbjct: 219 GGGGGFTGGRGGGLTGGGGEGNTGGGGGGGGNCGLGLGFGEG 260 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG G G G G G G GI GG Sbjct: 281 GGGKGGGGGGGGNTGGGIGGSTGGGGRGAGAGVG-GITGG 319 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G GG GG GG G GGG G GI G Sbjct: 264 GVGAGPGAGTGAITGGGGGGKGG--GGGGGGNTGGGIGG 300 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG G GG G GG Sbjct: 358 GVDGGGVVGDDWGGFAEGGGCGGRSGGAGGDWGGFAEGGG 397 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 GGG GGG G G G G GG G G G+ GG Sbjct: 182 GGGGDGGGGGEFWTSGGGGLAIGGGGDGVGLGLGLDGG 219 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG-IXGG 786 G GGG GGG G G G G G G G G I GG Sbjct: 239 GNTGGGGGGGGNCGLGLGFGEGTGFGVGAGPGAGTGAITGG 279 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG--GXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G G G G GG G G G G G G Sbjct: 291 GGNTGGGIGGSTGGGGRGAGAGVGGITGGGDGGFPGGGGGG 331 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GGGG G GG G G G Sbjct: 91 GGGGGEVTGGGGGGVAEGTGIGGGGGGGDGGNGAGVGCG 129 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G G G G G GGG GRG Sbjct: 197 GGGGLAIGGGGDGVGLGLGLDGGGGGGFTGGRG 229 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G G G GD G Sbjct: 285 GGGGGGGGNTGGGIGGSTGGGGRGAGAGVGGITGGGDGG 323 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG G G GG GG GGG G GG V Sbjct: 315 GITGGGDGGFPGGGGGGFSGGGGGGFPGGGCGGITGGDGGGVV 357 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG G GGG G GG Sbjct: 258 GEGTGFGVGAGPGAGTGAITGGGGGGKGGGGGGGGNTGGG 297 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P PP PP P PP PPP Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPP 299 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P PPP P P PP P P PPP P Sbjct: 269 PPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPP 310 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP PP P PP P P PP P Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPP 297 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXP---PPXXP 906 P +P PP P PP PP PP P PPP P PP P Sbjct: 254 PGTLPNGSGGPPRPP--PPQVPPPPPQAPPPPPPNAPMGMPPRIP 296 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPR---PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP P PP PPP Sbjct: 284 PPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPP 323 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 P +P P P P PP P PPP PPP P Sbjct: 245 PEANKPPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPPP 285 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP PP P PP PP Sbjct: 281 PPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPP 317 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP P PP PPP P Sbjct: 250 PPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPP-PPPPNAP 288 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P PP P P PP P Sbjct: 282 PPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIP 321 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PP PPPP Sbjct: 245 PEANKPPAAPGTLPNGSGGPPRPPPPQVPPPPP 277 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PP P P PP PP PPPP Sbjct: 247 ANKPPAAPGTLPNGSGGPPRPPPPQVPPPPPQAPPPPP 284 >12_01_0841 - 7873458-7874225 Length = 255 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G GG GG G GGG G G GG Sbjct: 45 GEGGGGGSGYGEGYGQGGGASGGGYGQGGGGGGGGGQGGG 84 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G GG Sbjct: 61 GGGASGGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGG 98 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 80 GQGGGSGSGYGSGYGQGGGASGGGYGKGGGGGGGGGQGGG 119 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G G Sbjct: 96 GGGASGGGYGKGG-GGGGGGGQGGGAGSGYGSGYGSG 131 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G G Sbjct: 174 GGGASGGGYGQGG-GGGGGGGQGGGNGSGYGSGYGSG 209 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G G G G G GG Sbjct: 213 GGGVHAGGYGQGGGGGGGGGQGGGSGSGSGYGSGYGGG 250 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G G G G G GG Sbjct: 63 GASGGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGGASGG 102 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 31 GGGGGGGEGGG-GGGGEGG--GGGSGYGEGYGQGGGASGG 67 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G G G GRG GG Sbjct: 102 GGYGKGGGGGGGGGQGGGAGSGYGSGYGSGYGQGRGASGG 141 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G G G G G GG Sbjct: 137 GASGGGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGG 176 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G G G G G GG Sbjct: 176 GASGGGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGG 215 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG GG G G G G G G Sbjct: 135 GRGASGGGYGQGGGGGG-GGGQGGGNGSGYGSGYGSG 170 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G GG Sbjct: 70 GQGGGGGGGGGQG-GGSGSGYGSGYGQGGGASGGGYGKGG 108 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG G G G G G G Sbjct: 220 GYGQGGGGGGGGGQGGGSGSGSGYGSGYGGGAG 252 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GGG G G GG G G G GG G G G Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSGYGEGYGQGGGASGGGYGQG 72 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G G G G G GG Sbjct: 141 GGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGGASGG 180 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G G GG Sbjct: 148 GGGGGGGQGGGNGSGYGSGYGSGYGQGGGASGGGYGQGGG 187 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G GG G G GG Sbjct: 35 GGGEGGGGGGGEGGGGGSGYGEGYGQGGGASGGGYGQGGG 74 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G GG G G G G GGA G Sbjct: 33 GGGGGEGGGGGGGEGGGGGSGYGEGYGQGGGASGGG 68 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G G G G G+ G Sbjct: 180 GGYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGGVHAG 219 Score = 33.5 bits (73), Expect = 0.24 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 10/50 (20%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---------GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GG G GGG G G GG Sbjct: 109 GGGGGGGQGGGAGSGYGSGYGSGYGQGRGASGGGYGQGGGGGGGGGQGGG 158 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GGG G GG Sbjct: 187 GGGGGGGQGGGNG-SGYGSGYGSGYGQGGGVHAGGYGQGG 225 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GGG G GG Sbjct: 147 GGGGGGGGQGGGNGSGYGSGYGSGYGQGGGASGGGYGQGG 186 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGG------GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 152 GGGQGGGNGSGYGSGYGSGYGQGGGASGGGYGQGGGGGGGGGQGGG 197 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G GG G GGG G G Sbjct: 125 GSGYGSGYGQGRGASGGGYGQGGGGGGGGGQGGGNG 160 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G GG G GGG G G Sbjct: 164 GSGYGSGYGQGGGASGGGYGQGGGGGGGGGQGGGNG 199 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G G G GGA G Sbjct: 144 GQGGGGGGGGGQG-GGNGSGYGSGYGSGYGQGGGASGGG 181 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG G G GGG G+G G Sbjct: 160 GSGYGSGYGSGYGQGGGASGGGYGQGGGGGGGGGQGGGNG 199 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G +GG G G G G GGG GGAG Sbjct: 90 GSGYGQGG-GASGGGYGKGGGGGGGGGQGGGAG 121 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G G G G G G GG Sbjct: 224 GGGGGGGGGQGGGSGSGSGYGSGYGGGAGG 253 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +GG GGGG G G GG G Sbjct: 66 GGGYGQGGGGGGGGGQGGGSGSGYGSGYGQGGGASGGG 103 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG G EG GGG G GG GGG +G Sbjct: 50 GGSGYGEGYGQGGGASGGGYGQGGGGGGGGGQGGGSGSG 88 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGG------GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG G G GGG G G GG Sbjct: 191 GGGQGGGNGSGYGSGYGSGYGQGGGVHAGGYGQGGGGGGGGGQGGG 236 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG G G G G G GG G Sbjct: 108 GGGGGGGGQGGGAGSGYGSGYGSGYGQGRGASGGGYGQG 146 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGG--AGDXGRXXSXXXG 766 G GGG GG G GG G G G G GG AG G+ G Sbjct: 183 GQGGGGGGGGGQG-GGNGSGYGSGYGSGYGQGGGVHAGGYGQGGGGGGG 230 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG 808 G GGG GG G GG G G GGG G Sbjct: 222 GQGGGGGGGGGQG-GGSGSGSGYGSGYGGGAGG 253 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG +GG G G G GG G G G Sbjct: 188 GGGGGGQGGGNGSGYGSGYGSGYGQGGGVHAGGYGQGGG 226 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG G G GGG G+G G Sbjct: 199 GSGYGSGYGSGYGQGGGVHAGGYGQGGGGGGGGGQGGGSG 238 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P PPP P PP P P PPP PPP P Sbjct: 609 PPILPNRSVPPPPPP--PPPLPNHSVLPPPPPPPPPPSLP 646 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P PPP PPP P Sbjct: 589 PPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLP 628 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PPP P PP PP P PPP P Sbjct: 544 PP--PPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP P PPP PPP P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 796 IPRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP PP PP P PPP P Sbjct: 617 VPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAP 656 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX----PXPPPXXPPPXXP 906 PP +P PPP P PP PP P PPP PPP P Sbjct: 553 PPSGNKPAFSPPPPPPPPPP-PPLPQSNYASSQPPPPPPPPPLP 595 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXP----PXPPXPXPPPXXPPPXXP 906 P P PP P PP P P P PPP PPP P Sbjct: 537 PSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP-PSXXPPPP 902 PPP PP P PPPP P S PPPP Sbjct: 602 PPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPP 637 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXPXPP-----PXXPPPXXP 906 PP +P PPP P PP P PP P P P PPP P Sbjct: 624 PPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 11/51 (21%) Frame = +1 Query: 787 PPXIPRPXXX---PPPXPXXPPXX----PPXPPXPXPPPXXP----PPXXP 906 PP +P+ PPP P PP P PP P PPP P PP P Sbjct: 572 PPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPP 622 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXX------PPXXPPXPPXPX--PPPXXPPPXXP 906 P P P PPP P PP PP PP P P PPP P Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPP 609 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP----PSXXPPPP 902 P PPP P P PPPP P PS PPPP Sbjct: 565 PPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP +P PPP P P PP P PP Sbjct: 642 PPSLPNRLVPPPPAPGIGNKFPAPPPPPPPP 672 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPPXXP 906 PP P P P P PP PP P P P PPP P Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 7/42 (16%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX-------PPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPP 626 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 546 PPPPPPPPPSGNKPAFSP---PPPPPPP---PPPP 574 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P P P PPP PPP Sbjct: 690 PPPPPPPLPPANRTNGPGVPSAPPPPPPPPP 720 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P P PP P PP PPP PP Sbjct: 750 PPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPP--PP 783 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P PP P P PP P PPP Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPP 719 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP----PPXXPPPXXP 906 P P P P PP PP P P P PPP P Sbjct: 529 PSDRKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIP-----RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P R PPP P P PP P P PP P Sbjct: 735 PPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVP 779 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 PP PP PPP P PP PPPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPP 782 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +1 Query: 790 PXIPR-PXXXPPPXPXXPPXXPPXPPXPXPPP 882 P +P P PPP P P P P PPP Sbjct: 706 PGVPSAPPPPPPPPPANRSNGPSAPAPPLPPP 737 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 A PPP PP PPPP PP PPP Sbjct: 541 AAAPPPPPPPPPPPSGNKPAFSPPPPPPPPP---PPP 574 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PA PPP PP PPP PP PPP Sbjct: 559 PAFSPPPPPPPPPPPPLPQSNYASSQPPPPPP---PPP 593 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP-------XPPPXXPPPXXP 906 P P P PP PP PP P P P PPP P Sbjct: 727 PSAPAPPLPPPLPAAANKRNPPAPPPPPLMTGKKAPAPPPPPPQAP 772 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS---XXPPPP 902 P PPP P P PPPP P+ PPPP Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPP 605 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP R P P PP P PP PPP Sbjct: 718 PPPANRSNGPSAPAPPLPPPLPAAANKRNPPAPPPPP 754 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P P P P PP PPP Sbjct: 709 PSAPPPPPPPPPANRSNGPSAPAPP--LPPP 737 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP PP P P PPP Sbjct: 747 PPAPPPPPLMTGKKAPAPPPPPPQAPKPPGTVPPPPP 783 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP PP P P P P Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAP 730 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 41.9 bits (94), Expect = 7e-04 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P PP P PP PP P PPP PPP P Sbjct: 1922 KPKQPPPHAPPPPPPPPPVEGKPKPPPHAPPPPPP 1956 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P PP PPP PPP Sbjct: 1923 PKQPPPHAPPPPPPPPPVEGKPKPPPHAPPP--PPP 1956 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP P P PPP P P PP P P Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPPPHAPPPPPP 1956 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PP P P Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPPGYRQPMAWP 163 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/36 (52%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXX-PPXXPPXPPX--PXPPPXXPPP 897 PRP PPP P PP PP PP P PPP PP Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPP 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P PP P PP P PP PPP P Sbjct: 116 PPRPPPPPPPHPPEDP--PPHPPHPPDHPPPPPP 147 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP PP PPPP Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPPP-PPCRVPPPP 154 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P PP P P PPP PPP Sbjct: 294 PPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPP 330 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP +P P PP P P PP P P P PP P PPP P Sbjct: 237 PPFLPFPL---PPIPFLTPPSPPPPAFPFPLPPWPWAPPPAFP 276 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP P P P PPP P P Sbjct: 263 PLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFP 300 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 10/50 (20%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX----------PXPPPXXPPPXXP 906 PP P PPP P P P PP P PPP PPP P Sbjct: 281 PPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPP 330 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP--PXPXPP--PXXPPPXXP 906 P P P P P P PP PP P P P PP P PP P Sbjct: 308 PHFPPLPSFYPSPPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSP 351 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 T P P P PPP P P PP P P PPP P P P Sbjct: 221 TPRPWFPPIPFLTPPPPPFLPFPLPPIPFLTPPSPPPPAFPFPLPP 266 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXP-PXPPXP-XPPPXXPPPXXP 906 P PRP P P P PP P P PP P PP PPP P Sbjct: 218 PFCTPRPWFPPIPFLTPPPPPFLPFPLPPIPFLTPPSPPPPAFP 261 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PP P P PP PP P Sbjct: 252 PPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPP 290 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P PP P PP P P P PP PPP P Sbjct: 257 PPAFPFPL---PPWPWAPPPAFPFPHLPPIFSPPSPPPPPPP 295 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P +P P PP PPP PP PPPP Sbjct: 294 PPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPP 332 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP----XXPPXXPPXPPXPXPPP 882 P P P PPP P PP P PP P PPP Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPP 353 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP-PXPPXPX-PPPXXPPPXXP 906 P P P PP P PP P P PP P PPP P P P Sbjct: 243 PLPPIPFLTPPSPP--PPAFPFPLPPWPWAPPPAFPFPHLP 281 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P PP PP PP P P PP P Sbjct: 305 PPLPHFPPLPSFYPSPPPPPPPPPPPPPSFPWPFPPLAP 343 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPP 899 P+ YP P PP P PP P PP PPP Sbjct: 314 PSFYPSPPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSPPP 353 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP P P P P P P P Sbjct: 314 PSFYPSPPPPPPPPP-PPPPSFPWPFPPLAPLFPPYPSPP 352 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 19/58 (32%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP-------------------PXPPXPXPPPXXPPPXXP 906 P +P P P P PP P P PP P PPP PPP P Sbjct: 278 PHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPPPPPPSFP 335 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P P P PP P P PP P Sbjct: 248 PFLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSP 286 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PPP P P P P PS PPPP Sbjct: 287 PSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPP 325 >10_08_0553 - 18720436-18720494,18721102-18721106,18721136-18721257, 18721390-18721478,18722136-18722316,18722403-18722654, 18722755-18722993,18723680-18723914,18724072-18724132, 18724632-18724987 Length = 532 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG G GG G GGG G G Sbjct: 15 GGGGGGGGGGGGGRGNGGGGFGGGGGGGGGNHGYYG 50 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRG 798 G GGG GGG G G GG GG G GGG GRG Sbjct: 15 GGGGGGGGGGGGGRGNGGGGFGGGGGGGGGNHGYYGRG 52 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG GGG G GG G GG G GGG G Sbjct: 11 GYTSGGGGGGGGGGGGGRGNGGGGFGGGGGGGGG 44 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G G GG G GGG G G G Sbjct: 756 GSGGGGYGGGGGGYGGGGYGGGGGGGGYGGGSSYGGGGQG 795 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG GG G G GGG G GG Sbjct: 756 GSGGGGYGGGGGGYGGGGYGGGGGGGGYGGGSSYGGG 792 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG G GGG G G GG Sbjct: 741 GGGARFGGRDFRRDRGSGGGGYGGGGGGYGGGGYGGG 777 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GG G GG GG G GG Sbjct: 237 GGGGGGSVGGSRQGFGAGGRGGGGGGGGG 265 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG R G GG G G GGG GG G G Sbjct: 747 GGRDFRRDRGSGGGGYGGGGGGYGGGGYGGGGGGGG 782 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG G G G G GGG G Sbjct: 235 GGGGGGGGSVGGSRQGFGAGGRGGGGGGGGG 265 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GG G G GG G GGG R Sbjct: 236 GGGGGGGSVGGSRQGFGAGGRGGGGGGGGGAWNSR 270 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG G G G G G G G GG Sbjct: 226 GPRWAGIVNGG-GGGGGGSVGGSRQGFGAGGRGGGGGGGG 264 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -3 Query: 892 GXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 G GG GGGG G GG GGG Sbjct: 231 GIVNGGGGGGGGSVGGSRQGFGAGGRGGGGGG 262 >07_01_0479 + 3606663-3607448 Length = 261 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 PP +P P PP P P PP PP P PPP PP P Sbjct: 180 PPQMPIPFQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRP 222 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP PP P P P PP P Sbjct: 159 PPVAYPQVVRPPPGQMPPPMRPPQMPIPFQRPPGVPPAFP 198 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + RP P P P PP P P PP P P P Sbjct: 217 PPQV-RPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGPQQP 255 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP RP PPP P PP PP P P PP Sbjct: 228 PPPGMRPGMPPPPFR---PGMPPPPPGPQQPGQNPP 260 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 PPP PP P PP PP P PPPP Sbjct: 169 PPPGQMPPPMRPPQMPIPFQRPPGVPPAFPGGPPPPP 205 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP---PXXPPP 897 PP P P PP P PP P P PP P PPP Sbjct: 201 PPPPPGPFMRGPP-PMGPPQVRPGMPGGPPPGMRPGMPPP 239 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXP--PPXXP 906 P + RP P P PP P P P PP P PP P Sbjct: 164 PQVVRPPPGQMPPPMRPPQMPIPFQRPPGVPPAFPGGPPPPP 205 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 PP + P P PP P PP P P PPP P Sbjct: 212 PPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPGMPPPPPGP 252 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 41.5 bits (93), Expect = 9e-04 Identities = 22/43 (51%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXG--RGIXGG 786 G GGG GGG G GG G G GG G GGG G +G GG Sbjct: 98 GGYGGGYGGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGG 140 Score = 41.5 bits (93), Expect = 9e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GGG GGG G GG GG G G GG G G GG K Sbjct: 103 GYGGGGGGGGGGGYGGYGGYGGYGGGGYGGYNKGYGGGGGGGYSK 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/37 (54%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG G G GG GG GG G GGG G G G Sbjct: 82 GGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGGGGYGG 118 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 70 GGGYGGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGG 109 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXG--GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G G GG GG G GGG G G GG Sbjct: 83 GGNGGGYGGGYGGYGGGYGGGYGGGGGGGGGGGYGGYGGYGG 124 Score = 35.9 bits (79), Expect = 0.044 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGG---GXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G G GGG G G GG Sbjct: 123 GGYGGGGYGGYNKGYGGGGGGGYSKGFGGGYGGGGYPGGGYYGG 166 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG G G GGG G G GG Sbjct: 74 GGGYGSGYGGGNGGGYGGGYGGYGGGYGGGYGGGGGGGGG 113 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G G G GG G G Sbjct: 94 GGYGGGYGGGYGGGGGGGGGGGYGGYGGYGGYGGGGYGG 132 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G GG GG GGG G G G Sbjct: 136 GYGGGGGGGYSKGFGGGYGGGGYPGGGYYGGGGGGG 171 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = -2 Query: 905 GXXGGG--XXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G G GG G GG G GGG Sbjct: 138 GGGGGGGYSKGFGGGYGGGGYPGGGYYGGGGG 169 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 41.5 bits (93), Expect = 9e-04 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 PP +P P PPP P PP PP P P PP P P P Sbjct: 93 PPLLPTPP--PPPASISPTPAPPLPPPPAPAPPPTPTPKFP 131 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXX-----PPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP PRP PPP P P P PP P P P PPP P Sbjct: 75 PPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAP 120 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP P PP PPP Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPP 124 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP------XPXPPPXXPPPXXP 906 PP +P P P P PP P PP P PPP P P P Sbjct: 59 PPPLPTPTVTTPTPP--PPPPAPRPPRRHHRIPPPPPPLLPTPPPP 102 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T PP P P PP PP PP P P PPP P P P Sbjct: 69 TPTPPP-PPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPP 113 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P PPP P P P Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPPPPAPRPP 82 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P PPP P P PP P P P P Sbjct: 54 PDSPPPPPLPTPTVTTPTPPPPPPAPRPP 82 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPP 894 PPP P P P P PP PP Sbjct: 57 PPPPPLPTPTVTTPTPPPPPPAPRPP 82 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G GGG GRG GG Sbjct: 104 GGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGG 143 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G GG GG G GGG G G Sbjct: 90 GGGGGGGYGQRGGGGGYGGGGGYGGGGGGGYG 121 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 9/49 (18%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GGG G G GG Sbjct: 105 GYGGGGGYGGGGGGGYGQRREGGYGGGGGYGGGRGGGGGYGGGYGSRGG 153 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G+ GG Sbjct: 90 GGGGGGGYGQRGGGGGYGG--GGGYGGGGGGGYGQRREGG 127 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GG G GG GG GG GGG G Sbjct: 127 GYGGGGGYGG--GRGGGGGYGGGYGSRGGGNSDG 158 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GG GG G G Sbjct: 98 GQRGGGGGYGGGGGYGGGGGGGYGQRREGGYGGGGGYGG 136 >12_02_0450 + 19172812-19172920,19173020-19173088,19173168-19173274, 19173874-19174365 Length = 258 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG GGG G G GG Sbjct: 119 GGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGG 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG GGG G G GG Sbjct: 117 GGGGYGGG-GYGGGGGGYGGGGYSGGGGYGGGGYSGG 152 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G GG G GG G GG G GG V Sbjct: 143 GYGGGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRGGGGGGYGV 185 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G G G GGG G Sbjct: 153 GGGGGGYQGGGGGYGGNNGGYGNRGGGGGGYGVAEG 188 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGGGXGXGG---XGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G GGG G G GG Sbjct: 118 GGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGG 157 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G G GG GG G GGG G G Sbjct: 137 GYSGGGGYGGG-GYSGGGGGGGGYQGGGGGYGGNNGGYG 174 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G GG G GGG +G GG Sbjct: 129 GGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGGGG 165 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GG G G GG Sbjct: 125 GYGGGGGGYGGGGYSGGGGYGGG--GYSGGGGGGGGYQGG 162 Score = 36.3 bits (80), Expect = 0.033 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 132 GYGGGGYSGGG-GYGG-GGYSGG-GGGGGGYQGGGGGYGG 168 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG GG G GG G G GGG GG G G S G Sbjct: 112 GGFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGG 154 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG GG G G Sbjct: 113 GFRSGGGGYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSG 151 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 131 GGYGGGGYSGGGGYGGGGYSGG--GGGGGGYQGGGGGYG 167 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGG---GXXGGAGDXG 790 G GGG GG G GG G G GG G GG G G Sbjct: 120 GYGGGGYGGGGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQG 161 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGG G GG GGG Sbjct: 129 GGGGYGGGGYSGGGGYGGGGYSGGGGGGGGYQGGG 163 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG GG G G G G GGG G G G G Sbjct: 136 GGYSGGGGYGGGGYSGGGGGGGGYQGGGGGYGGNNGGYGNRGGGGGG 182 >10_08_0222 - 15983756-15984313 Length = 185 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G G G GG Sbjct: 102 GPYGGGYAQGGGGGGGSGGGQNGGSGSGSGSGSGSGQAGG 141 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G G G G G GG Sbjct: 31 GGGGGGGGGGGSSGGGSGWGSGSGSGYGQAGG 62 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G GG GG G G G G G G G Sbjct: 61 GGSGGAYASGGGGGGGSGGGANGGSGYGSGSGSGYGQAG 99 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G GG G G GG Sbjct: 36 GGGGGGSSGGGSGWGSGSGSGYGQAGGSGGAYASGGGGGGG 76 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G G Sbjct: 32 GGGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSG 64 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G G GG G G G G G G Sbjct: 31 GGGGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSGG 65 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGG---GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG GGG G GG Sbjct: 116 GGSGGGQNGGSGSGSGSGSGSGQAGGYGPYGGGYAQAGGQGGG 158 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG GG G G G G G G Sbjct: 143 GPYGGGYAQAGGQGGGGGGGQSGPGGSGSGSGSGSG 178 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G G G G G G GG Sbjct: 111 GGGGGGGSGGGQNGGSGSGSGSGSGSGQAGGYGPYGG 147 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GGG GG G G G G G G GG Sbjct: 31 GGGGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSGGAYASGG 71 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G G G G G G GG G G GGG G G GG Sbjct: 44 GGGSGWGSGSGSGYGQAGGSGGAYASGGGGGGGSGGGANGG 84 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G GG GG Sbjct: 33 GGGGGGGGGSSGGGSGWGSGSGSGYGQAGGSGGAYASGGG 72 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG GG G GGG G G G Sbjct: 56 GYGQAGGSGGAYASGGGGGG--GSGGGANGGSGYGSG 90 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G G G G G GG Sbjct: 70 GGGGGGGSGGGANGGSGYGSGSGSGYGQAGSYGPYGG 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G GG GGG G G Sbjct: 84 GSGYGSGSGSGYGQAGSYGPYGGGYAQGGGGGGGSG 119 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GG G G GG GGG Sbjct: 114 GGGGSGGGQNGGSGSGSGSGSGSGQAGGYGPYGGG 148 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GG GG GG G GGG G G G Sbjct: 135 GSGQAGGYGPYGGGYAQAGGQGGGGGGGQSGPGGSG 170 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG----XGGGXXXGRGIXGG 786 G GG GG G G G G G GGG G G GG Sbjct: 74 GGGSGGGANGGSGYGSGSGSGYGQAGSYGPYGGGYAQGGGGGGG 117 >09_03_0145 - 12749288-12751510 Length = 740 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 PP P+P PP P PP PP P P P PPP P Sbjct: 19 PPFKPKPTNPSPPPPPPPPGIQPPPPALPGMPHGRPPPPFP 59 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 + +P P P PP PP P PPP P Sbjct: 16 LSKPPFKPKPTNPSPPPPPPPPGIQPPPPALP 47 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXP---PXPXPPPXXPPPXXP 906 PP IP PPP P PP P P P P P P P PP P Sbjct: 27 PPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGP 70 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 P PRP P P P P PP PP P PP P P Sbjct: 13 PAPPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTP 50 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP P P PPPP P PPPP Sbjct: 15 PPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPP 48 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP PPP P Sbjct: 66 PPPGPGPAAAPSPHSPSPSNAPWVAPAADIPPPPPPPPNP 105 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP PP P PPP P P Sbjct: 16 PRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAP 52 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP---PXXPPXP---PXPXP-PPXXPPPXXP 906 PP P P PPP P P PP P P P P P P P P Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSPHSP 81 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P P PPP P S PPPP Sbjct: 5 PDPIQQDSPAPPRPTPAPQATPPPAIPESGPPPPP 39 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 PP P P PPP P P PP P P P P P P Sbjct: 46 PPPTPAPQSSPAPPPAPDMTP--PPGPGPAAAPSPHSPSP 83 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP-PSXXPPPP 902 PA P P P PPPP P P P PP Sbjct: 20 PAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPP 59 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P P PP P PPP Sbjct: 37 PPPAPDMPPPPPTPA--PQSSPAPPPAPDMTPPP 68 >06_03_1506 + 30641428-30642168 Length = 246 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G G GGG G G GG Sbjct: 142 GHGGGGGGGSGYGNGGYGSGFGEGYGSGGGVNGGGGSGGG 181 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G G G G G GG Sbjct: 65 GGVGGGGYGGGGGYGSGGGEGNGAYGQGYGYGSGNGGGGG 104 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG G G G G G G GG Sbjct: 135 GGQGGGGGHGGGGGGGSGYGNGGYGSGFGEGYGSGGG 171 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G G G G+ GG Sbjct: 136 GQGGGGGHGGGGGGGSGYGNGGYGSGFGEGYGSGGGVNGG 175 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXGG 786 G GG GG G GG GG GG G G G G G GG Sbjct: 165 GYGSGGGVNGGGGSGGGGGGGGGASGYRYGAGYGKGYGYGGG 206 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G G G G G GG Sbjct: 206 GPGGGG--GGAGGGGGGGSYNGGTGGYGEGHGSGYGGGGG 243 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G GGG G G GG Sbjct: 73 GGGGGYGSGGGEGNGAYGQGYGYGSGNGGGGGGGYGGGGG 112 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G G G G G G G Sbjct: 96 GSGNGGGGGGGYGGGGGGSYGSGGMGSGYGGGYGSGYDYG 135 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG G G G G G G Sbjct: 94 GYGSGNGGGGGGGYGGGGGGSYGSGGMGSGYGGGYG 129 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G GG GG G G GGG G G G Sbjct: 121 GSGYGGGYGSGYDYGGQGGGGGHGGGGGGGSGYGNGGYG 159 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G GG G G GG G G Sbjct: 200 GYGYGGGPGGGGGGAGGGGGGGSYNGGTGGYGEGHG 235 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGG---XGXGGXGGXXGGXXGXG---GGXXXGRGIXGG 786 G GGG GGG G GG G GG G G GG G G GG Sbjct: 101 GGGGGGYGGGGGGSYGSGGMGSGYGGGYGSGYDYGGQGGGGGHGGG 146 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG------XGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G G GG Sbjct: 171 GVNGGGGSGGGGGGGGGASGYRYGAGYGKGYGYGGGPGGGGGGAGG 216 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GGG G G G Sbjct: 121 GSGYGGGYGSGYDYGGQGGGGGHGGGGGGGSGYGNG 156 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG G GG GG G G G G G G V Sbjct: 135 GGQGGGGGHGGGGGGGSGYGNGGYGSGFGEGYGSGGGV 172 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G G G GG G G GGG G G G Sbjct: 154 GNGGYGSGFGEGYGSGGGVNGGGGSGGGGGGGGGASG 190 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG G G G GGG G G Sbjct: 98 GNGGGGGGGYGGGGGGSYGSGGMGSGYGGGYGSGYDYGG 136 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGGXXVXKXXY 762 G GGG G GG G G GG G G GGG G G GG Y Sbjct: 108 GGGGGGSYGSGGMGSGYGGGYGSGYDYGGQGGGGGHGGGGGGGSGYGNGGY 158 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GG G G Sbjct: 144 GGGGGGG--SGYGNGGYGSGFGEGYGSGGGVNGGGGSGG 180 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G G G G GG GGG G G GG Sbjct: 147 GGGGSGYGNGGYGSGFGEGYGSGGGVNGGGGSGGGGGGGGG 187 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G G G G G G G G GG Sbjct: 33 GGGGGGYGSGGGEGNGGYGHGYGYGSGYGFGNGGVGG 69 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G G G G GG Sbjct: 33 GGGGGGYGSGGGEGNGGYGHGYGYGSGYGFGNGGVGGGGYGGG 75 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G GG G GG GG GG G GGG G Sbjct: 59 GYGFGNGGVGGGGYGG--GGGYGSGGGEGNG 87 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGX-GGXXGGXXGXGGGXXXGRGIXG 789 G G G G G GG GG GG G GGG G G Sbjct: 190 GYRYGAGYGKGYGYGGGPGGGGGGAGGGGGGGSYNGGTGG 229 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX-GGXXGXGGGXXXGRGIXG 789 G G G G G GG GG GG G G G G G G Sbjct: 51 GHGYGYGSGYGFGNGGVGGGGYGGGGGYGSGGGEGNGAYG 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G GG G GGG G G GG Sbjct: 182 GGGGGGASGYRYGAGYGKGYGYGGGPGGGGG-GAGGGGGGG 221 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GGG G G G G G G G G Sbjct: 210 GGGGAGGGGGGGSYNGGTGGYGEGHGSGYGGGGGHG 245 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 10/50 (20%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXG---------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GG G G G GG GG G GGG G G G Sbjct: 38 GYGSGGGEGNGGYGHGYGYGSGYGFGNGGVGGGGYGGGGGYGSGGGEGNG 87 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G G G G G GG GG GG G GG G G G G Sbjct: 90 GQGYGYGSGNGGGGGGGYGGGGGGSYGSGGMGSGYGGGYGSG 131 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG G G G G GGG GGAG G S G Sbjct: 181 GGGGGGGASGYRYGAGYGKGYGYGGGPGGGG-GGAGGGGGGGSYNGG 226 >06_03_0674 + 23422004-23422552,23423295-23423369,23424360-23424443, 23424749-23424991,23425348-23425515,23425608-23425727, 23426372-23427016 Length = 627 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG GG GGG G G GG Sbjct: 544 GGGYSGGGGGGGYSGGGGGGGYSGGGGGYSGGGRGGG 580 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G G G RG GG Sbjct: 549 GGGGGGGYSGGGGGGGYSGGGGGYSGGGRGGGYSRGGRGG 588 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GG G GG Sbjct: 546 GYSGGGGGGGYSGGGGGGGYSGGGGGYSGGGRGGGYSRGG 585 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GG G G GG Sbjct: 559 GGGGGGYSGGGGGYSGGGRGGGYSRGGRGGYSGGGGGGGG 598 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G GG Sbjct: 558 GGGGGGGYSGGGGGYSGGGRGGGYSRGGRGGYSGGGGGGG 597 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG GRG G Sbjct: 554 GGYSGGGGGGGYS-GGGGGYSGGGRG-GGYSRGGRGGYSG 591 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG G G GG G G GG GG GD R Sbjct: 564 GYSGGGGGYSGGGRGG-GYSRGGRGGYSGGGGGGGGDPYR 602 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PRP PPP P PP P PP P PPP P Sbjct: 920 PPPPRPPGAPPPPP--PPGKPGGPPPPPPPPGSLP 952 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 10/49 (20%) Frame = +1 Query: 790 PXIPRPXXXPP----------PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +PRP P P P PP PP PP P P PPP P Sbjct: 899 PRVPRPPPAPSATANTASALSPPPPRPPGAPPPPPPPGKPGGPPPPPPP 947 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPX-PPPXXPPP 897 PPP P P PP P P PPP PPP Sbjct: 921 PPPRPPGAPPPPPPPGKPGGPPPPPPPP 948 >06_01_0690 + 5033943-5034740 Length = 265 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G G G G G G GG Sbjct: 182 GPYGGGYAQGGGGGGGGGGGQNGGSGYGSGSGSGYGQAGG 221 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG G G G G G G GG Sbjct: 64 GGYASGGGGGGGGGGGGGNGGSGYGSGSGSGYGQAGG 100 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G GG Sbjct: 70 GGGGGGGGGGGGNGGSGYGSGSGSGYGQAGGYGPYGG 106 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG GG GG GG G GG G G G Sbjct: 176 GQAGGYGPYGGGYAQGG-GGGGGGGGGQNGGSGYGSGSGSG 215 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G G G Sbjct: 31 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQASG 62 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG GGG G G GG Sbjct: 158 GGGGGQNGGSGYGSGSGYGQAGGYGPYGGGYAQGGGGGGG 197 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G G Sbjct: 32 GGGGGGGGGGGSGNGSGWGSGSGSGYGQASGPG 64 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G G G G GG Sbjct: 71 GGGGGGGGGGGNGGSGYGSGSGSGYGQAGG 100 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 110 GGGGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGG 146 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 191 GGGGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGG 227 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GG G GG GG G G G G G+ Sbjct: 142 GPYGGGAYAQGGGGGGGGGGGQNGGSGYGSGSGYGQ 177 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G G G G G G G Sbjct: 31 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQASGPGG 65 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G G GG G G GG Sbjct: 36 GGGGGGGSGNGSGWGSGSGSGYGQASGPGGYASGGGGGGGG 76 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G GGG G GG GG G GG G G Sbjct: 136 GQAGGYGPYGGGAYAQGGGGGGGGGGGQNGGSGYGSG 172 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG GG G GG G G G Sbjct: 96 GQAGGYGPYGGYAQGGGGGG-GGGGGQNGGSGYGSGSGSG 134 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G G G G GG G GG G GGG G G G Sbjct: 50 GSGSGSGYGQASGPGGYASGGGGGGGGGGGGGNGGSGYGSG 90 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG----XXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG G G GGG G G GG Sbjct: 162 GQNGGSGYGSGSGYGQAGGYGPYGGGYAQGGGGGGGGGGGQNGG 205 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G GG G G GG Sbjct: 75 GGGGGGGNGGSGYGSGSGSGYGQAGGYGPYGGYAQGGGGGGG 116 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX-GXGGGXXXGRGIXGG 786 G G G G G G G GG G GGG G G GG Sbjct: 84 GSGYGSGSGSGYGQAGGYGPYGGYAQGGGGGGGGGGGQNGG 124 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G G G G G GG Sbjct: 111 GGGGGGGGGGQNGGSGYGSGSGSGYGQAGG 140 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG G G G G G G+ G Sbjct: 33 GGGGGGGGGGSGNGSGWGSGSGSGYGQASGPG 64 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GG G G G G G G G GG +G GG Sbjct: 114 GGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGAYAQGGGGG 156 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G G GG G GGG G G G Sbjct: 48 GWGSGSGSGYGQASGPGGYASGGGGGGGGGGGGGNGGSG 86 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G G GGG GG G G Sbjct: 88 GSGSGSGYGQAGGYGPYGGYAQGGGGGGGGGGGQNG 123 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GG G G GG GGG Sbjct: 113 GGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGG 147 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GG G GG GGG Sbjct: 153 GGGGGGGGGGQNGGSGYGSGSGYGQAGGYGPYGGG 187 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G G G G GGG G G G Sbjct: 44 GNGSGWGSGSGSGYGQASGPGGYASGGGGGGGGGGGGGNG 83 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GG G G G G G G G GG G GG Sbjct: 195 GGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGYAQAGGQGGG 237 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GGG R GG Sbjct: 92 GGGAGGPLGGGGGGWGAGGGGGGGGGGGGGGFWSRIFSGG 131 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG GGG G G GG Sbjct: 88 GGGFGGGAG-GPLGGGGGGWGAGGGGGGGGGGGGGG 122 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG GG G G GGG G G Sbjct: 88 GGGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGG 121 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G G GG G GG G GGG G Sbjct: 89 GGFGGGAGGPLGGGGGGWGAGGGGGGGGGGGGGG 122 >02_01_0158 - 1103461-1104186 Length = 241 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG GG GR GG Sbjct: 81 GAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGG 120 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GGG G GG Sbjct: 80 GGAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWGGG 114 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GGGG G GG GGG G Sbjct: 86 GGGGGGFGSRGGGGSGGGGRSYGGSWGGGRRSGGGGPGG 124 Score = 31.9 bits (69), Expect = 0.72 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG--GXXGXGGGXXXGRGIXGG 786 G G GG G GG GG G G G GGG G GG Sbjct: 72 GPDGSFVKGGAGGGGGGGGGFGSRGGGGSGGGGRSYGGSWGG 113 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G GG G G GGG G G G Sbjct: 87 GGGGGFGSRGGGGSGGGGRSYG--GSWGGGRRSGGGGPG 123 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -2 Query: 896 GGGXXGGGXGXGGX--GGXXGGXXGXGGG 816 GGG GGG GG GG G G GGG Sbjct: 97 GGGSGGGGRSYGGSWGGGRRSGGGGPGGG 125 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG------XXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG G GGG G G GG Sbjct: 118 GGGGPGGGCFKCGESGHMARDCFNGGGVGVGGGGGGGGGAGGG 160 >12_02_1114 - 26171876-26172493 Length = 205 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G G GGG G GG GG GG G GGG Sbjct: 58 GGSGSGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GG G GG GG GG G GGG G Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G GG GG GG G GGG G G G Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG GG G GGG Sbjct: 57 GGGSGSGGGGGGGGGGGGGGGGGGGGGGGG 86 >10_08_0214 - 15915156-15915713 Length = 185 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG G G G G G G G Sbjct: 32 GGGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGG 67 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G G G G Sbjct: 139 GSGAGGAHGGGYGSGG-GGGGGGGQGGGSGSGSGSGYGSG 177 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGGXXV 777 G GG GGG G GG GG GG G G G G+G G V Sbjct: 62 GGGSGGAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGV 105 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGG--XXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG G G G G G G+ G Sbjct: 67 GAAGGGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGG 107 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G G G GGG G Sbjct: 35 GGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAG 70 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G G G G G GG Sbjct: 144 GAHGGGY--GSGGGGGGGGGQGGGSGSGSGSGYGSGSGGG 181 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G G G G G Sbjct: 114 GGGGGGGQGGGAGGYGQGSGYGSGYGSGAGGAHGGGYGSG 153 Score = 35.1 bits (77), Expect = 0.077 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 8/48 (16%) Frame = -2 Query: 905 GXXGGGXXGG-GXG-------XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG GG G GGG G G GG Sbjct: 41 GEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGGG 88 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G G G G G GG Sbjct: 74 GRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGG 116 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G G G G G GG Sbjct: 78 GGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGGGGGGGQGGG 124 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G G GG GG G GG G G G Sbjct: 98 GSGYGAGVGGAGGYGSGGGGGGGQGGGAGGYGQGSGYGSG 137 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G G G G G G G Sbjct: 34 GGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAG 70 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG G G G G G G G G Sbjct: 104 GVGGAGGYGSGGGGGGGQGGGAGGYGQGSGYGSGYGSGAG 143 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 11/51 (21%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-----------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG GG G GGG G G GG Sbjct: 115 GGGGGGQGGGAGGYGQGSGYGSGYGSGAGGAHGGGYGSGGGGGGGGGQGGG 165 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GGG G G G G G G G G G Sbjct: 148 GGYGSGGGGGGGGGQGGGSGSGSGSGYGSGSGGGNG 183 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G G G G G GG Sbjct: 71 GGYGRGGGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGG 110 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG GG G G G G G GG Sbjct: 30 GPGGGGGGGGGGEGGG--GGYGGSGYGSGSGYGEGGG 64 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G G G G G G Sbjct: 37 GGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRG 76 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GG G G G GG G GGG G G Sbjct: 58 GYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSG 90 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G G G G GG Sbjct: 110 GYGSGGGGGGGQGGGAGGYGQGSGYGSGYGSGAGGAHGGG 149 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG G G GGG G G G Sbjct: 56 GSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSGSG 92 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG G GGG G G G Sbjct: 135 GSGYGSGAGGAHGGGYGSGGGGGGGGGQGGGSGSGSG 171 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G G GG G G Sbjct: 77 GGGGGGGGEGGGSGSGYGSGQGSGYGAGVGGAGGYGSGG 115 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGX--XXGRGIXGG 786 G GG G G G G G GG GG G GGG G G G Sbjct: 46 GGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGGGSG 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -1 Query: 897 GGGXXRG-GXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G G G GG G G GGG GGAG G+ G Sbjct: 94 GSGQGSGYGAGVGGAGGY-GSGGGGGGGQGGGAGGYGQGSGYGSG 137 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G G GG G Sbjct: 33 GGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGG 71 >09_06_0283 + 22024779-22026134,22026181-22026714 Length = 629 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G GG GG GG G GG Sbjct: 23 GFLGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG 816 GG GGG G GG GG GG G GGG Sbjct: 26 GGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G GG GG GG G GGG G Sbjct: 23 GFLGGGGGGGGGGGGGGGGGGGGGGGGGG 51 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G GG GG GG G GGG Sbjct: 23 GFLGGGGGGGGGGGGGGGGGGGGGGG 48 >04_04_1413 - 33386049-33386339 Length = 96 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG GG GG GG G GGG G Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGGGGCGGGGGSGGG 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G GG GG G GGG G G Sbjct: 63 GGGGGGGGGGGCGGGGGGGGGGGCGGGGGSGGG 95 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G GGG G G GG Sbjct: 63 GGGGGGGGGGGCGGGGGGGGGGGCGGGGGSGG 94 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G GGG G G G Sbjct: 62 GGGGGGGGGGGGCGGGGGGGGGGGCGGGGGSG 93 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG G GG G GGG G G GG Sbjct: 64 GGGGGGGGGGCGGGGGGGGGGGCGGGGGSGGG 95 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG GG G GGG G G GG Sbjct: 53 GSGGRRRRTGGGGGGGGGGGGCGGGGGGGGGGGCGGG 89 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG R G G GG G G GGG GG G G Sbjct: 55 GGRRRRTGGGGGGGGGGGGCGGGGGGGGGGGCGGGG 90 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPP----XXPPXPPXPXPPPXXPPP 897 PP +P PPP P PP PP PP PPP PPP Sbjct: 419 PPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVPPPP 460 Score = 36.7 bits (81), Expect = 0.025 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 + RP PPP P PP PP PPP P P Sbjct: 412 VSRPQSPPPPLPSDAFEQPPPPPEHPPPPESTSPPPP 448 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP PP P P P PPP PP Sbjct: 430 PP--PPPEHPPPPESTSPPPPPTSDPPPVPPP--PP 461 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 9/36 (25%) Frame = +1 Query: 817 PPPXPXXPPXXPPX---------PPXPXPPPXXPPP 897 PPP P P P PP P PPP PPP Sbjct: 506 PPPFPSAPNTPPGFQGLAGPFYGPPYPAPPPPPPPP 541 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P +PPP P P PPPP S P P Sbjct: 433 PPEHPPPPESTSPPPPPTSDPPPVPPPPPTTGSFMPIP 470 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 PP P P PPP P PP P P P P P P Sbjct: 445 PP--PPPTSDPPPVPPPPPTTGSFMPIPSAPFAGLPVPAGP 483 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P PP P PPP P S PP P Sbjct: 419 PPPLPSDAFEQPPPPPEHPPPPESTSPPPPPTSDPPPVP 457 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP R PPP P PP PP PPP PPP P Sbjct: 975 PPPFTRQDIPPPP-PSPPPLPITQPPSVPPPPNSPPPLQP 1013 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +1 Query: 802 RPXXXPPPXPXXPP-----XXPPXPPXPXPPPXXPPPXXP 906 RP PPP PP PP PP P P P PP P Sbjct: 963 RPPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVP 1002 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 IP P PPP P P P PP P PP P P Sbjct: 983 IPPPPPSPPPLPITQP--PSVPPPPNSPPPLQPATDP 1017 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P P P P P PP PPP PP Sbjct: 20 PSPAPSPSSSSAPAPASPRSPVPPPPGVPPPPPPPP 55 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 P PPP PP P PPP P P PPPP Sbjct: 964 PPPPPPPPNVAPPPFTRQDIPPPPPSPPPLPITQPPSVPPPP 1005 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP PRP PPP P PP P PP P P P P Sbjct: 614 PPPPPRPPGAPPPPP--PPGKPGGPPPPPPRPGSLP 647 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 10/46 (21%) Frame = +1 Query: 790 PXIPRPXXXP----------PPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +PRP P PP P PP PP PP P P PPP Sbjct: 594 PRVPRPPPAPSATANTASALPPPPPRPPGAPPPPPPPGKPGGPPPP 639 >10_08_0213 - 15912048-15912716 Length = 222 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G GRG G Sbjct: 139 GSGAGGASGGGGGHGGGGGGGQGGGYGSGSGYGSGRGYGQG 179 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G GG Sbjct: 38 GGGGGGGSGGGGGYGGSGYGSGSGYGEGGGAGAGGYGHGG 77 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG G G G G G G G Sbjct: 36 GGGGGGGGGSGGGGGYGGSGYGSGSGYGEGGGAGAG 71 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG G G GGG G G GG Sbjct: 49 GGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGGGGEGGG 88 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G G G G G G G GG Sbjct: 181 GAYGGGYASGGGGGGGGGQGGGSGYGSGSGYGYGSGGGGG 220 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/38 (47%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G G G G+G G Sbjct: 65 GGGAGAGGYGHGGGGGGGGGEGGGSGSGYGSGQGSGSG 102 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG GG G G G G G GG Sbjct: 179 GGGAYGGGYASGGGGGGGGGQGGGSGYGSGSGYGYGSGGG 218 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG GG GGG G G GG Sbjct: 163 GYGSGSGYGSGRGYGQGGGAYGGGYASGGGGGGGGGQGGG 202 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG GG G G G G G G G Sbjct: 102 GYGSGAFGAGGYGSGGGGGGGGAGSGYGSGEGYGSGYGSG 141 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G GG Sbjct: 149 GGGHGGGGGGGQGGGYGSGSGYGSGRGYGQGGGAYGG 185 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG--GXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G GG G GGG G G G Sbjct: 57 GSGSGYGEGGGAGAGGYGHGGGGGGGGGEGGGSGSGYGSGQG 98 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G G G G G G G G Sbjct: 67 GAGAGGYGHGGGGGGGGGEGGGSGSGYGSGQGSGSGYGSG 106 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G G G GG Sbjct: 74 GHGGGGGGGGGEG-GGSGSGYGSGQGSGSGYGSGAFGAGG 112 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG G G G G G G G G Sbjct: 111 GGYGSGGGGGGGGAGSGYGSGEGYGSGYGSGAGGASG 147 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG G G G G G GG Sbjct: 33 GGEGGGGGGGGGSGGG--GGYGGSGYGSGSGYGEGGG 67 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 9/45 (20%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---------GXGGXXGGXXGXGGGXXXGRG 798 G GGG G G G G G GG GG G GGG G+G Sbjct: 117 GGGGGGGAGSGYGSGEGYGSGYGSGAGGASGGGGGHGGGGGGGQG 161 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG G GG G G GG Sbjct: 43 GGSGGGGGYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGGG 83 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G G GG G G G G G G G G Sbjct: 106 GAFGAGGYGSGGGGGGGGAGSGYGSGEGYGSGYGSGAGG 144 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXG---GXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G GGG G G GG Sbjct: 153 GGGGGGGQGGGYGSGSGYGSGRGYGQGGGAYGGGYASGGGGGGG 196 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG G G G G G G G G G G Sbjct: 71 GGYGHGGGGGGGGGEGGGSGSGYGSGQGSGSGYGSGAFG 109 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G G G G GG G G GG G G G G G G Sbjct: 100 GSGYGSGAFGAGGYGSGGGGGGGGAGSGYGSGEGYGSG 137 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG G G G GGG G G G Sbjct: 50 GYGGSGYGSGSGYGEGGGAGAGGYGHGGGGGGGGGEGGGSG 90 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G G G GG G G GG Sbjct: 118 GGGGGGAGSGYGSGEGYGSGYGSGAGGASGGGGGHGG 154 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G G G G GGG G G G Sbjct: 92 GYGSGQGSGSGYGSGAFGAGGYGSGGGGGGGGAGSGYGSG 131 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G G G G G GG Sbjct: 111 GGYGSGGGGGGGGAGSGYGSGEGYGSGYGSGAGGASGGGGG 151 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGG-----GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G GG G G GG Sbjct: 79 GGGGGGEGGGSGSGYGSGQGSGSGYGSGAFGAGGYGSGGGGGGGG 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G G Sbjct: 77 GGGGGGGGEGGGSGSGYGSGQGSGSGYGSGAFGAGGYGSG 116 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -1 Query: 897 GGGXXRGGXGXG---GXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G G G G G GG GG G G Sbjct: 116 GGGGGGGGAGSGYGSGEGYGSGYGSGAGGASGGGGGHGG 154 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG----GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G G GG G G GGG G G G Sbjct: 90 GSGYGSGQGSGSGYGSGAFGAGGYGSGGGGGGGGAGSGYGSGEG 133 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G GG GG G G GGG G+G Sbjct: 137 GYGSGAGGASGGGGGHGGGGGGGQGGGYGSGSG 169 >03_05_0576 + 25765137-25766420 Length = 427 Score = 39.9 bits (89), Expect = 0.003 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP P P PPP PPP Sbjct: 65 PEAPPSPSPSPSPSPPPQPSSPPPPPPSPPP 95 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP PP PP P PP P Sbjct: 69 PSPSPSPSPSPPPQPSSPPPPPPSPP-PAAAVSVSPPTQP 107 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P P P PP PP P PPP Sbjct: 65 PEAPPSPSPSPSPSPPPQPSSPPPPP-PSPPP 95 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPP 894 P P+P PPP P PP P P P P PP Sbjct: 77 PSPPPQPSSPPPPPPSPPPAAAVSVSPPTQPRPRPELPP 115 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P PP PP P Sbjct: 68 PPSPSPSPSPSP-PPQPSSPPPPPPSPPP 95 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP PP PP P P Sbjct: 73 PSPSPSPPPQPSSPPPPPPSPPPAAAVSVSPPTQPRP 109 >06_01_0194 + 1503350-1503554,1504399-1504490,1504835-1504935, 1506186-1506276,1506616-1506674,1506764-1506884, 1506959-1507027,1507321-1507373,1507688-1507796, 1507895-1508065,1508148-1508306,1508561-1508650, 1508751-1508933,1509837-1510027,1510340-1510787 Length = 713 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/38 (55%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGG-GXXXGRG 798 G GGG G GG G GG GG GG G GG G GRG Sbjct: 672 GRGGGGGRGRGGGGGGGRGGGGGGGGGRGGRGRGRGRG 709 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GG G G GG GG G GGG GRG G Sbjct: 665 GSRGRGRGRGGGGGRGRGGGGGGGRGGGGGGGGGRGGRG 703 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG GG G G G GRG Sbjct: 676 GGGRGRGGGGGGGRGGGGGGGGGRGGRGRGRGRGRG 711 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG G G G G GRG Sbjct: 678 GRGRGGGGGGGRGGGGGGGGGRGGRGRGRGRGRGRG 713 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G G GG GG G GGG GRG GG Sbjct: 664 GGSRGRGRGRGGGGGR-----GRGGGGGGGRGGGGG 694 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GGG RGG G GG G G GGG GG G Sbjct: 676 GGGRGRGGGGGGGRGGGGG-----GGGGRGGRG 703 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P PP PP P PPP Sbjct: 37 PPSRPEPDQAAPPPPPQPHTAPPPPPPNAEPEAPPPP 73 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PPP P P PP P P P P Sbjct: 48 PPPPPQPHTAPPPPPPNAEPEAPPPPQLEVKAPAATLPPNP 88 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G GG G GG G GGG GRG G Sbjct: 9 GRGRGRGRGGGRGGGGGDGRGGGYGGAGGGGVGGRGGRG 47 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG G GG G G GRG GG Sbjct: 60 GGGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGG 96 Score = 36.3 bits (80), Expect = 0.033 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G G G GRG GG Sbjct: 17 GGGRGGG--GGDGRGGGYGGAGGGGVGGRGGRGPPGG 51 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG G G GRG GG Sbjct: 29 GGGYGGAGGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGG 68 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G GGG G G GG Sbjct: 33 GGAGGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGGGGGG 72 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG G G GG GG GGG G G G Sbjct: 61 GGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGGGRG 99 Score = 35.5 bits (78), Expect = 0.059 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGG---GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G GG G GGG GRG G Sbjct: 64 GYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGG---GRGYESG 103 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G GGG G G GG Sbjct: 42 GRGGRGPPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGG 81 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 906 GXXGGGXX-RGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG RGG G G G G G G GG G GR G Sbjct: 34 GAGGGGVGGRGGRGPPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGG 81 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G GG G G GRG GG Sbjct: 77 GGGGGGGGYESGGGRGYGGGGRGYESG--GGRGPGGG 111 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -1 Query: 906 GXXGGGXXRG-GXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG RG G G GG G G GGG G GR Sbjct: 66 GGGGGGGGRGYGGGGGGGGYESGGGRGYGGGGRGYESGGGR 106 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGG---GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G GG G GGG GRG G Sbjct: 79 GGGGGGYESGGGRGYGGGGRGYESGGGRGPGGG---GRGHESG 118 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 GGG RG GG G G G G GG G GR Sbjct: 7 GGGRGRGRGRGGGRGGGGGDGRGGGYGGAGGGGVGGR 43 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G RG G G G G GG GG G G Sbjct: 6 GGGGRGRGRGRGGGRGGGGGDGRGGGYGGAGGGGVGGRG 44 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 906 GXXGGGXXRG---GXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG RG G G G G G GGG GG + G Sbjct: 47 GPPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGGGGGYESG 88 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G GG G G G G GG G G Sbjct: 23 GGGDGRGG-GYGGAGGG-GVGGRGGRGPPGGGGGRG 56 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRGIXG 789 G GG G G G GG G GG G GG GRG G Sbjct: 99 GYESGG--GRGPGGGGRGHESGGGGGRGGNVWAQPGRGRGG 137 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/36 (52%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G GGG G+G Sbjct: 661 GGGGGGYGGGGGGYGGGG--YGGGGGYGGGYGGGQG 694 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG G G GGG G G GG Sbjct: 661 GGGGGGYGGGGGGYGGGGYGGGGGYGGGYGGG 692 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG G GGG G G GG Sbjct: 646 GGARFGGRDFRRDNRGGGGGGYGGGGGGYGGGGYGGG 682 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 879 GGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 GG G GG G G GGG GG G+ Sbjct: 663 GGGGYGGGGGGYGGGGYGGGGGYGGGYGGGQ 693 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G R G GG G G GGG GG G G Sbjct: 652 GRDFRRDNRGGGGGGYGGGGGGYGGGGYGGGGGYGG 687 >01_05_0490 + 22672241-22674679 Length = 812 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP------PXXPPXPPXPXPPPXXPPP 897 PP P P PP P P PP PP P PPP PPP Sbjct: 664 PPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPPPP 706 Score = 35.1 bits (77), Expect = 0.077 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P+P PPP P P P PPP PP P Sbjct: 639 PQPPPPPPPTTRRSRKPPQPPSRPAPPPPPPPQQQP 674 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/52 (42%), Positives = 22/52 (42%), Gaps = 12/52 (23%) Frame = +1 Query: 787 PPXIP-RPXXXPPPXPXX-PPXXP---------PXPPXPXP-PPXXPPPXXP 906 PP P RP PPP P PP P P PP P PP PPP P Sbjct: 655 PPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPPPP 706 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP R PP P P PP PP PP Sbjct: 645 PPPTTRRSRKPPQPPSRPAPPPPPPPQQQPP 675 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXX----PXXXPPPPXPPSXXPPPP 902 PPP PP P P PP PP PPPP Sbjct: 667 PPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPPPPPPP 705 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP PP PP Sbjct: 690 PPPSPPLPPPPPPPPPPMSEGEEEAPP 716 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +1 Query: 787 PPXIPRPXXX---PPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PP P P PP PP PP P Sbjct: 641 PPPPPPPTTRRSRKPPQPPSRPAPPPPPPPQQQPPFYP 678 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 863 GGXGGXXGGXXGXGGGXXXGRG 798 GG G GG G GGG GRG Sbjct: 64 GGPWGGGGGGGGGGGGYQRGRG 85 >12_01_0838 - 7830944-7831444 Length = 166 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G GG GG G G G G G+G G Sbjct: 66 GQSGGGQGSGGGGGGGGGGSNGSGSGSGYGYGYGQGNGG 104 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G G G G GG Sbjct: 109 GSGGGGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGG 148 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G G Sbjct: 64 GGGQSGGGQGSGGGGGGGGGGSNGSGSGSGYGYGYGQG 101 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG G G G G G GG Sbjct: 31 GGESGGGGGGGGGGGGGGNGSGSGSGYGYNYGKGGG 66 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG G G G G G G GG Sbjct: 103 GGAQGQGSGGGGGGGGGGGGGGSGQGSGSGYGYGYGKGGG 142 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G G G G G G GG Sbjct: 107 GQGSGGGGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGG 146 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GGG G G GG Sbjct: 114 GGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGG 153 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G GG G GGG G G GG Sbjct: 118 GGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGGGGG 158 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GGG G G GG Sbjct: 113 GGGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGG 152 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G GGG G G GG Sbjct: 116 GGGGGGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGG 155 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG GG GG G G G G G G Sbjct: 101 GNGGAQGQGSGGGGGGGGGGGGGGSGQGSGSGYGYGYGKG 140 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G G G G G GG Sbjct: 31 GGESGGGGGGGGGGGGGGNGSGSGSGYGYNYGKGGGQSGG 70 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGG-XXXGRGIXGG 786 G GGG GGG G G G G G G GGG G+G GG Sbjct: 36 GGGGGGGGGGGGGNGSGSGSGYGYNYGKGGGQSGGGQGSGGG 77 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G+G GG Sbjct: 77 GGGGGGGGSNGSGSGSGYGYGYGQGNGGAQGQGSGGG 113 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GG G G G G G GG G GGG G G G V + Sbjct: 120 GGGGGSGQGSGSGYGYGYGKGGGGGGGGGGDGGGGGGGGSAYVGR 164 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G G GG G G GG GG G GGG G G G K Sbjct: 95 GYGYGQGNGGAQGQGSGGGGGGGGGGGGGGSGQGSGSGYGYGYGK 139 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G GG G G G G G GG Sbjct: 79 GGGGGGSNGSGSGSGYGYGYGQGNGGAQGQGSGGGGGGGGGGG 121 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG G G G G G GG Sbjct: 44 GGGGGNGSGSGSGYGYNYGKGGGQSGGGQGSGGGGGGGGG 83 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG GG G G G G G G G Sbjct: 65 GGQSGGGQGSGGGGGGGGGGSNG-SGSGSGYGYGYGQGNG 103 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G G G GG G G GGG G G G Sbjct: 83 GGSNGSGSGSGYGYGYGQGNGGAQGQGSGGGGGGGGGGGGGG 124 >10_08_0217 - 15962192-15962884 Length = 230 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G G G G G GG Sbjct: 62 GGSGGAYASGGGGGGGGGGGQNGGSGYGSGSGSGYGQAGG 101 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G G GG Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQAGG 63 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG G G G G G G GG Sbjct: 103 GSHGGAYAQGGGQGGGGGGGANGGSGYGSGSGSGYGQAGG 142 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 112 GGGQGGGGGGGANGGSGYGSGSGSGYGQAGGYGPHGG 148 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G G Sbjct: 33 GGGGGGGGGGGSGNGSGWGSGSGSGYGQAGGSG 65 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G G GG G G GG Sbjct: 37 GGGGGGGSGNGSGWGSGSGSGYGQAGGSGGAYASGGGGGGG 77 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 71 GGGGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGSHGG 107 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G G GG GG Sbjct: 33 GGGGGGGGGGGSGNGSGWGSGSGSGYGQAGGSGGAYASGGG 73 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG GG GG G G G G G G G Sbjct: 144 GPHGGAYAQGGGQGGGGGGGYNGGSGYGSGSGSGYGQAG 182 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G G G G G G G Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQAGGSGG 66 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GG G G GG Sbjct: 75 GGGGGGGQNGGSGYGSGSGSGYGQAGGYGSHGGAYAQGGGQGGG 118 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G G G G G G GG G G GGG G G GG Sbjct: 45 GNGSGWGSGSGSGYGQAGGSGGAYASGGGGGGGGGGGQNGG 85 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG GG GG GG G GG G G G Sbjct: 57 GYGQAGGSGGAYASGGGGGG-GGGGGQNGGSGYGSGSGSG 95 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GG G G GG Sbjct: 116 GGGGGGGANGGSGYGSGSGSGYGQAGGYGPHGGAYAQGGGQGGG 159 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G GG Sbjct: 153 GGGQGGGGGGGYNGGSGYGSGSGSGYGQAGSYGPYGG 189 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G GG GGG G G Sbjct: 85 GSGYGSGSGSGYGQAGGYGSHGGAYAQGGGQGGGGG 120 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G GG GGG G G Sbjct: 126 GSGYGSGSGSGYGQAGGYGPHGGAYAQGGGQGGGGG 161 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G GG Sbjct: 157 GGGGGGGYNGGSGYGSGSGSGYGQAGSYGPYGGGYAHAGG 196 >10_07_0161 - 13674631-13675433,13675793-13675862 Length = 290 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G GGG G GG Sbjct: 187 GGGWTGGGNGGGGSGGGGGARGSSGGGGGGGWAGGGG 223 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG GG G G GGG G G Sbjct: 189 GWTGGG--NGGGGSGGGGGARGSSGGGGGGGWAGGG 222 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG GGG G GG Sbjct: 175 GRSGGGLTDSGGGGGWTGGGNGGGGSGGGGGARGSSGGGG 214 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG GGG Sbjct: 194 GNGGGGSGGGGGARGSSGGGGGGGWAGGGG 223 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G G G GG GGG G Sbjct: 193 GGNGGGGSGGGGGARGSSGGGGGGGWAGGGGGQG 226 Score = 32.7 bits (71), Expect = 0.41 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 893 GGXXGGGXGX-GGXGGXXGGXXGXG--GGXXXGRGIXGG 786 GG GGG GG GG GG G G GG RG GG Sbjct: 174 GGRSGGGLTDSGGGGGWTGGGNGGGGSGGGGGARGSSGG 212 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GGG AG Sbjct: 186 GGGGWTGGGNGGGGSGGGGGARGSSGGG----GGGGWAG 220 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 897 GGGXXR-GGXGXGGXGXXXGXXXXXGGGXXGG-AGDXG 790 GGG GG G GG G G GGG GG AG G Sbjct: 186 GGGGWTGGGNGGGGSGGGGGARGSSGGGGGGGWAGGGG 223 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG G GGG GRG Sbjct: 129 GGLSRGGGSGSARDGGSGVGGWTGGGGSSGGRG 161 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P PP P P PPP Sbjct: 216 PKGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 +PR PP P P PP PP P P P PPP Sbjct: 132 LPRGPGQEPPPPHVPKAAPPPPPPPPPHAPPGPPP 166 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P + P PPP P PP P P PPP P P P Sbjct: 211 PKLKGPKGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPP 250 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP 864 PP +P+ PPP P PP PP PP Sbjct: 142 PPHVPKAA--PPPPPPPPPHAPPGPP 165 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP P+ PPPP Sbjct: 216 PKGAPPPPPPPPPSPHRHPAA--HPPPPPHHPAPRPPPP 252 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 PP P P P P P PP P P PPP P P Sbjct: 220 PPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPPMAAAPRQP 260 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P PP PP P P PPP Sbjct: 136 PGQEPPPPHVPKAAPPPPPPPPPHAP-PGPPP 166 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 787 PPXIPR--PXXXPPPXPXXPPXXPPXP--PXPXPPPXXPP 894 PP P P PPP P P PP P P P PP Sbjct: 226 PPPSPHRHPAAHPPPPPHHPAPRPPPPMAAAPRQPAALPP 265 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PPP PPP P Sbjct: 133 PRGPGQEPPPPHVPKAAPPPPPPPPPHAP 161 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXP-PPXXPPPXXP 906 PP P P P P PP P P PP P P P P Sbjct: 224 PPPPPSPHRHPAAHPPPPPHHPAPRPPPPMAAAPRQPAALPP 265 >12_01_0776 + 7076218-7076832 Length = 204 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G GRG Sbjct: 70 GGEGGGGGGGGEG-GGEDGRDGGREGSGDGGGEGRG 104 >11_07_0007 - 27262229-27262638,27263252-27263312 Length = 156 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G GG G GGG GRG G Sbjct: 91 GGGSAGGGRGGGAGGSHRGGGGGRGGG-LSGRGHGSG 126 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG GG GG GG GGG G G+ G Sbjct: 83 GGCGGAGHGGGSAGGGRGGGAGGSH-RGGGGGRGGGLSG 120 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGX--GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG GG GRG G Sbjct: 63 GHGGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAG 104 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G G GG G GG RG GG Sbjct: 73 GQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAGGSHRGGGGG 113 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGR 801 G GG GGG G GG G G G GG GR Sbjct: 101 GGAGGSHRGGGGGRGGGLSGRGHGSGGAGGSSGGGR 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG G G GG G G G GG G G G Sbjct: 51 GHGGGGGRLAGHGHGGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGG 97 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G GG GG G G Sbjct: 79 GAPGGGC--GGAGHGGGSAGGGRGGGAGGSHRGGGGGRG 115 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG G G GG G G GGG GGAG R G Sbjct: 72 GGQSGGIGAPGGGCGGAGHGGG---SAGGGRGGGAGGSHRGGGGGRG 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G GG G G GGG GG G Sbjct: 44 GGGHDRGGHGGGG-GRLAGHGHG-GGGIPGGGQSGG 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG G G G GG G G G G G Sbjct: 111 GGGRGGGLSGRGHGSGGAGGSSGGGRRSLPGHGHGG 146 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G G G G G G GGG GG G G Sbjct: 84 GCGGAGHGGGSAGGGRGGGAGGSHRGGGGGRGGGLSGRGHGSGGAGG 130 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP PP P PPP PPP P Sbjct: 73 PPPPQTPPSPPPPPP-PPPPP--PPPLSP 98 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P PPP P P Sbjct: 74 PPPQTPPSPPPPPPPPPPPPPPLSPTP 100 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P PPP P PP PP P P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSPTP 100 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P PP P PP PP PP P P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSPTP 100 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A +P P P PPPP PP PPPP Sbjct: 60 ADHPHPHHHVSAAPPPPQTPPSPPPPPPPPP--PPPPP 95 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 819 PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP P PPPP PP P P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSPTP 100 >09_02_0274 + 6611555-6611615,6612229-6612638 Length = 156 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G GG G GGG GRG G Sbjct: 91 GGGSAGGGRGGGAGGSHRGGGGGRGGG-LSGRGHGSG 126 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG GG GG GG GGG G G+ G Sbjct: 83 GGCGGAGHGGGSAGGGRGGGAGGSH-RGGGGGRGGGLSG 120 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGX--GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG GG GRG G Sbjct: 63 GHGGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAG 104 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G G GG G GG RG GG Sbjct: 73 GQSGGIGAPGGGCGGAGHGGGSAGGGRGGGAGGSHRGGGGG 113 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGR 801 G GG GGG G GG G G G GG GR Sbjct: 101 GGAGGSHRGGGGGRGGGLSGRGHGSGGAGGSSGGGR 136 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG G G GG G G G GG G G G Sbjct: 51 GHGGGGGRLAGHGHGGGGIPGGGQSGGIGAPGGGCGGAGHGGGSAGG 97 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G GG GG G G Sbjct: 79 GAPGGGC--GGAGHGGGSAGGGRGGGAGGSHRGGGGGRG 115 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG G G GG G G GGG GGAG R G Sbjct: 72 GGQSGGIGAPGGGCGGAGHGGG---SAGGGRGGGAGGSHRGGGGGRG 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G GG G G GGG GG G Sbjct: 44 GGGHDRGGHGGGG-GRLAGHGHG-GGGIPGGGQSGG 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG G G G GG G G G G G Sbjct: 111 GGGRGGGLSGRGHGSGGAGGSSGGGRRSLPGHGHGG 146 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G G G G G G GGG GG G G Sbjct: 84 GCGGAGHGGGSAGGGRGGGAGGSHRGGGGGRGGGLSGRGHGSGGAGG 130 >08_01_0774 + 7482311-7482919,7484012-7484077,7484211-7484384, 7484473-7484603,7484726-7484802,7484981-7485064, 7487885-7488066,7488189-7488266,7489813-7489945, 7491610-7491670,7491861-7491942,7492143-7492271, 7492510-7492653,7493102-7493204,7493382-7493513, 7494127-7494485,7495149-7495229,7495384-7495450, 7495636-7495706,7496087-7496178,7496365-7496458, 7497692-7497789,7498206-7498341,7498599-7498618, 7498781-7498876,7498973-7499060,7499171-7499288, 7499738-7499759,7500203-7500326,7500625-7500702, 7500837-7500955,7501816-7501869,7502260-7502362, 7503133-7503261,7503345-7503453,7503788-7503819 Length = 1424 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP-XXPPXXPPXPPXPXPPP 882 PP P+ PPP P P PP PP P PPP Sbjct: 58 PPSPPKASPTPPPQPQPHPQLQPPPPPAPLPPP 90 Score = 31.9 bits (69), Expect = 0.72 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXP 876 PP P PP PP PP P P Sbjct: 155 PPLPLPPPPPPPMPPIPLP 173 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P PP P P P PPP P Sbjct: 53 PPELMPPSPPKASPTPPPQPQPHPQLQPPPPPAP 86 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P P PP P P PPP P P Sbjct: 53 PPEL-MPPSPPKASPTPPPQPQPHPQLQPPPPPAPLP 88 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P PP P P PP P P P P PP P Sbjct: 54 PELMPPSPPKASPTPPPQPQPHPQLQPPPPPAPLP 88 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PPP P PP P P P P P P Sbjct: 155 PPLPLP---PPPPPPMPPIPLPHMPFLPMMPHVPVPMPP 190 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 P PP P P PPP PP P Sbjct: 151 PGFAPPLPLPPPPPPPMPPIPLP 173 >07_03_1533 + 27523811-27524710 Length = 299 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG GG G G GG Sbjct: 85 GGGDDDGGGGGGGGGGGGGGGGDDSGGDDGGGGGGGG 121 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG G GGG G G Sbjct: 91 GGGGGGGGGGGGGGGGDDSGGDDGGGGGGGGDG 123 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG G GG G GGG Sbjct: 91 GGGGGG--GGGGGGGGGGDDSGGDDGGGGG 118 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G G G G GGG Sbjct: 92 GGGGGGGGGGGGGGGDDSGGDDGGGGGGGG 121 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG +GG GGGG G GG GGG Sbjct: 85 GGGDDDGGGGGGGGGGGGGGGGDDSGGDDGGGGG 118 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG GG G GG G G Sbjct: 96 GGGGGGGGGGGDDSGGDDGGGGGGGGDG 123 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G GG G G G Sbjct: 94 GGGGGGGGGGGGGDDSGGDDGGGGGGGGDG 123 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG GG GGGG G G GGG Sbjct: 85 GGGDDDGGGGGGGGGGGGGGGGDDSGGDDGGGGGG 119 >07_03_0782 - 21497949-21498563 Length = 204 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G GRG Sbjct: 70 GGEGGGGGGGGEG-GGEDGRDGGREGSGDGGGEGRG 104 >06_02_0271 + 13618149-13618297,13618311-13618560 Length = 132 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G G GG GG G G G G G GG V Sbjct: 54 GGEGGGGEGGGEGGDGGTEGGGDGGREGSGDGGGEGGGEDGGGEV 98 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G GG G GG G G G G+GD G Sbjct: 51 GRGGGEGGGGEGGGEGGDGGTEGGGDGGREGSGDGG 86 >05_05_0101 - 22398814-22399164 Length = 116 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G GG GG G GGG Sbjct: 18 GLGGGGGLGGGGGGLGEGGVRGGGAGLGGG 47 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG GG G GGG G G Sbjct: 15 GGAGLGGGGGLGGGGGGLGEGGVRGGGAGLGGG 47 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G G GGG G GG G GG G G G GR Sbjct: 14 GGGAGLGGGGGLGGGGGGLGEGGVRGGGAGLGGGR 48 >05_01_0545 - 4756266-4757510 Length = 414 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P +P P PPP P P PP P P P PP Sbjct: 377 PFVPSPLLPPPPPPAYPGPLPPVYPVPYASPPPPP 411 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 4/32 (12%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 P P PP PP P P PP P PP P Sbjct: 380 PSPLLPPPPPPAYPGPLPPVYPVPYASPPPPP 411 >03_05_0704 - 26953474-26953643,26953770-26953801,26953915-26954009, 26954107-26954180,26954283-26954412,26954522-26954585, 26954660-26954722,26954795-26954937,26955386-26955523, 26955610-26955731,26955805-26955976,26956559-26956630, 26956753-26956887,26956987-26957103,26957184-26957316, 26957455-26957561,26958060-26958077,26958235-26958379, 26958472-26958671,26960744-26961421 Length = 935 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/33 (51%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G GG GG GG G GGG G+G Sbjct: 5 GGGGGGRRGGRGGGGGREGGGGGGGGGGRGGQG 37 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G G G GG Sbjct: 20 GREGGGGGGGGGGRGGQGRGDLGVVGERQGGGRGAGERGG 59 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG GG G G GGG GRG G Sbjct: 7 GGGGRRGGRGGGGGREGGGGGGGGGGRGGQG 37 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -1 Query: 882 RGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 RGG G G G G GGG GG G G Sbjct: 4 RGGGGGGRRGGRGGGGGREGGGGGGGGGGRG 34 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXG-GXXXXGGG*XAGXXXXRXXTXXG 752 GGGG EGG GGGG G GGG AG R G Sbjct: 16 GGGGGREGGGGGGGGGGRGGQGRGDLGVVGERQGGGRGAGERGGRHDAPRG 66 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G GG GGG Sbjct: 6 GGGGGRRGGRGGGGGREG--------GGGGGGGGG 32 >02_05_0149 + 26290236-26290880 Length = 214 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG GG G GG G G GG Sbjct: 100 GEGGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGG 142 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG GGG G GG Sbjct: 132 GGGGGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGG 171 Score = 35.1 bits (77), Expect = 0.077 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GGG G GG GG G G GG G GG Sbjct: 129 GFGGGGGGGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGG 170 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG GG G G GGG G GG Sbjct: 96 GGSRGEGGGGGGGGGGGSGRAYGFGGGYGGHPGGFGG 132 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG G G G G GGG GG G GR G Sbjct: 104 GGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGGGRNYGGGSG 150 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G G GG GG G GGG G GG Sbjct: 85 GGKGSGFGFGYGGSRGEGGGGGG--GGGGGSGRAYGFGGG 122 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G GG G G GG G G GGG G G G Sbjct: 146 GGGSGGIGGYGNYG-GGYNGEPGGGGGGAGEGGGYGG 181 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG EGG GGGG G GG GG G Sbjct: 96 GGSRGEGGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGG 133 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/50 (44%), Positives = 22/50 (44%), Gaps = 10/50 (20%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-----GGXGGXXGGXX-----GXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG GR GG Sbjct: 102 GGGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGGGGG---GRNYGGG 148 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGG---XGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GG GGAG+ G Sbjct: 136 GGGGGGGRNYGGGSGGIGGYGNYGGGYNGEPGGGGGGAGEGG 177 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG GG G G RG G Sbjct: 164 GEPGGGGGGAGEG-GGYGGDYGG--GDVGANWSKRGSFRG 200 >01_06_1758 - 39681942-39682030,39682115-39682345,39682643-39682679, 39683604-39683835,39683937-39684022,39684126-39684218, 39684302-39684465,39684541-39684702,39684783-39684962, 39685079-39685515,39685614-39685669 Length = 588 Score = 38.7 bits (86), Expect = 0.006 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 GGG GGG G GG GG G GGG GR Sbjct: 66 GGGAGGGGWGRGGGGGGGAGGYRGGGGRGGGR 97 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G G GG G G G GGG Sbjct: 67 GGAGGGGWGRGGGGGGGAGGYRGGGGRGGG 96 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG G G GG GG G GGG G G Sbjct: 54 GGDFSRFGGRGRGGGAGGGGWGRGGGGGGGAG 85 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG RGG GG G GG GG G G Sbjct: 61 GGRGRGGGAGGGGWGRGGGGGGGAGGYRGGGGRGG 95 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 896 GGGXXG--GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GG G G GG GG G GG G G Sbjct: 62 GRGRGGGAGGGGWGRGGGGGGGAGGYRGGGGRGGG 96 >01_01_0036 + 278982-279494 Length = 170 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G GRG Sbjct: 70 GGEGGGGGGGGEG-GGEDGRDGGREGSGDGGGEGRG 104 >12_02_1177 - 26708215-26708309,26708355-26708392,26708476-26709563, 26709826-26709945,26710018-26710098,26710696-26710812, 26711122-26711904 Length = 773 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG GG G G GGG GR GG Sbjct: 6 GPRYGGGGGGGGGGGGGAGQSGDGGGSRGGRRGGGG 41 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXGXGGG 816 G GGG GGG G G GG GG G GGG Sbjct: 12 GGGGGGGGGGGAGQSGDGGGSRGGRRGGGGG 42 >12_01_0840 - 7847239-7847531,7847576-7847675,7848312-7848388, 7848486-7848738 Length = 240 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G GG G G GG Sbjct: 176 GGGVCGGSYGQGGGGGGGGGGQG-GGAHARGYGQGGG 211 Score = 37.5 bits (83), Expect = 0.015 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 6/43 (13%) Frame = -2 Query: 896 GGGXXGGGXGXG------GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G GG GG G GGG G G G Sbjct: 189 GGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGGSSSGSGYGSG 231 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G GG G GGG G G GG Sbjct: 182 GSYGQGGGGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGG 221 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G G GGG G GG GG G G G G G G+ GG Sbjct: 144 GYGQGGGGGGGGGQGGGNGSGYGSGYGSGYGQGGGVCGG 182 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG +GG G GG G G G G GG G G Sbjct: 178 GVCGGSYGQGGGGGGGGGGQGGGAHARGYGQGGGGGGGG 216 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GGG G GG Sbjct: 150 GGGGGGGQGGGNG-SGYGSGYGSGYGQGGGVCGGSYGQGG 188 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G G GG G G GG Sbjct: 32 GGGGGGEGGGGGGGEGGGGGSGYGSGYGG 60 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG G G G G G Sbjct: 205 GYGQGGGGGGGGGQGGGSSSGSGYGSGYGGGAG 237 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG G G G G Sbjct: 31 GGGGGGGEGGG-GGGGEGGGGGSGYGSGYG 59 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXXGGGXGXGGX----GGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G GG G GGG G G Sbjct: 187 GGGGGGGGGGQGGGAHARGYGQGGGGGGGGGQGGGSSSGSG 227 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G GG GG G GGG G G G Sbjct: 32 GGGGGGEGGGG--GGGEGGGGGSGYGSGYGG 60 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGG------GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG GG G GGG G G GG Sbjct: 154 GGGQGGGNGSGYGSGYGSGYGQGGGVCGGSYGQGGGGGGGGGGQGG 199 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG G G GGG Sbjct: 207 GQGGGGGGGGGQG-GGSSSGSGYGSGYGGG 235 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GG GG G GG G GGG G G Sbjct: 170 GSGYGQGGGVCGGSYGQGGGGGGGGGGQGGGAHARG 205 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPP 894 PP +P P PPP P PP PP P P P PP Sbjct: 227 PPVLPLPLLNPPPPPPPPPSLLPPVPLLPPLIPGVPP 263 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP I P PPP PP P P PPP PP P Sbjct: 206 TPSPPSILPPLTPQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLP 249 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXX---PPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PP P PP PP PP PP PP P Sbjct: 214 PPLTPQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLPPVPLLPPLIP 259 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPX-IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP +P P P PP P PP PP P P Sbjct: 193 TPAPPSLVPPVFPTPSPPSILPPLTPQPPPSSLIPPVLPLP 233 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP P S PP P Sbjct: 220 PPPSSLIPPVLPLPLLNPPPPPPPP-P-SLLPPVP 252 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP PP PP Sbjct: 186 PIPPNPITPAPPSLVPPVFPTPSPPSILPPLTPQPP 221 >04_01_0034 - 401208-402923 Length = 571 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIP-RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P +P PPP P P P P PPP PPP Sbjct: 297 PRLPLQPRPAPPPPPPQQQRAKPSRPPPPPPPLDPPP 333 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PR P P P PP PPP PP P Sbjct: 294 PHAPRLPLQPRPAPPPPPPQQQRAKPSRPPPPPPPLDPP 332 >03_05_0267 - 22538631-22539452 Length = 273 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G GG G G GGG G G G Sbjct: 117 GDSGGGGLGDGGGGGLGGGGSSGGEGSGGGSSDGEGCGDG 156 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G G G G G GG Sbjct: 125 GDGGGGGLGGGGSSGGEGSGGGSSDGEGCGDGSGGGELGG 164 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG G GG G G Sbjct: 130 GGLGGGGSSGGEGSGGGSSDGEGCGDGSGGGELGGG 165 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG GG GG G GGG GRG G Sbjct: 144 GQSQGGGRG-GGRGGGRGGFRGRGGGGFRGRGAPRG 178 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G GGG GRG GG Sbjct: 7 GGGGRFGGGGGGRFGGGGGRGGRFGGGGRGGRGGGGG 43 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGG 819 G GGG GGG G GG GG GG G GG Sbjct: 13 GGGGGGRFGGGGGRGGRFGGGGRGGRGGGGG 43 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G GG G G GGG Sbjct: 14 GGGGGRFGGGGGRGGRFGGGGRGGRGGGGG 43 >10_08_0221 - 15980370-15980927 Length = 185 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 100 GPYGGGYAQGGGGGQGGGGGQNGG-SGYGSGSGSGYGQAGG 139 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG GG GG GG G GG G G G Sbjct: 94 GQAGGYGPYGGGYAQGG-GGGQGGGGGQNGGSGYGSGSGSG 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G G G Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASG 61 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG G G G G G G Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASG 61 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G Sbjct: 31 GGGGGGGGGGGSNGGSGWGSGSGSGYGQASGDG 63 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG GG G G G G G Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASGDG 63 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G G G G G G GG Sbjct: 63 GSYASGDGGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGG 104 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GGG G GG Sbjct: 113 GQGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGYAQAGGQGGG 156 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG G G G G G G+ G Sbjct: 32 GGGGGGGGGGSNGGSGWGSGSGSGYGQASGDG 63 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G GG Sbjct: 35 GGGGGGGSNGGSGWGSGSGSGYGQASGDGSYASGDGGGGG 74 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRG 798 G GGG GG G G G G G GG GGG G G Sbjct: 72 GGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGYAQGGG 111 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GG G G GG GGG Sbjct: 71 GGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGG 105 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGX--XGXGGGXXXGRGIXGG 786 G G G G G G G GG G GGG G G GG Sbjct: 82 GSGYGSGSGSGYGQAGGYGPYGGGYAQGGGGGQGGGGGQNGG 123 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G G G G G GG G G Sbjct: 109 GGGGGQGGGGGQNGGSGYGSGSGSGYGQAGGYGPYG 144 >10_08_0220 - 15977247-15977804 Length = 185 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 100 GPYGGGYAQGGGGGQGGGGGQNGG-SGYGSGSGSGYGQAGG 139 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG GG G GG G G G Sbjct: 98 GSGPYGGGYAQGGGGGQ-GGGGGQNGGSGYGSGSGSG 133 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG G G G G G G GG Sbjct: 60 GGDGSYASGGGEG-GGGGGGENGGSGYGSGSGSGYGQAGG 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 68 GGGEGGGGGGGENGGSGYGSGSGSGYGQAGGSGPYGG 104 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG G G G G G GG Sbjct: 30 GGGGSGEGGGGGSDGGSGWGSGSGSGYGQAGGDGSYASGG 69 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG--XXGXGGGXXXGRGIXGG 786 G G G G G G G GG G GGG G G GG Sbjct: 82 GSGYGSGSGSGYGQAGGSGPYGGGYAQGGGGGQGGGGGQNGG 123 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GGG G GG Sbjct: 113 GQGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGYAQAGGQGGG 156 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G GG Sbjct: 72 GGGGGGGENGGSGYGSGSGSGYGQAGGSGPYGGGYAQGGG 111 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-----GXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG GG G G G G G GG GG G G G Sbjct: 35 GEGGGGGSDGGSGWGSGSGSGYGQAGGDGSYASGGGEGGGGGGGENGGSGYG 86 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G G G G G GG G G Sbjct: 109 GGGGGQGGGGGQNGGSGYGSGSGSGYGQAGGYGPYG 144 >09_05_0008 + 20042390-20042845,20043323-20043457,20043539-20043679, 20043771-20043882,20044084-20044154,20044251-20044405, 20044484-20044595,20044932-20045033,20045116-20045176, 20045251-20045422,20045512-20045608,20045692-20045786, 20045881-20046014,20046208-20046422 Length = 685 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G GGG G GG GG GG G GGG GRG GG K Sbjct: 641 GSRGGGRFGNRRFSGGGGGRGGGGRGFGGG--RGRGGGGGNRFNK 683 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G G GG G G G GRG GG Sbjct: 640 GGSRGGGRFGNRRFSGGGGGRGGGGRGFGGGRGRGGG 676 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P P PP PP PPP P Sbjct: 584 VPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX----PPXPPXPXPPPXXPPPXXP 906 PP IP+ P P PP PP P P P P PP P Sbjct: 560 PPPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPP 603 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P P P PP P P PPP P Sbjct: 585 PPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 PP P+ PPP P PP PP P P PPP P Sbjct: 591 PPPAPK-AAPPPPPPKSTGPGPPRPPPPAMPGSSKTRPPPPLKP 633 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+ P PP P PP P P PPP Sbjct: 569 PPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPP 604 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +1 Query: 802 RPXXXPPPXP--XXPP----XXPPXPPXPXPPPXXPPPXXP 906 +P PPP P PP PP P PPP PP P Sbjct: 555 QPPVMPPPIPKLLSPPAPQAPMPPLKASPVPPPEPSPPPAP 595 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P P P PP P PPPP Sbjct: 564 PKLLSPPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPP 602 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P P P P PPP PPP P Sbjct: 228 PLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGPP 261 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPP 894 P +P P PPP P P P PP P PPP PP Sbjct: 227 PPLP-PPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP PRP P P P P PP P PP PP P Sbjct: 358 PPLPPRPPTMPSMQPDMLAPGVPRFPPPPPPPDTRPPFMAP 398 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPP 894 P +PR PPP PP P P P PPP PP Sbjct: 377 PGVPRFPPPPPPPDTRPPFMAPGVNARPLPPPPPGLPP 414 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX---PXPPPXXPPPXXP 906 PPP P PP P P PPP PPP P Sbjct: 406 PPPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYP 438 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PP P P P PP PPP P Sbjct: 200 PSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKP 239 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 14/54 (25%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX---PPXXPPXPPXPXP-----------PPXXPPPXXP 906 PP P P P P PP PP PP P P PP PPP P Sbjct: 207 PPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGP 260 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PP PP P PPP PP PPP Sbjct: 230 PPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPPP 897 P P P PP P PP PP PPP P P Sbjct: 404 PLPPPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYPGP 440 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 P +P P PPP P PP P PPP P P P Sbjct: 246 PGLPLPP--PPPPPPGPPPREIVPGQTLLPPPPPPRPLQP 283 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P+ PPP P P PP PP PPP Sbjct: 200 PSTLPPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPP 237 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 796 IPRPXXXP---PPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 +P P P PP P PP P P P P PPP P Sbjct: 347 LPLPPPQPSHLPPLPPRPPTMPSMQPDMLAPGVPRFPPPPPP 388 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-----PXXPPXXPPXPPXPXPPP 882 PP P P P P P P PP PP P PPP Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPPPP-PGPPP 262 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P P PP PP PP P P P Sbjct: 235 PPPKPANIAGAPGLPLPPP--PPPPPGPPPREIVP 267 >05_04_0303 - 20010761-20011756 Length = 331 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G + GG Sbjct: 46 GGGGGGVGGGVVGGDGVGGGGGGGGGGGGGVGAGE-MNGG 84 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GG G GG Sbjct: 55 GVVGGDGVGGGGGGGGGGGGGVGAGEMNGGASSAAGSSGG 94 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G G G GG Sbjct: 61 GVGGGGGGGGGGGGGVGAGEMNGGASSAAGSSGGGGGGGGG 101 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG GG GG G G GGG GAG+ S G Sbjct: 47 GGGGGVGGGVVGGDGVGGGGGGGGGGGGGVGAGEMNGGASSAAG 90 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG G GG GG Sbjct: 59 GDGVGGGGGGGGGGGGGVGAGEMNGGASSAAGSSGGG 95 >04_04_0679 + 27214577-27215023 Length = 148 Score = 37.9 bits (84), Expect = 0.011 Identities = 19/37 (51%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG G G G G G G+G G Sbjct: 71 GGGGGGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGG 107 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G GG G G G G G G G Sbjct: 71 GGGGGGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGGWG 109 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG G GG Sbjct: 111 GAGAFGGGSGSGGGGGGWSARGGFHGG 137 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXG---GXXGGXXGXGGG 816 G GGG GG G GG G G GG G GGG Sbjct: 91 GGHGGGFGWAGGQGHGGWGAGAGAFGGGSGSGGG 124 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG G G G GG G G GGG RG Sbjct: 98 GWAGGQGHGGWGAGAGAFGGGSGS--GGGGGGWSARG 132 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GG G GG G G AG Sbjct: 75 GGGGGGVGGRGGSSGRGGHGGGFGWAGGQGHGGWGAGAG 113 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GGG G G G Sbjct: 92 GHGGGFGWAGGQGHGGWGAGAGAF---GGGSGSGGGGGG 127 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P P PP P PP PPP Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPPPP 41 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 +PPP PP P PPP PPS PPPP Sbjct: 8 WPPPTPSPPPFSSR----PRVVGPPPPPPSDPPPPP 39 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXX--PPXPPXPXPPPXXPPPXXP 906 PPP P PP P P PPP PPP P Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPPP 40 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T PP P P PP PP P P PPP Sbjct: 7 TWPPPTPSPPPFSSRPRVVGPPPPPPSDPPPPPPP 41 Score = 31.9 bits (69), Expect = 0.72 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 17/60 (28%) Frame = +1 Query: 778 TXXPPXI---PRPXXXPPPXPXXPPXXPPX--------------PPXPXPPPXXPPPXXP 906 T PP PR PPP P PP PP P P P P PPP P Sbjct: 12 TPSPPPFSSRPRVVGPPPPPPSDPPPPPPPHHHHHHRRRHRHSKKPKPQPQPQPPPPPLP 71 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP PP P PPP PPP P Sbjct: 27 PPPPPHPPP-PPPLEPAPPSTPQLRGEASPPPPPPPPVGP 65 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 7/40 (17%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP-------PXPXPPPXXPPP 897 P P PPP P P P P P P PPP PP Sbjct: 27 PPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP P PPPP PP PP Sbjct: 30 PPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 37.5 bits (83), Expect = 0.015 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +1 Query: 817 PPPXPXXPPXXP-PXPPXPXPPPXXPP 894 PPP P PP P PP P PPP PP Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPPPPQPP 74 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P PP PP PPP PPP P Sbjct: 43 PRFAPPPPQ---PTLPPPPPRTLPPPPPPPPPQP 73 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P+P PPP PP PP PP P PP Sbjct: 47 PPPPQPTLPPPPPRTLPP--PPPPPPPQPP 74 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG G G G GGG G Sbjct: 293 GAEGGGGGGGGGGGGGHGAPELGFSGGGGGGGGG 326 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG G G GGG G G+ GG Sbjct: 175 GGGGGGGPGRAPGGGGGGGGPGRAPGGGGG---GGGLGGG 211 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GG G GG Sbjct: 188 GGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGGGG 227 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG--RGIXGG 786 GGG GGG G GG GG G GGG R I GG Sbjct: 187 GGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPERVIGGG 225 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -1 Query: 906 GXXGGGXXR---GGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG R GG G GG G G GGG GG G+ G Sbjct: 176 GGGGGGPGRAPGGGGGGGGPGRAPGGGGG-GGGLGGGGGEGG 216 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GG G G GG GG G G GGG GR GG Sbjct: 162 GGGRGGALGRPPGGGGGGGGPGRAPGGGGGGGGPGRAPGGG 202 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG G G GGG Sbjct: 201 GGGGGGGLGGGGGEGGAPERVIGGGGGGGG 230 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG GG G GGG R + GG Sbjct: 111 GGGGGGPPSLPPGAGGGGGARPPAPGGGGGGGAPRRVLGG 150 Score = 31.5 bits (68), Expect = 0.95 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG----RGIXGG 786 G GGG GGG G GG G GGG G RG GG Sbjct: 297 GGGGGGGGGGGGHGAPELGFSGGGGGGGGGEIAGTVDLRGGGGG 340 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG G GGG G G Sbjct: 278 GGGGGGGALENAREDGAEGGGGGGGGGGGGGHG 310 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG GG G GG G G Sbjct: 293 GAEGGGGGGGGGGGGGHGAPELGFSGGGGGGGG 325 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GG Sbjct: 202 GGGGGGLGGGGGEGGAPERVIGGGGGGGGALKCVVGGGGG 241 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GGGG GGGG G GG GGG G R Sbjct: 177 GGGGGPGRAPGGGGGGGGPGRAPGGGGGGGGLGGGGGEGGAPER 220 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG---GXXGXGGGXXXGRGIXGG 786 G GGG G GG GG G G GGG +G GG Sbjct: 239 GGGGGGALKRAAGSGGGGGALECEIGGGGGGGGTDRNKGGGGG 281 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR-GIXGG 786 G GGG G GG GG G GGG G GG Sbjct: 279 GGGGGGALENAREDGAEGGGGGGGGGGGGGHGAPELGFSGG 319 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXXGGGXGX---GGXGGXXGGXXGXGGGX-XXGRGIXGG 786 GGG GG GG GG G G GGG GR GG Sbjct: 149 GGGGGGGALARPPGGGRGGALGRPPGGGGGGGGPGRAPGGG 189 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG + GG Sbjct: 315 GFSGGGGGGGGGEIAGTVDLRGGGGGAGGVFPPTPDLGGG 354 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG G GG G G Sbjct: 196 GRAPGG-GGGGGGLGGGGGEGGAPERVIGGGGGGGG 230 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGA 802 GGG GG G GG GGG GGA Sbjct: 200 GGGGGGGGLGGGGGEGGAPERVIGGGGGGGGA 231 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = -2 Query: 905 GXXGGGXX-----GGGXGXGGXGGXXGGXXGXGGGXXXGR--GIXGG 786 G GGG GGG G GG GG G GG R G GG Sbjct: 251 GSGGGGGALECEIGGGGGGGGTDRNKGGGGGGGGALENAREDGAEGG 297 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXR--GGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG R GG G GG GG GG G G Sbjct: 266 GGGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGGGGGG 306 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG + GGGG G G GGG G Sbjct: 267 GGGGGTDRNKGGGGGGGGALENAREDGAEGGGGGGGGGG 305 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG G GGG GRG Sbjct: 53 GGRGGG-YGGGGGGGGPPYYGGGGGGGGGGGGQGRG 87 Score = 32.7 bits (71), Expect = 0.41 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G GG G G GRG GG Sbjct: 101 GMEGGGGRGGYRGDGDGGYGRGGGGYHGDGE-RGYGRGGGGG 141 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G G G GGG GG G G Sbjct: 113 GDGDGGYGRGGGGYHGDG-ERGYGRGGGGGGGGGGGYRG 150 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Frame = -2 Query: 905 GXXGGGXXGG----GXGXGGXGGXXGGXXG----XGGGXXXGRGIXGG 786 G GGG GG G G GG GG G G G G RG+ GG Sbjct: 58 GYGGGGGGGGPPYYGGGGGGGGGGGGQGRGYYDDGGDGRGYQRGMEGG 105 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGDXGR 787 G G GG G G G G G GGG GG G G+ Sbjct: 44 GRGQDGSYPGGRGGGYGGGGGGGGPPYYGGGGGGGGGGGGQ 84 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG RG GG G GGG G GD Sbjct: 78 GGGGGGQGRGYYDDGGDGRGYQRGMEGGGGRGGYRGD 114 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GGG G G G G GGG RG Sbjct: 115 GDGGYGRGGGGYHGDGERGYGRGGGGGGGGGGGYRG 150 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG G GGG G G G Sbjct: 142 GGGGGGYRGDDEGRSSYGRARGG--GGGGGGYHGDGEAG 178 >06_02_0122 - 12095385-12095713,12096018-12096120 Length = 143 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G G GG GG GG G GGG G G G Sbjct: 105 GGGYGGSGGGYGGGYGGGYGGGYGGGGGYGGGYGGGG 141 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G GG G G GGG G G Sbjct: 93 GGGYGGGYGRGYGGGYGGSGGGYGGGYGGGYG 124 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G G G GGG G G G Sbjct: 56 GGYYPGGGYGYGGGYGGEYGRPGYGGGYGGGYGHPG 91 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXX---GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GGG G G GG Sbjct: 94 GGYGGGYGRGYGGGYGGSGGGYGGGYGGGYGGGYGGGGGYGGG 136 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G G G GG G GGG G G Sbjct: 85 GGYGHPGYGGGYGGGYGRGYGGGYGGSGGGYGGGYG 120 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGG 819 G GG GGG G G G GG GG G GG Sbjct: 112 GGGYGGGYGGGYGGGYGGGGGYGGGYGGGG 141 >06_01_0760 - 5676973-5677830 Length = 285 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG GG G G G G G G GG Sbjct: 65 GGAYASGGGGGGGGGGGQNGGSGYGSGSGSGYGQAGG 101 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G GG GG G GG G G G Sbjct: 97 GQAGGYGPYGGGAYAQGEGGGGGGGGGQNGGSGYGSGFGSG 137 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG G G G G G G G G GG Sbjct: 103 GPYGGGAYAQGEGGGGGGGGGQNGGSGYGSGFGSGYGQAGG 143 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G G G Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQSSG 63 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G G Sbjct: 33 GGGGGGGGGGGSGNGSGWGSGSGSGYGQSSGSG 65 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G G GG G G GG Sbjct: 37 GGGGGGGSGNGSGWGSGSGSGYGQSSGSGGAYASGGGGGGG 77 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G GG Sbjct: 71 GGGGGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGG 107 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G G G G G G G Sbjct: 32 GGGGGGGGGGGGSGNGSGWGSGSGSGYGQSSGSGG 66 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG G GG Sbjct: 156 GGQGGGGGGGQNGGSGSGSGSGSGYGQAGGYGPYYGPYGG 195 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G G G G G G G GG Sbjct: 115 GGGGGGGGGQNGGSG--YGSGFGSGYGQAGGYGPYGG 149 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG G G G G G G+ G Sbjct: 34 GGGGGGGGGGSGNGSGWGSGSGSGYGQSSGSG 65 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GG G G G G G G G GG +G GG Sbjct: 75 GGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGGAYAQGEGGG 117 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G Sbjct: 155 GGGQGGGGGGGQNGGSGSGSGSGSGYGQAGGYG 187 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G Sbjct: 202 GGGQGGGGGGGQNGGSGQGSGSGSGYGQAGGYG 234 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G G G G G GG Sbjct: 203 GGQGGGGGGGQNGGSGQGSGSGSGYGQAGG 232 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GG GG G GG G G G Sbjct: 59 GQSSGSGGAYASGGGGGGGGGGGQNGGSGYGSGSGSG 95 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GG G G GG GGG Sbjct: 74 GGGGGGGGQNGGSGYGSGSGSGYGQAGGYGPYGGG 108 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G G G G G G G G G GGG G G GG Sbjct: 45 GNGSGWGSGSGSGYGQSSGSGGAYASGGGGGGGGGGGQNGG 85 >03_05_0688 + 26762668-26762893,26763027-26763101,26763865-26764032, 26764983-26765114,26765538-26765677,26765840-26765908, 26766325-26766435,26766854-26766973,26768223-26768324, 26769608-26769778,26769865-26769944,26770119-26770182 Length = 485 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GGG G GG G G GGG GR Sbjct: 11 GRDGGGGGGGGGGGGGGGVDPAGGGSGGGGPGMGR 45 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -1 Query: 891 GXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG G GG G G GGG GG GR S G Sbjct: 11 GRDGGGGGGGGGGGGGGGVDPAGGGSGGGGPGMGRRGSDARG 52 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G G GGG G GG GG G GG G G+ Sbjct: 7 GRHRGRDGGGGGGGGGGGGGGGVDPAGGGSGGGGPGM 43 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG GG G G RG Sbjct: 17 GGGGGGGGGGGGVDPAGGGSGGGGPGMGRRGSDARG 52 >03_05_0252 - 22403504-22404676 Length = 390 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GGG GG G GG GG GGG GR + Sbjct: 13 GRVGGGGGGGAGGGGGGGGGGAAAAAAGGGGDFGRAV 49 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG GG GG G GGG GG Sbjct: 7 GGGGRAGRVGGGGGGGAGGGGGGGGGGAAAAAAGGGG 43 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G GGG GG Sbjct: 6 GGGGGRAGRVGGGGGGGAGGGGGGGGGGAAAAAAGGG 42 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G GG G GG G GG G G Sbjct: 5 GGGGGGRAGRVGGGGGGGAGGGGGGGGGGAAAAAAGGGG 43 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G GGG GG Sbjct: 5 GGGGGGRAGRVGGGGGGGAGGGGGGGGGGAAAAAAGG 41 >12_02_0687 + 22123216-22123760,22125021-22125330 Length = 284 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G GG GG G G GG Sbjct: 32 GGGGGGYDGGGDGEGGGGGDGEGGGGGGG 60 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG GG G GG G GGG G Sbjct: 30 GGGGGGGGYDGGGDGEGGGGGDGEGGGGGGG 60 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -2 Query: 869 GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG G GGG G G GG Sbjct: 31 GGGGGGGYDGGGDGEGGGGGDGEGGGGG 58 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG G G G GGG G G GG Sbjct: 30 GGGGGGGGYDGGGDGEGG-GGGDGEGGGGGGG 60 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGA 802 G GGG GG GG G G GGG GGA Sbjct: 30 GGGGGG---GGYDGGGDGEGGGGGDGEGGGGGGGA 61 >06_03_1370 + 29645598-29646288,29646364-29646752 Length = 359 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG G GG G Sbjct: 8 GGGGGGGGGGGVG-GGGGGGRGGERGGGGDHAIG 40 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAGD 796 G RGG G GG G G G GG GG GD Sbjct: 3 GFSLRGGGGGGGGGGGVGGGGGGGRGGERGGGGD 36 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 875 GXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GG GG G GGG GRG Sbjct: 3 GFSLRGGGGGGGGGGGVGGGGGGGRG 28 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P P PP P PPP PPP Sbjct: 51 PADTTPTSPPPASPPLPSATPPLAASPPPPPPPPPP 86 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 778 TXXPPXIPR-PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 T PP P P PP PP PP PP P P PP Sbjct: 57 TSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPP 96 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 P P P P P P P PP P PPP P P P Sbjct: 56 PTSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKP 95 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP PP PP PPP P Sbjct: 47 PNATPADTTPTSPPPASPPLPSATPPLAASPPPPPPPPPP 86 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 T PP P P PPP P P P P P PP P Sbjct: 110 TTTPPTAPVPAAAPPPTAPSPYSAPSPTPTPTHTQPRPSPPLLP 153 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PPP P PP PP PP Sbjct: 71 PPLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPP 106 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P P PPPP PP P PP Sbjct: 56 PTSPPPASPPLPSATPPLAASPPPPPPPP-PPRNSPSPP 93 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P PP P Sbjct: 78 PPPPPPPPPRNSPSPPKPPSQAAQSPLPPTTTTTTPPTAP 117 >04_04_1125 + 31085106-31085714 Length = 202 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 P P P PP P P P PP P PPP P P P Sbjct: 35 PTTKPPPPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTP 75 Score = 36.7 bits (81), Expect = 0.025 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXP---XPPPXXPPP 897 PP P P PP P PP P PP P P P PPP Sbjct: 47 PPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPP 87 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +3 Query: 735 LSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 LS+ P P PPP PP P P P PP P PP Sbjct: 18 LSAQLAPAAATWCGSNCPTTKPPPPPCQPPPPTPTPATPTTPPTPWTPPPATPTPP 73 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP P P PP P P P PP P Sbjct: 36 TTKPP--PPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTP 77 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP P P P P P Sbjct: 42 PPCQPPPPTPTPATPTTPPT-PWTPPPATPTPPTPTPWTP 80 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXX-PPPXXP 906 PP P P P P P PP P P P PP P P P Sbjct: 66 PPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTPAPAPSTP 108 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T P P PPP PP P P P PP P Sbjct: 52 TPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTP 89 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P P P PP P P P P P Sbjct: 77 PWTPTPAT-PPPTPATPAT-PTTPPTPAPAPSTPTGKCP 113 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P P P PPP P P Sbjct: 56 PTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATP 95 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P P+ PP Sbjct: 65 PPPATPTPPTPTPWTPTPATPPPTPATPATPTTPP 99 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP----XXPPXXPPXPPXPXPPPXXPPP 897 T P P P PP P P PP P P P P P Sbjct: 58 TPPTPWTPPPATPTPPTPTPWTPTPATPPPTPATPATPTTPPTP 101 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP PP P P PPP PPP Sbjct: 39 PPPARHRAPSPPRPPPPPPPPTQPAPPP--PPP 69 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP PP PP P PPP P P P Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPP 67 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP R PP P PP P P P PPP Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPPPP 69 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P PP P PP PP P Sbjct: 39 PPPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PPPP PP P PP Sbjct: 33 PIWSAPPPPARHRAPSPPRPPPPPPPPTQPAPP 65 >02_05_0157 - 26353971-26354336,26354645-26354726,26354838-26354933, 26355365-26356068 Length = 415 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G GG G G GGG G+ GG Sbjct: 145 GGGVVGAGGGVVGAGGGVVGAGGAGGGVVGDGGVGGG 181 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 896 GGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G GG GG G GGG G G Sbjct: 74 GGGVAGGGGVAGGGARGGDGGGVAGAGGGVAGGDG 108 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG G G G GG GG G GGG G G Sbjct: 101 GGVAGGDGGGVAGAGGGCDGGDGGGVVGAGGGVAGGDG 138 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G G G GG GG G GGG G G Sbjct: 90 GGDGGGVAGAGGGVA--GGDGGGVAGAGGGCDGGDG 123 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G GG G GG Sbjct: 80 GGGVAGGGARGGDGGGVAGAGGGVAGGDGGGVAGAGG 116 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GGG G GG Sbjct: 131 GGVAGGDGGGVVGAGGGVVGAGGGVVGAGGGVVGAGGAGGG 171 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXG 789 G GGG G G G GG GG G GGG G G+ G Sbjct: 120 GGDGGGVVGAGGGVA--GGDGGGVVGAGGGVVGAGGGVVG 157 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GG RGG G G G G GGG G G Sbjct: 81 GGVAGGGARGGDGGGVAGAGGGVAGGDGGGVAGAGG 116 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G G GGG GG G G GGG G G+ GG Sbjct: 66 GVGAGASAGGGVAGGGGVAGGGARGGDGGGVAGAGGGVAGG 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 G GG +GG GGG G GG GGG Sbjct: 113 GAGGGCDGGDGGGVVGAGGGVAGGDGGGVVGAGGG 147 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGG G GG GGG G Sbjct: 98 GAGGGVAGGDGGGVAGAGGGCDGGDGGGVVGAGGGVAGG 136 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +P PPP P P PP PP PP PP Sbjct: 353 QPPAPPPPPPFAPTLPPPPPPRRKPPSPSPP 383 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 796 IPR-PXXXPPPXPXXPPXXPPXPPXPXPPP 882 IPR P PPP P PP PP P PPP Sbjct: 404 IPRNPFVQPPPPPTHTHGPPPPPPPPPPPP 433 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P PP PP PP PP P Sbjct: 357 PPPPPPFAPTLPPPPPPRRKPPSPSPPSSP 386 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPP--XPPXPXPP 879 P P PP P PP PP PP P PP Sbjct: 355 PAPPPPPPFAPTLPPPPPPRRKPPSPSPP 383 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PPP PPP P Sbjct: 405 PRNPFVQPPPPPTHTHGPPPPPPPPPPPP 433 >01_06_0146 + 26969011-26969995,26970878-26970930 Length = 345 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P+P PPP P PP PP P PP P P P Sbjct: 97 PQPRAAPPPAPAPDQPAPPSPP-PSLPPSPPAPGSP 131 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P PP P P P PP PP P Sbjct: 88 PPLPHDNRTPQPRAAPPPAPAPDQPAPPSPPPSLPPSPP 126 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 PP P P PPP P PP P P P P P Sbjct: 24 PPPTPHPATDPPPISPQNPTPPPPPLPASAAAPTTPSP 61 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 RP P P PP P PP P P P PP P Sbjct: 69 RPIPSQAPAPPPPPTADPSPPLPHDNRTPQPRAAPPPAP 107 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PP PPP P Sbjct: 86 PSPPLPHDNRTPQPRAAPPPAPAPDQPAPP--SPPPSLP 122 >06_02_0125 + 12122812-12122911,12123647-12123993 Length = 148 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GG G G GG GG G GGG G Sbjct: 113 GGYGGGYGGGYGGGYGGGGGYGGGGGYGGGHGGG 146 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXG---GXXGXGGGXXXGRG 798 GGG GGG G G GG G G G GGG G G Sbjct: 64 GGGYGGGGYGHPGYGGGYGGGYGHPGYGGGYGGGYG 99 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXG 789 GG GGG G GG G G G G GGG G G G Sbjct: 54 GGAHGGGYGYGGGYGGGGYGHPGYGGGYGGGYGHPG 89 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/32 (56%), Positives = 18/32 (56%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG GG GG G GGG G G Sbjct: 116 GGGYGGGYG-GGYGG--GGGYGGGGGYGGGHG 144 Score = 33.1 bits (72), Expect = 0.31 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXG--GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G GG G G G G GG Sbjct: 55 GAHGGGYGYGGGYGGGGYGHPGYGGGYGGGYGHPGYGGGYGGG 97 >05_06_0078 - 25412770-25413852 Length = 360 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G G GGG G GG Sbjct: 286 GGGDAAGGEGGGAAGGGRDGITGGGGGGGSGAPRDGG 322 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G GG GG GG G G GG Sbjct: 264 GITGGGGGGDGVGRGATGGAGGGGGDAAGG--EGGGAAGG 301 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG GGG GRG GG Sbjct: 249 GGGGDEGGTGFTGFDGITGGG---GGGDGVGRGATGG 282 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G G G GGG G G G Sbjct: 228 GVGGGGGGISGGDGDGGCITGGGGGDEGGTGFTG 261 Score = 31.9 bits (69), Expect = 0.72 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G GG G GG G G G GGG G G G Sbjct: 206 GDGGGGFTGEGGDGVGGSTGIT-GVGGGGGGISGGDGDGG 244 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG G G GGG G G G Sbjct: 47 GRDGGATDGDGEGDGSREAGDGAGGDRAGGSGVGGGFVVGAGAASG 92 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG--XXGGXXG-XGGGXXXGRG 798 G GG GGG GG GG GG G GGG G G Sbjct: 278 GATGGAGGGGGDAAGGEGGGAAGGGRDGITGGGGGGGSG 316 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG GG G GG G G G G G Sbjct: 287 GGDAAGGEGGGAAGGGRDGITGGGGGGGSGAPRDGGNGG 325 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG G G GI GG Sbjct: 232 GGGGISGGDGDGGCITGGGGGDEGGTGFTGFDGITGG 268 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGX----GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G GG G GG Sbjct: 292 GGEGGGAAGGGRDGITGGGGGGGSGAPRDGGNGGAGAGVLALGG 335 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG GG GG G G G G GG Sbjct: 276 GRGATGGAGGGGGDAAGGEGGGAAGGGRDGITGGGGGGG 314 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-----GXGGXXGGXXG-XGGGXXXGRGIXGG 786 G GG GG G G G G GG G GGG G + GG Sbjct: 66 GDGAGGDRAGGSGVGGGFVVGAGAASGGWEGTVGGGAGEGGDVAGG 111 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G G GG G+ GG Sbjct: 194 GGSGFTGEGGGDGDGGGGFTGEGGDGVGGSTGI-TGVGGG 232 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG G GG GG G GGG Sbjct: 310 GGGGGSGAPRDGGNGGAGAGVLALGGG 336 >05_01_0521 + 4500268-4500283,4500364-4500680,4500999-4501094, 4501219-4501296,4501333-4501557,4502842-4502910, 4502946-4503200 Length = 351 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG G G GG GRG GG Sbjct: 12 GGGGRGDGGGRGGGGGRGFGRVGDSGG-RGGRGGRGG 47 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G GG G GRG GG Sbjct: 8 GFGRGGGGRGDGGGRGGGGGRGFGRVGDSGGRGGRGG 44 >04_03_0904 + 20717005-20718087 Length = 360 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 PP +P P P P PP P P P P P P P P Sbjct: 257 PPPTYKPQPKPTPTPYTPPTYKPQPKPTPTPTPYTPTP 294 Score = 36.3 bits (80), Expect = 0.033 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPPPXXP 906 P P P P P P PP P PP P P P PP P Sbjct: 222 PKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNPPPTYKP 263 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P PP P P P P PPP P P P Sbjct: 64 PPKEHKPPAYTPPKPTPTPPTYTPTPKPTPPPYTPKPTPP 103 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P P P P P P P P PP PP P Sbjct: 86 TPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTPPTYKP 128 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXPXPPPXXPPPXXP 906 PP +P P P P P PP P P P P P P P Sbjct: 154 PPPTYKPQPKPTPTPYTPTPTPPSYKPQPKPTPTPYTPTPTPP 196 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP P P P PP P P Sbjct: 53 PPHHHEPKPEKPPKEHKPPAYTPPKPTPTPPTYTPTP 89 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P PP P P P P P Sbjct: 83 PTYTPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPPKPTPP 124 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPP--XPXPPPXXPPPXXP 906 T P P P P P PP P P PP P PP P P P Sbjct: 74 TPPKPTPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPPTYTPTPTPP 119 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPP--XPXPPPXXPPPXXP 906 T PP P P P P P P P PP P P P PP P Sbjct: 115 TPTPPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPKPTPPPTYKP 160 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXI-PRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPP 897 T PP P+P PPP P P P P P PP P P Sbjct: 140 TPTPPTYKPQPKPTPPPTYKPQPKPTPTPYTPTPTPPSYKPQP 182 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPP-XPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P P PP PPP Sbjct: 314 PYKPQPKPTPSPYTPKPTPTPPTYTPTPTPPYHKPPP 350 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 715 TPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 TP Y P T P P P P P P P P P P P P Sbjct: 270 TPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPKPTPTPTPYKPQPKPTPSPYTPK 329 Query: 895 P 897 P Sbjct: 330 P 330 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P P P PP P P P P Sbjct: 275 PTYKPQPKPTPTPTPYTPTPKPNPPPTYKPQPKPTPTPTP 314 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P Sbjct: 144 PTYKPQPKPTPPPTYKPQPK-PTPTPYTPTPTPP 176 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P P P PP P Sbjct: 247 PTYKPQPKPNPPPTYKPQPK-PTPTPYTPPTYKP 279 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P PP P Sbjct: 265 PKPTPTPYTPPTYKPQPKPTPTPTPYTPTPKPNPPPTYKP 304 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXP----PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P PP P P P Sbjct: 300 PTYKPQPKPTPTPTPYKPQPKPTPSPYTPKPTPTPPTYTPTPTPP 344 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 T P P P P P PP P P P PPP P Sbjct: 207 TPYTPTPTPPSYKPQPKPNPPPTYKP-QPKPNPPPTYKP 244 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPX-PPX--PXPPPXX 888 PT Y P T PP +P P P P P PP P P P P Sbjct: 152 PTPPPTYKPQPKPTPTPYTPTPTPPSY-KPQPKPTPTPYTPTPTPPSYKPQPKPTPTPYT 210 Query: 889 PPPXXP 906 P P P Sbjct: 211 PTPTPP 216 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PP PPP P P Sbjct: 319 PKPTPSPYT-PKPTPTPPTYTPTPTPPYHKPPPSYTPGPPP 358 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ Y P PP P PPP P PPPP Sbjct: 323 PSPYTPKPTPTPPTYTPTPTPPYHKPPPSYTPG--PPPP 359 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPP--XPXPPPXXPPPXXP 906 T P P P P P P P P PP P P P PP P Sbjct: 187 TPYTPTPTPPSYKPQPKPTPTPYTPTPTPPSYKPQPKPNPPPTYKP 232 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 P P P P P P P PP P P P P P P P Sbjct: 253 PKPNPPPTYKPQPKPTPTPYTPPTYKPQPKPTP-TPTPYTP 292 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXP-PPXXPPPXXP 906 P P P P P P P P P PP P P P P P Sbjct: 150 PKPTPPPTYKPQPKPTPTPYTPTPTPPSYKPQPKPTPTPYTP 191 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPPXPPSXXPPPP 902 P Y PP P P P P P PP+ P PP Sbjct: 70 PPAYTPPKPTPTPPTYTPTPKPTPPPYTPKPTPPAHTPTPP 110 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PX-PXPPPXXPPP 897 PP P+P PP PP P P P P PP P P Sbjct: 94 PPYTPKPT--PPAHTPTPPTYTPTPTPPKPTPPTYKPQP 130 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 P +P P PP P PP P P PPP P Sbjct: 59 PKPEKPPKEHKPPAYTPPKPTPTPPTYTPTPKPTPPPYTP 98 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +1 Query: 715 TPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 TPT Y P P P P P P P PP P P Sbjct: 106 TPTPPTYTPTPTPPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPKPTPPPTYKPQPKPT 165 Query: 895 P 897 P Sbjct: 166 P 166 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP PP P P PPP Sbjct: 214 PAPAPEPEPEPPKKEPPPPPPPKQEPCPPPP 244 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P PP PP P PPP Sbjct: 213 PPAPAPEPEPEPPKKEPPPPPPPKQEPCPPP 243 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P P+ P P P PP P P P PP PPP P Sbjct: 193 PPPPKEEEKPEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPP 234 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P P P PP P Sbjct: 214 PAPAPEPEPEPPKKEPPPPPPPKQEPCPPPPKVVEVP 250 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P P P P P PP P PP Sbjct: 171 PPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPPP 206 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PPP P P Sbjct: 204 PPPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEPCPPP 243 >02_04_0271 + 21445113-21445865,21446727-21446788,21446927-21447027, 21447165-21447248,21448054-21448058,21448193-21448267, 21448339-21448416,21448896-21448952,21449351-21449421, 21449529-21449628,21449758-21449862,21450004-21450066, 21450144-21450266,21450371-21450514,21450598-21450672 Length = 631 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 GGG GGG G GG GG GG G G G + Sbjct: 192 GGGGGGGGGGGGGAGGGGGGEEGAGKDGWGGSNL 225 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G GG G G G GG Sbjct: 194 GGGGGGGGGGGAGGGGGGEEGAGKDGWGG 222 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GGG GGG GG GG G GG G+ + Sbjct: 193 GGGGGGGGGGGGAGGGGGGEEGAGKDGWGGSNLGKDL 229 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 187 PKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPP 223 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXXP---PXXPPXPPXPXPPPXXPPP 897 P+P P P P P P P PP P P P P P Sbjct: 157 PKPGPKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKP 192 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P PP P P P PP Sbjct: 167 PSPPKPKPGPKPKPPKP-GPKPKPPKPGPKPKPKPP 201 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P P P Sbjct: 189 PPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPPQPWWP 228 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P PP P P P PP Sbjct: 178 PKPPKPGPKPKP-PKPGPKPKPKPPKPGPKPKPKPP 212 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPX-PPPXXPPPXXP 906 P P+P P P P P P P PP P P P PP P Sbjct: 198 PKPPKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFPKPPCPP 238 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P+P P P P PP P P P P P P P Sbjct: 169 PPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGP 205 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP--PXPXPPPXXPP 894 P P+P PP P PP P P P P P PP Sbjct: 201 PKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFPKPPCPP 238 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P PP P P P Sbjct: 157 PKPGPKPKPKPSPPKPKPGPKPKPPKPGPKPKPP 190 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P PP P PP P P P P P P P Sbjct: 180 PPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGP 216 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPPXXP 906 PP I RP PP PP PP P PP PPP P Sbjct: 200 PPTIARPPRPLPPASPPPPSIATPPPSPASPPPPSTATPPPPSP 243 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPP 897 PP P PPP PP P PP P PPP P P Sbjct: 206 PPRPLPPASPPPPSIATPPPSPASPPPPSTATPPPPSPTP 245 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP PP P PPP P P Sbjct: 195 PAPPTPPTIARPPRPLPPASPPPPSIATPPPSPASPPPP 233 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P PP P P P P Sbjct: 211 PPASPPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASPTPP 255 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP-PPPXPPSXXPPPP 902 PA PPP PP P PPP P + PPP Sbjct: 227 PASPPPPSTATPPPPSPTPTTTRASPTPPPIPTATVRPPP 266 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP PP P P P PP Sbjct: 223 PP--PSPASPPPPSTATPPPPSPTPTTTRASPTPPP 256 >10_08_0223 - 15986763-15987575 Length = 270 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G G G G G G GG Sbjct: 81 GGGAGGGGGGGGGTNGGYGS--GSGSGYGMGSGSSGG 115 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG G G G G G G G GG Sbjct: 35 GGGGGGGGGGGGGGTNGGWGSGSGAGAGAGYGESGG 70 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG G G G G G G G Sbjct: 82 GGAGGGGGGGGGTNGGYGSGSGSGYGMGSGSSGGSG 117 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG GG G G G G G G Sbjct: 37 GGGGGGGGGGGGTNGGWGSGSGAGAGAGYGESGG 70 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G G G G G G Sbjct: 228 GSSGGGYASGMGGGKGGGGGGGENGGYGSGSGKGSGSGSG 267 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G GG G GG G G G G GAG+ G Sbjct: 130 GNYATGDGEGGGGGGGGGSNGGSGYGAGAGVGQGAGESG 168 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXX--GXGGGXXXGRGIXGG 786 G G G G G G GG G G GGG G G GG Sbjct: 52 GWGSGSGAGAGAGYGESGGDSGNTWNYGRGGGAGGGGGGGGG 93 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG GG G GG G G G GAGD G S G Sbjct: 192 GGGGGGGGGHGG-GPAASPSYGVGAGAGSGAGDAGSDGSSGGG 233 >10_08_0116 + 14935582-14936089,14936850-14937188,14937914-14937960, 14938175-14938264 Length = 327 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GG GGG G GG GG GG GGG Sbjct: 192 GGSGGGGGGGGGGGGGGGGGVLAVGGG 218 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GG G GG GG GG G GGG Sbjct: 181 GIGSSGHGSGGGGSGGGGGGGGGGGGGGGG 210 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G G GGG G GG GG GG G GGG Sbjct: 183 GSSGHGSGGGGSG-GGGGGGGGGGGGGGGG 211 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGG 800 GGGG GG GGGG G GG G Sbjct: 190 GGGGSGGGGGGGGGGGGGGGGGVLAVGGGSTDDG 223 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -1 Query: 891 GXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG G G GGG GG G Sbjct: 181 GIGSSGHGSGGGGSGGGGGGGGGGGGGGGGG 211 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG G GG GG G Sbjct: 196 GGGGGGGGGGGGGGGGVLAVGGGSTDDG 223 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P PPP P PP P P PPP PPP P Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP P P P PPP PP Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PP PP PP P PP P Sbjct: 327 PPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP PP P P Sbjct: 323 PPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPPTGP 361 >08_01_1038 + 10540185-10540709 Length = 174 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G G GG GG G GGG Sbjct: 25 GLGGGSGLGGGGGGLGKGGVRGGGGGLGGG 54 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGR 801 GG GGG G GG GG GG G GGG GR Sbjct: 22 GGVGLGGGSGLGGGGGGLGKGGVRGGGGGLGGGR 55 >07_03_0527 - 19085828-19086319 Length = 163 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G G GG GG G GGG Sbjct: 25 GLGGGSGLGGGGGGLGEGGVRGGGGGLGGG 54 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGR 801 GG GGG G GG GG GG G GGG GR Sbjct: 22 GGTGLGGGSGLGGGGGGLGEGGVRGGGGGLGGGR 55 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 36.3 bits (80), Expect = 0.033 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ P P PP P PPP PP PPPP Sbjct: 78 PSLIPTPAASTPPASPTANASPPPSLPPPPPPLRPPPPP 116 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P PP PP P P PPP PP P Sbjct: 78 PSLIPTPAASTPPASPTANASPP-PSLPPPPPPLRPPPPP 116 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 P P P PPP PP PP P PPP PPP P Sbjct: 1184 PPPPAPVILPPPPVKSPP--PPAPVISPPPPVKSPPPPAP 1221 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPPXXP 906 P P P PPP PP PP P P PP PPP P Sbjct: 1216 PPPPAPVILPPPPVKSPP--PPAPVISPPPPEKSPPPAAP 1253 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 P P P PPP PP PP P PPP PPP P Sbjct: 1152 PPPPAPVILPPPPIKSPP--PPAPVISPPPPVKSPPPPAP 1189 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPPXXP 906 P P P PPP PP PP P P PP PPP P Sbjct: 1168 PPPPAPVISPPPPVKSPP--PPAPVILPPPPVKSPPPPAP 1205 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPPXXP 906 P P P PPP PP PP P P PP PPP P Sbjct: 1200 PPPPAPVISPPPPVKSPP--PPAPVILPPPPVKSPPPPAP 1237 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 1/51 (1%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXX-XPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P V L P PPP PP P PPP P PPPP Sbjct: 1130 PPTVKPLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPP 1180 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 T P P P PPP PP PP P PPP PPP P Sbjct: 1132 TVKPLPPPVPVSSPPPPEKSPP--PPAPVILPPPPIKSPPPPAP 1173 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 1162 PPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPP 1196 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 1178 PPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1212 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 1194 PPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPP 1228 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 1210 PPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPP 1244 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P P PP P PP P P PPP Sbjct: 1305 PPPAVKPLPPPAPVSLPPPAVKPLPP-PVPQVSLPPP 1340 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P PPP P P P P P P PPP Sbjct: 1129 PPPTVKP--LPPPVPVSSPPPPEKSPPPPAPVILPPP 1163 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 +P P P P P PP P P PP PPP P Sbjct: 1120 LPPPATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAP 1157 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P PPP P P P P P P PPP Sbjct: 1157 PVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPP 1195 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P PPP P P P P P P PPP Sbjct: 1189 PVILPPPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPP 1227 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PP PP P P PP P PPPP Sbjct: 1111 ASSPPTEKSLPPPATVSLPPPTVKPLPPPVPVSSPPPP 1148 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPPP Sbjct: 1242 PPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPP 1276 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXX-PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P V L P PPP PP P P PP P PPP Sbjct: 1290 PPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVPQVSLPPP 1340 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 2/40 (5%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPPXPPSXXPPP 899 P PPP PP P PPP P S PPP Sbjct: 1237 PVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPP 1276 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P PPP P PP P P P P P Sbjct: 448 PPAAPSTPTSHGPPPPEEESPEEPPEEPTPSPTPSSP 484 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P P PP PP PP P Sbjct: 717 PPTPESEASSPPPPA-PEGHTPSPPKSSPPEEKSPPIPP 754 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 PP P P P P PP P PPP P PP P Sbjct: 965 PPPSPTPKSSP---PSHEEYVPPSPAKSTPPPEKPLPPHTP 1002 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPP 894 T PP P PP P PP P P PP PP Sbjct: 573 TPSPPKSGPPAGESPPTPESKASPPPTPEEYTPSPPKSTPP 613 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PP P PPP P Sbjct: 628 PPPPAPEGHTPSPPESTPPSEKSPPTPESKASSPPPPTP 666 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PP P PPP P Sbjct: 661 PPPPTPEGHTPSPPKSTPPTEKSPPTPESESSSPPPPAP 699 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPP 894 T PP P PP P PP P P PP PP Sbjct: 736 TPSPPKSSPPEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPP 776 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP P P PP P Sbjct: 414 PGHPTPGKPSEPPEKPPLIPVPVGPPEKSP 443 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PP P PPP P Sbjct: 694 PPPPAPEGHMPSPPKSTPPVEKSPPTPESEASSPPPPAP 732 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + P PPP PP P P PPP Sbjct: 879 TKSPPTLT-PEISPPPEGKSPPSHTPESSSPPSKESEPPP 917 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P + P P P P P PP PPP P Sbjct: 1123 PATVSLPPPTVKPLPPPVPVSSPPPPEKSPPPPAP 1157 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPP 897 PP P P PP P P PP P PPP PPP Sbjct: 1313 PP--PAPVSLPP--PAVKPLPPPVPQVSLPPPKQESLPPP 1348 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPPPXXP 906 P P PPP P PP P PPP P P Sbjct: 520 PKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTP 559 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P PPP P Sbjct: 596 PP--PTPEEYTPSPPKSTPPAEKSPPTPESKASSPPPPAP 633 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P PP P PP PP P PP P Sbjct: 604 TPSPPKSTPPAEKSPPTPESKASSPP-PPAPEGHTPSPPESTP 645 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P PP P PP PP P PP P Sbjct: 637 TPSPPESTPPSEKSPPTPESKASSPP-PPTPEGHTPSPPKSTP 678 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPP P PP Sbjct: 1226 PPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPP 1259 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP PP P P PPP Sbjct: 1232 PPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPP 1267 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 +P P P P P PP P PP P PP P Sbjct: 1296 LPPPAPVSLPPPAVKPLPPPAPVSLPPPAVKPLPPPVP 1333 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPP 894 P P P PP P PP P P PP PP Sbjct: 545 PESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPP 582 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPP----XPXPPPXXPP 894 T PP P PP P PP P P PP PP Sbjct: 670 TPSPPKSTPPTEKSPPTPESESSSPPPPAPEGHMPSPPKSTPP 712 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 T PP P PP P P PP P PPP P P Sbjct: 767 TPSPPKSSPPEEKSPP-PHSPEKSPPSEAHPTSPPPSEKSPPTP 809 >11_04_0246 - 15311912-15312481 Length = 189 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G G G Sbjct: 70 GGEGGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >10_08_0218 - 15967064-15967906 Length = 280 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG G G G G G G GG Sbjct: 63 GSSGGAYASGGGGGQGGGGGQNGGSGYGSGSGSGYGQAGG 102 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG GGG G GG Sbjct: 234 GGGGGGQYGGSGSGSGSGSGQAGGYGPYGGGYAQAGGQGGG 274 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G GG G G GG Sbjct: 157 GGGGGGGQNGGSGYGSGSGYGQAGSYGPGGAYAQGGGQGGG 197 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG G G GG Sbjct: 196 GGGGGGQYGGSGHGSGSGYGQAGSYGPGGAYAQGGGQGGG 235 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG GG GG GG G GG G G G Sbjct: 62 GGSSGGAYASGGGGGQ-GGGGGQNGGSGYGSGSGSG 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG G GG Sbjct: 34 GGSGGGGGGGSEDGSGWGSGSGSGYGQAGGSSGGAYASGG 73 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXX--GXGGGXXXGRGIXGG 786 G G G G G GG GG G GGG G G GG Sbjct: 49 GWGSGSGSGYGQAGGSSGGAYASGGGGGQGGGGGQNGG 86 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GG G G GG Sbjct: 76 GQGGGGGQNGGSGYGSGSGSGYGQAGGYGPHGGAYAQGGGQGGG 119 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG--GXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG G G GG Sbjct: 118 GGGGGGVNGGSRYGSGSGSGYGQAGSYGPGGAYAQGGGQGGG 159 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G GG G GGG G G G Sbjct: 53 GSGSGYGQAGGSSGGAYASGGGGGQGGGGGQNGGSGYGSG 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG GG GG G G G G G G Sbjct: 104 GPHGGAYAQGGGQGGGGGGGVNGGSRYGSGSGSGYGQAG 142 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G G GGG G GG GG G G G G G+ Sbjct: 145 GPGGAYAQGGGQG-GGGGGGQNGGSGYGSGSGYGQ 178 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G G G G G G G GG GG G G G+ GG Sbjct: 86 GSGYGSGSGSGYGQAGGYGPHGGAYAQGGGQGGGGGGGVNGG 127 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG G G G G G G GG Sbjct: 221 GPGGAYAQGGGQG-GGGGG--GQYGGSGSGSGSGSGQAGG 257 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G G G G G GG G G Sbjct: 72 GGGGGQGGGGGQNGGSGYGSGSGSGYGQAGGYGPHG 107 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG G G G G G G G Sbjct: 33 GGGSGGGGGGGSEDGSGWGSGSGSGYGQAGG 63 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG +G G G G GG GGG Sbjct: 40 GGGGSEDGSGWGSGSGSGYGQAGGSSGGAYASGGG 74 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G G GGG G GG GG G G G G G+ Sbjct: 183 GPGGAYAQGGGQG-GGGGGGQYGGSGHGSGSGYGQ 216 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG G G G G+G GG Sbjct: 239 GQYGGSGSGSGSGSGQAGGY--GPYGGGYAQAGGQGGGGG 276 >05_07_0217 - 28469229-28469798 Length = 189 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G G G Sbjct: 70 GGEGGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >02_05_0269 + 27307837-27308424 Length = 195 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G G G Sbjct: 70 GGEGGGGDGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 7/40 (17%) Frame = +1 Query: 799 PRPXXXPP-------PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P P PP PP P PPP PPP Sbjct: 17 PNPFNLPPWLRSLRCPFTFLCPPPPPPPPPPPPPPPPPPP 56 Score = 35.1 bits (77), Expect = 0.077 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPPXXP 906 PP PP P PPP PPP P Sbjct: 38 PPPPPPPPPPPPPPPPPPP 56 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP PP P P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPLEVVSPSP 64 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP PPPP Sbjct: 38 PPPPPPPPPPPPPPPPPP 55 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP PPPP Sbjct: 39 PPPPPPPPPPPPPPPPPP 56 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P PP PP P P P Sbjct: 39 PPPPPPPPPPPPPPPPPPLEVVSPSPRWRRP 69 >01_02_0131 - 11441713-11441728,11441911-11441953,11442324-11442762 Length = 165 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G G G G G Sbjct: 70 GSEGGGGGGGGDG-GGEDGGDGGREGSGDGGGEGGG 104 >01_01_0082 + 625198-625719 Length = 173 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PPP P P P PP PPP P P Sbjct: 56 PDVLPTPVYYPPPPPVYYPPPSP-PPVAYPPPTTPSTNCP 94 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPPP P P PPP P + PPPP Sbjct: 62 PVYYPPPP---PVYYPPPSPPPVAYPPPTTPSTNCPPPP 97 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP P P PPP PP PPP Sbjct: 53 PPPPDVLPTPVYYPPPPPVYYPPPSPPPVAYPPP 86 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP PPP PP P Sbjct: 55 PPDVLPTPVYYPPPPPVYYPPPSPPPVAYP 84 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPQHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPQHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPQHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >10_07_0154 + 13487971-13488168,13488259-13488483,13488592-13490492, 13490578-13490829,13491110-13491191,13491466-13491657 Length = 949 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 546 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSP 584 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 534 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 570 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 540 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 574 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 532 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 570 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 537 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPAP 574 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/52 (30%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXP--PXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P + + PA PP P P P P PP PS PP P Sbjct: 521 PSSLQAMTAAAPAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPPLP 572 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >09_04_0487 - 18014469-18014660,18014935-18015016,18015297-18015548, 18015634-18017789 Length = 893 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 490 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSP 528 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 478 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 514 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 484 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 518 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P P PP PP PP P Sbjct: 470 PSSAAAPAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 509 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 476 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 514 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 481 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPAP 518 >09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962, 7633517-7633622,7633897-7633978,7634068-7634178, 7634259-7634510,7634596-7635688,7636157-7636829, 7636920-7637117 Length = 936 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 426 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSP 464 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 414 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 450 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 420 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 454 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 412 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 450 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 417 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPAP 454 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 495 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 533 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 483 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 489 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 523 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 481 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 486 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 523 >08_02_1084 - 24232968-24234779 Length = 603 Score = 35.5 bits (78), Expect = 0.059 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 9/48 (18%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG---------GGXXXGRGIXG 789 G GGG GG G GG G GG G G GG GRGI G Sbjct: 307 GGRGGGPGGGAGGGGGNWGRGGGGMGRGPAGNMRNRMGGPAGGRGIMG 354 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXG 789 GG GGG G G GG GG G GG GRG G Sbjct: 302 GGNYGGGRGGGPGGGAGGGGGNWGRGGGGMGRGPAG 337 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GG G G GG GG G GG G G G Sbjct: 294 GGAGSPQVGGNYGGGRGGGPGGGAGGGGGNWGRGGGGMG 332 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG G G G G GG Sbjct: 289 GGRGGGGAGSPQVGGNYGGGRGGGPGGGAGGGGGNWGRGG 328 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP PP PP P P P PPP Sbjct: 74 PSQQLPPPPQQQQPPPQHSLPPPP-PLPQAPPP 105 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Frame = +1 Query: 805 PXXXPPPXPXXPP---XXPPXPPXPXPPP---XXPPPXXP 906 P PPP P P PP P PPP PPP P Sbjct: 61 PPSLPPPLPQKQPPSQQLPPPPQQQQPPPQHSLPPPPPLP 100 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PP PP PP P P PPP Sbjct: 61 PPSLPPPLPQKQPPSQQLPP--PPQQQQPPPQHSLPPP 96 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P P P PPP P Sbjct: 94 PPPPPLPQAPPPQQQKVHIPGVAAPAPNHPPSQPNLPPPAAP 135 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXG 789 G GGG G GG GG G GGG GRG G Sbjct: 290 GRGGGGAGSPQVGGNYGGGRGGGPGGGAGGGGGNWGRGGGG 330 >08_02_0450 - 17266977-17267165,17268017-17268053,17268139-17269514, 17285369-17286055,17286146-17286343 Length = 828 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 536 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSP 574 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 524 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 560 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 530 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 564 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P P PP PP PP P Sbjct: 516 PSSAAAPAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 555 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 522 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 560 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 527 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPAP 564 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 560 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 598 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 548 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 554 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 588 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 546 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 551 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 588 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 560 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 598 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 548 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 554 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 588 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 546 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 584 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 551 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 588 >08_01_0202 - 1638978-1639571 Length = 197 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG GG GG G GGG G G Sbjct: 153 GGGGGGGYG-GGGGGYRGGGGGGGGGGCYNCGETG 186 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG G GG G GGG RG GG Sbjct: 87 GDRGYGGGGGGGRYGGDRGYGGGGGGYGGG---DRGYGGG 123 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRG--GXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G GG G G GGG GG G G Sbjct: 93 GGGGGGRYGGDRGYGGGGGGYGGGDRGYGGGGGYGGGGGGG 133 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG RG G GG G G GGG G GD G Sbjct: 85 GGGDRGYGGGGGGGRYGGDRGYGGGGGGYGGGDRG 119 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG G GGG G GG GG G GGG G Sbjct: 98 GRYGGDRGYGGGGGGYGGGDRGYGGGGGYGGGGGGG 133 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G G GG GG Sbjct: 154 GGGGGGYGGGGGGYRGGGGGGGG 176 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = -2 Query: 896 GGGXXGG---------GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G G GG GG GG G GGG G G GG Sbjct: 74 GGALTGGSRPSGGGDRGYGGGGGGGRYGGDRGYGGG---GGGYGGG 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = -3 Query: 901 GGGGXXEG--GXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G G GGGG G GG GGG Sbjct: 95 GGGGRYGGDRGYGGGGGGYGGGDRGYGGGGGYGGGGG 131 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXG---XGGXGGXXGGXXGXG 822 G GGG GGG G GG GG GG G Sbjct: 153 GGGGGGGYGGGGGGYRGGGGGGGGGGCYNCG 183 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG G GG G G G Sbjct: 161 GGGGGGYRGGGGGGGGGGCYNCGETG 186 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 882 RGGXGXGGXGXXXGXXXXXGGGXXGG 805 +GG G GG G G GGG GG Sbjct: 152 QGGGGGGGYGGGGGGYRGGGGGGGGG 177 >07_03_1160 - 24430240-24431268 Length = 342 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P PP P P PP P Sbjct: 64 PPLQPTPGVPPLPNPDVPPMNKPDVPPMPKPDGPPIPPVQP 104 Score = 35.1 bits (77), Expect = 0.077 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP-PXXP 906 PP P P P P P PP P P P P P PP P P Sbjct: 100 PPVQPCPDQPPQPKPDGPPLPNPNQP-PQPNPNGPPKPDMP 139 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P PP P PP P PP P P Sbjct: 109 PPQPKPDGPPLPNPNQPPQPNPNGPPKPDMPPMPKPDGLP 148 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + +P P P P PP PP P P PP P P Sbjct: 81 PPMNKPDVPPMPKPDGPP-IPPVQPCPDQPPQPKPDGPP 118 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P+P PP P PP P PP P PP P P Sbjct: 240 PDQPPQPNPDMPPKPDQPPQPCPDGPPKPDQPPQPNPNGPP 280 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXP-PXPXPPPXXPPPXXP 906 P P+P P P P PP PP P P P P PP P Sbjct: 248 PDMPPKPDQPPQPCPDGPPKPDQPPQPNPNGPPKPDQPPQPNP 290 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P+P PP P PP P PP P PP P P P Sbjct: 254 PDQPPQPCPDGPPKPDQPPQPNPNGPPKPDQPP-QPNPNGP 293 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P +P P P P PP P P P PP P P P Sbjct: 69 TPGVPPLPNPDVPPMNKPDVPPM--PKPDGPPIPPVQPCPDQP 109 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P PP P PP P P P P Sbjct: 262 PDGPPKPDQPPQPNPNGPP-KPDQPPQPNPNGPSKPDQPP 300 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P PP P PP PP Sbjct: 276 PNGPPKPDQPPQPNPNGPSKPDQPPRPNPDMPPKPDQPP 314 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P PP P P P P PP P Sbjct: 49 PPLLPTPDVVP--NPNQPPLQPTPGVPPLPNPDVPPMNKP 86 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P PP P PP P P P P P P Sbjct: 268 PDQPPQPNPNGPPKPDQPPQPNPNGPSKPDQPPRPNPDMP 307 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP---PXXPPPXXP 906 P +P+P P P P PP P PP P PP P Sbjct: 89 PPMPKPDGPPIPPVQPCPDQPPQPKPDGPPLPNPNQPPQPNP 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXP--PPXXPPPXXP 906 +P P P P PP P PP P P PP P P Sbjct: 239 KPDQPPQPNPDMPPK-PDQPPQPCPDGPPKPDQPPQP 274 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 P IP P P P PP P PP P PP P Sbjct: 223 PSIPNQPPQPIPNGPIKPDQPPQPNPDMPPKPDQPPQPCP 262 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 P P P PP P P P PP P P P P P P Sbjct: 86 PDVPPMPKPDGPPIPPVQP-CPDQPPQPKPDGPPLPNPNQP 125 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P PP P P PP P P P P PP P Sbjct: 106 PDQPPQPKPDGPPLPN--PNQPPQPNPNGPPKPDMPPMPKP 144 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P+P P P PP P PP P PP P P Sbjct: 226 PNQPPQPIPNGPIKPDQPPQPNPDMPPKPDQPPQPCPDGPP 266 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPP 897 P PRP PP P PP PP P P P P Sbjct: 296 PDQPPRPNPDMPPKPDQPPQPEYYEQPPKPDAPQMPPLP 334 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPP-PXXP 906 P IP P P P PP P P P P PP P P Sbjct: 230 PQPIPNGPIKPDQPPQPNPDMPPKPDQPPQPCPDGPPKPDQP 271 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPP 894 P P+P PP P P PP P P P P PP Sbjct: 156 PDQPPQPISDGPPLPN--PNVPPKPDQPPQPIPNGPP 190 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP----PXXPPXPPXPXPPPXXPPPXXP 906 P P+P PP P P PP P P PP P P Sbjct: 39 PYDYPKPDQPPPLLPTPDVVPNPNQPPLQPTPGVPPLPNPDVPP 82 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P P PP P P P P PP P Sbjct: 55 PDVVPNPNQPPLQPTPGVPPLPNPDVP-PMNKPDVPPMPKP 94 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 802 RPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 RP P P PP P PP P PP P P Sbjct: 155 RPDQPPQPISDGPPLPNPNVPPKPDQPPQPIPNGPP 190 >07_01_0862 - 7172083-7172931 Length = 282 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+ PPP P P P P PP PP P Sbjct: 174 PPLPPKKKPLPPPSPPPQPPLPEKENTPLPPLLLPPKKKP 213 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P PPP P P P PP P PPP P P Sbjct: 164 PPRKKPLLYPPPLP---PKKKPLPP-PSPPPQPPLP 195 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-----PXPPXPXP-PPXXPPPXXP 906 PP PR P P P P P PP P PP PPP P Sbjct: 148 PPLPPRKKAMLFPLPLPPRKKPLLYPPPLPPKKKPLPPPSPPPQPP 193 >06_02_0123 + 12104187-12104252,12105455-12105775 Length = 128 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G G GG GG G GGG Sbjct: 97 GGGYGGGYGGGYGGGYSGGGYGGRYGGGGG 126 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G GG G G GGG G G Sbjct: 78 GGGYGGGYGCGYGGGYGGYGGGYGGGYGGGYG 109 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG G G G GGG G G Sbjct: 41 GGYYPGGGFGYGGGYGGGYGRPGYGGGYGGGYG 73 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G G G GG G GGG G G Sbjct: 70 GGYGYPRYGGGYGGGYGCGYGGGYGGYGGGYGGGYG 105 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = -2 Query: 896 GGGXXG--GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G GG G G GG GG G G G G G Sbjct: 90 GGGYGGYGGGYGGGYGGGYGGGYSGGGYGGRYGGG 124 Score = 31.1 bits (67), Expect = 1.3 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Frame = -2 Query: 905 GXXGGGXX---GGGXG--XGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G GG GR GG Sbjct: 79 GGYGGGYGCGYGGGYGGYGGGYGGGYGGGYGGGYSGGGYGGRYGGGG 125 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG R G G GG G G GGG GG G Sbjct: 53 GGYGGGYGRPGYG-GGYGGGYG-YPRYGGGYGGGYG 86 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >06_01_0145 + 1092764-1093351 Length = 195 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G G GG G GG GG GG G GG G GRG GG Sbjct: 97 GKGGAGGNAGPGGVGG-KGGPGGDGGPGGIGGRGGDGG 133 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG GG G GG GG GG G GG G GRG GG Sbjct: 147 GGRGGRGGSGGFG-GGDGG-RGGRGGDGGEGRGGGRGGDGG 185 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GG G GG GG G G G G G G Sbjct: 156 GGFGGGDGGRGGRGGDGGEGRGGGRGGDGGEG 187 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 GG G G G GG GG G G G GGG G G GG Sbjct: 153 GGSGGFGGGDGGRGGRGGDGGEGRGGG-RGGDGGEGG 188 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGX----GGGXXXGRGIXG 789 G G G GG G GG GG G G GGG G+G G Sbjct: 28 GGRGRGGRGGRGGRGGAGGRLGVRHGRRGRRGGGGARGQGCVG 70 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXG--XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G GG G G G G GG G G Sbjct: 144 GGRGGRGGRGGSGGFGGGDGGRGGRGGDGGEGRGGGRGGDG 184 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GG GG G G G GG G GD GR Sbjct: 126 GGRGGDGGCGGVGGRGRKGGRGGRGGRGGSGGFGGGDGGR 165 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG +GG G G G GG G GD G G Sbjct: 135 GGVGGRGRKGGRGGRGGRGGSGGFGGGDGGRGGRGGDGGEGRGGGRG 181 >05_05_0334 + 24156532-24156565,24156681-24156782,24157145-24157274, 24157361-24157445,24157525-24157666,24157762-24157894, 24157993-24158254,24158331-24158519,24158596-24158721, 24158809-24159195,24159288-24159398,24159629-24160423, 24161114-24161255,24161350-24162518,24162609-24162818, 24163010-24163478,24164037-24164464 Length = 1637 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G GG GGG Sbjct: 1524 GGGGGWSGGGGGGGNSGGWTDNIGSGGGGWGTGGG 1558 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG GG G GG RG GG Sbjct: 1547 GSGGGGWGTGGGSSWAGGGDGGSGGGDSNRGGGGG 1581 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXX------GGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG GG G GGG G GG Sbjct: 1526 GGGWSGGGGGGGNSGGWTDNIGSGGGGWGTGGGSSWAGGGDGG 1568 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G G GG G GG G GGG G Sbjct: 1567 GGSGGGDSNRGGG-GGWGTPAGGSDGGGGGWGAAPG 1601 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G GG G GG Sbjct: 1554 GTGGGSSWAGG-GDGGSGGGDSNRGGGGGWGTPAGGSDGG 1592 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -1 Query: 906 GXXGGGXXRGGX----GXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG G GG G G GG GG+G Sbjct: 1531 GGGGGGGNSGGWTDNIGSGGGGWGTGGGSSWAGGGDGGSG 1570 >05_03_0662 + 16732965-16733037,16733310-16733413,16734468-16734861, 16736291-16736901,16739238-16739289,16739771-16739826, 16739962-16740190,16740980-16741212,16741480-16741740 Length = 670 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG GG GG G G G Sbjct: 153 GGGGGGSAGASGGSGGGGGGAGGATGGGAG 182 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G GG G GG G GGG G G Sbjct: 146 GGAGAAAGGGGGGSAGASGGSGGGGGGAGGATGGGAG 182 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G GGG G G G GG G GG G Sbjct: 146 GGAGAAAGGGGGGSAGASGGSGGGGGGAGGATGG 179 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G GG GG G GG G G Sbjct: 149 GAAAGG--GGGGSAGASGGSGGGGGGAGGATGGGAG 182 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G G G GG G G G G G G G G G G G Sbjct: 144 GQGGAGAAAGGGGGGSAGASGGSGGGGGGAGGATGGGAGSG 184 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXP-PXXPPXPPXPXPPPXXP-PPXXP 906 PP P P P PP PP PP P PP P Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSP 601 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P PP P PP PP PP PP P P Sbjct: 571 PSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527, 4797608-4797859,4797945-4800115 Length = 935 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 495 PPSPPPLRSPPRQPTPPPSPSQQPPLPVPQPVQASPTSP 533 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 483 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 489 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPVP 523 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 481 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 519 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 486 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPVP 523 >03_06_0297 - 32924162-32924605 Length = 147 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +PR PPP P P PP PP P PP P Sbjct: 106 PDVPRNPDVPPPKP--PELDPPRPPPEVVPEPTPPDVEP 142 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXXPPXPPX---PXPPPXXPPPXXP 906 P IP P P P P PP PP P PPP P P Sbjct: 95 PSIPSPPMPEVPDVPRNPDVPPPKPPELDPPRPPPEVVPEPTP 137 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 P P P PP P P P P P P PP PP P Sbjct: 90 PEQPGPSIPSPPMPEVPDV-PRNPDVPPPKPPELDPPRPP 128 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P P P PP PP P Sbjct: 82 PPGAPTPGPEQPGPSIPSPPMPEVPDVPRNPDVPPPKPPELDP 124 >03_02_0350 - 7734494-7734952,7735765-7736133 Length = 275 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G GG GG GG G GGG Sbjct: 4 GGGASSALGGGGGGGGSGGGGGGPSGGGGG 33 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG G G GGG Sbjct: 12 GGG--GGGGGSGGGGGGPSGGGGGGGG 36 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G GG GG GG G GG G G G Sbjct: 4 GGGASSALGGGGGGGGSGGGGGGPSGGGGGGGGPCG 39 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG G G GG GG G Sbjct: 14 GGGGGGSGGGGGGPSGGGGGGGGPCG 39 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG GG G GGG G G GG Sbjct: 4 GGGASSALGGGGGGGGSGGGGGGPSGGGGGGG 35 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G GG GG G GGG G G GG Sbjct: 5 GGASSALGGGGGGGGSGGGGGGPSGGGGGGGG 36 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG G G GGG Sbjct: 5 GGASSALGGGGGGGGSGGGGGGPSGGGGGG 34 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GG G G GG GG G Sbjct: 12 GGGGGGGGSGGGGGGPSGGGGGGGGPCG 39 >02_05_1258 + 35290183-35290198,35290292-35290599,35290844-35290939, 35291067-35291144,35291224-35291400,35292738-35292806, 35292917-35293093 Length = 306 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 GGG GGG G GG GG G G GG RG GG Sbjct: 17 GGGRSGGGGRGFGRGGDSGGRGGRGRGGGRTPRGRGGG 54 >02_04_0264 - 21393029-21393046,21394249-21394814,21395005-21395623 Length = 400 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G G GG Sbjct: 258 GQAAGGGRGGAGAGGGHGGAGAGAGGARGGAGAGGG 293 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG GG G G GG Sbjct: 263 GGRGGAGAGGGHGGAGAGAGGARGGAGAGGGHGGAGAGAGGG 304 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 896 GGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G G G G G GG G G G GRG G Sbjct: 271 GGGHGGAGAGAGGARGGAGAGGGHGGAGAGAGGGRGGAG 309 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GG GGG G G G GG G G G G GG + Y Sbjct: 283 GARGGAGAGGGHGGAGAGAG-GGRGGAGAGAGGGAQEPGGGGARRVVY 329 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG GG GG G G GG G G G Sbjct: 258 GQAAGGGRGGAGAGGGHGGAGAGAGGARGGAGAGGGHGG 296 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG GG GG G G GG G G Sbjct: 278 GAGAGGARGGAGAGGGHGGAGAGAGGGRGGAGAGAG 313 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G G G G G G GG G G GGG G G GG Sbjct: 275 GGAGAGAGGARGGAGAGGGHGGAGAGAGGGRGGAGAGAGGG 315 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G G G GG G G G G G G G GR Sbjct: 266 GGAGAGGGHGGAGAGAGGARGGAGAGGGHGGAGAGAGGGR 305 >02_03_0120 + 15463163-15465250 Length = 695 Score = 35.5 bits (78), Expect = 0.059 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 P PPP PP P PP P P P PPP P Sbjct: 278 PNSSYAPPPTKYIGPMPPNNQPLPPPPSPSPSPPPPSPP 316 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PPP PPP Sbjct: 292 PMPPNNQPLPPPPSPSPSPPPPSPPP 317 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP PP P PPP PPP P Sbjct: 284 PPPTKYIGPMPPNNQPLPP--PPSPSPSPPPPSPPPPPHP 321 >02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551, 2703632-2703883,2703969-2704798,2704895-2706202, 2706293-2706490 Length = 990 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 550 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 588 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 538 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 574 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 544 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 578 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 536 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 574 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 541 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 578 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 35.5 bits (78), Expect = 0.059 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP---PPXXP 906 PP +P PPP P P P PP P P P P PP P Sbjct: 113 PPPRKKPQFQPPPQP--PRAWDPSPPPPPPAPAAPVLVPPPAP 153 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PR PP P P P P P P P P P Sbjct: 124 PPQPPRAWDPSPPPPPPAPAAPVLVPPPAPAPRPAPAPAP 163 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPP----XPXPPPXXPPPXXP 906 +P PPP P PP P P PPP P P P Sbjct: 107 KPYRPPPPPRKKPQFQPPPQPPRAWDPSPPPPPPAPAAP 145 >01_06_0075 - 26201231-26201422,26201697-26201778,26201868-26201978, 26202059-26202310,26202396-26204629,26204720-26204917 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 570 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 35.5 bits (78), Expect = 0.059 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P P P P Sbjct: 582 PPSPPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P+P P P PP P P P P PP Sbjct: 570 PPSPPKPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 568 PAPPSPPKPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 606 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 573 PPKPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPTP 610 >11_06_0300 + 22095396-22096145,22096261-22096344,22097062-22097304, 22098535-22098702,22098895-22099008,22099378-22099890 Length = 623 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GGG GG GG G G GGG GGAG Sbjct: 585 GGGDYYGGGSSGGAGGYGGSSAYGGGGYGGGAG 617 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPPXXP 906 P PPP P P PP P PPP PPP P Sbjct: 132 PAPPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPP 169 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PPP P P PPPP + PPPP Sbjct: 132 PAPPPPPPPSHPALLPPDATAP---PPPPTSVAALPPPP 167 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP PP PPP P P Sbjct: 137 PPPPSHPALLPPDATAPPP--PPTSVAALPPPPPPQP 171 >10_08_0216 - 15942379-15942852,15942956-15943033 Length = 183 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G GG G GG G GG Sbjct: 73 GAAASGGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGG 112 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG GG G GG G GG G GG G G V Sbjct: 112 GGGGGAGGGGGGGYGYGAGGGYGQAGGPYYGPYASGAVVV 151 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 13/53 (24%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX-------------GGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G G Sbjct: 78 GGGGGGGGGGGYGYGAGGGYGQAGGPYYGPYASGGGGGGAGGGGGGGYGYGAG 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GG GG G GG GG G G G G G Sbjct: 72 GGAAASGGGGGGGGGGGYGYGAGGGYGQAGG 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGG 818 GGGG GG GGGG G GG Sbjct: 111 GGGGGGAGGGGGGGYGYGAGGGYGQAGG 138 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G GG G G GGG G Sbjct: 111 GGGGGGAGGGGGGGYGYGAGGGYGQAGG 138 >09_04_0430 + 17502387-17503505 Length = 372 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P + +P PPP P PP P P P PP PP Sbjct: 160 PAPMQQPQPQPPPQP-TPPRAAPLPTPPRAPPQSTPP 195 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PP P P Sbjct: 160 PAPMQQPQPQPPPQPTPPRAAPLPTPPRAPPQSTPP 195 >08_02_1256 + 25645085-25645396 Length = 103 Score = 35.1 bits (77), Expect = 0.077 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPP 894 PP PP PP P PPP PP Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPP 894 P P PPP P PP PP PPP P Sbjct: 61 PPPPPPPPPLPSPPPPPPPQQQEEQSPPPLLDP 93 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPPXXP 906 PP PP P P P PPP P Sbjct: 61 PPPPPPPPPLPSPPPPPPP 79 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P P PP PP P PP Sbjct: 62 PPPPPPPPLPSPPPPPPPQQQEEQSPP 88 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P P PP PP PPP Sbjct: 63 PPPPPPPLPSPPPPPPPQQQEEQSPPP 89 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PS PPPP Sbjct: 61 PPPPPPPPPLPSPPPPPP 78 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P PP PP PP P Sbjct: 64 PPPPPPLPSPPPPPPPQQQEEQSPPPLLDP 93 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP P PPPP Sbjct: 62 PPPPPPPPLPSPPPPPPP 79 >07_03_0890 - 22332768-22333382 Length = 204 Score = 35.1 bits (77), Expect = 0.077 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP----XXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP P P PPP P P P Sbjct: 75 PPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PP PP PPPP PP+ P P Sbjct: 79 PAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTP 117 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 1/39 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXP 891 T PP P P P P PP P P P PP P Sbjct: 83 TPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPPELP 121 >02_02_0100 - 6783821-6784339,6784815-6784984,6785062-6785164, 6785291-6785454,6786781-6786821,6786933-6787129 Length = 397 Score = 35.1 bits (77), Expect = 0.077 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G G G G G G GRG Sbjct: 353 GAYGGGAYGGAPGAYGGAGGYGSYGGAGAGGAGGRG 388 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGG-GXXXGRGIXG 789 G GGG GGG G G GG G G GG G G G G Sbjct: 343 GAYGGGAYGGGAYGGGAYGGAPGAYGGAGGYGSYGGAGAGG 383 Score = 33.1 bits (72), Expect = 0.31 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG G G G G GG Sbjct: 348 GAYGGGAYGGG-AYGGAPGAYGGAGGYGSYGGAGAGGAGG 386 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GG GG GG G GG G G Sbjct: 261 GGAAASGGGGGGGGGGSGSSGGYGYGAG 288 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G G G G GGG Sbjct: 269 GGGGGGGGSGSSGGYGYGAGYRSAGGG 295 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGX-GXGG-XGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GG G G GG Sbjct: 338 GAYGGGAYGGGAYGGGAYGGGAYGGAPGAYGG-AGGYGSYGG 378 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G G G G G G Sbjct: 262 GAAASGGGGGGGGGGSGSSGGYGYGAGYRSAGG 294 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GGG G GG Sbjct: 318 GSGYGGGYGGSLYGGAYGAYGAYGGGAYGGGAYGGG 353 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG G GGG G G GG Sbjct: 323 GGYGGSLYGGAYGAYGAYGGGAYGGGAYGGGAYGG-GAYGG 362 >01_06_0561 + 30251547-30252173,30252248-30252405,30253250-30254192, 30254271-30254438,30254546-30254857,30255498-30255557, 30255905-30255937,30256083-30256271 Length = 829 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG G G GG Sbjct: 27 GGGGGGGGGGTGGGGGGGGRRGGEDGG 53 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G GG GG GG GG Sbjct: 22 GRRGGG-GGGGGGGGGTGGGGGGGGRRGG 49 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG G GG G GG G GGG G G G Sbjct: 11 GGRRWGEGEEGGRRGGGGGGGGGGGGTGGGGGGGG 45 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 891 GXXRGGXGXGGXGXXXGXXXXXGGGXXGG 805 G RGG G GG G GGG GG Sbjct: 21 GGRRGGGGGGGGGGGGTGGGGGGGGRRGG 49 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 35.1 bits (77), Expect = 0.077 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P P PPP PPP Sbjct: 108 PKPQPRSPEPETPPAPAPLPPPPPPPP 134 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +1 Query: 796 IPRPXXXP-PPXPXXPPXXPPXPPXPXPPP 882 +P+P P P P PP P PP P PPP Sbjct: 105 LPQPKPQPRSPEPETPPAPAPLPP-PPPPP 133 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP P P P PPP Sbjct: 106 PQPKPQPRSPEPETPPAPAPLPPPPPP 132 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 P P+P P P P PP PP P Sbjct: 106 PQPKPQPRSPEPETPPAPAPLPPPPPPP 133 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PPP P Sbjct: 106 PQPKPQPRSPEPETPPAPAPLPPPPPPP 133 >01_02_0007 + 10132380-10133201 Length = 273 Score = 35.1 bits (77), Expect = 0.077 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P+P P P P P PP P P P P P P Sbjct: 116 PQPLPQPNPNPQPLPQPDPNAPPL-PLPQPNPNNPQP 151 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P +P+P P P P P P P P P P P PP P Sbjct: 102 PQPLPQPGPQPNPNPQPLPQPNPNPQPLPQPDPNAPPLPLP 142 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P +P+P P P P P P P P P P P P P Sbjct: 58 PQPLPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQPQPQPLP 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P PP P P P P P P PP P Sbjct: 173 PLPLPQPDPNAPPQPLPQPDPNNPQPLPQPDPNAPPQPLP 212 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P P P P P PP P P P P PP P Sbjct: 185 PQPLPQPDPNNPQPLPQPDPNAPPQP-LPQPDPNSPPQPLP 224 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P P P P P PP P P P P PP P Sbjct: 149 PQPLPQPDPNAPSLPLPQPDPNAPPL-PLPQPDPNAPPQPLP 189 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP-XXPPXXPPXPPXPXPPPXXPP 894 P +P+P PP P P P P P P P PP Sbjct: 196 PQPLPQPDPNAPPQPLPQPDPNSPPQPLPQPDPNTPP 232 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P +P+P P P P P P P P P P P P P Sbjct: 70 PQPLPQPQPQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGP 110 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P +P+P P P P P P P P P P P P P Sbjct: 84 PQPLPQPQPQPQPLPLPGPQPLPQPGPQPNPNPQPLPQPNP 124 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 +P P P P P P P P P P P P P P Sbjct: 51 LPNPRPQPQPLPQPNPNPQPQPLPQPQPQPQPQPQPLP 88 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 54 PRPQPQPLPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQPQP 94 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 90 PQPQPQPLPLPGPQPLPQPGPQPNPNPQPLPQPNPNPQPLP 130 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP----PXPXPPPXXPPPXXP 906 P P P P P P PP P P P P P P P P Sbjct: 120 PQPNPNPQPLPQPDPNAPPLPLPQPNPNNPQPLPQPDPNAPSLP 163 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P PP P P P P P P Sbjct: 167 PDPNAPPLPLPQPDPNAPP-QPLPQPDPNNPQP 198 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 64 PNPNPQPQPLPQPQPQPQPQPQPLPQPQPQPQPLPLPGPQP 104 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPP-XXPPPXXP 906 P +P P P P P P P P P P P P P P P Sbjct: 96 PLPLPGPQPLPQPGPQPNPNPQPLPQPNPNPQPLPQPDPNAP 137 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 110 PQPNPNPQPLPQPNPNPQPLPQPDPNAPPLPLPQPNPNNP 149 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P PP P P P P P P P P Sbjct: 126 PQPLPQPDPNAPPLPLPQPNPNNPQPLPQPDPNAPSLPLP 165 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 52 PNPRPQPQPLPQPNPNPQPQPLPQPQPQPQPQPQPLPQPQP 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 76 PQPQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGPQPNPNP 116 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 78 PQPQPQPQPLPQPQPQPQPLPLPGPQPLPQPGPQPNPNPQP 118 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP P P PP P P Sbjct: 191 PDPNNPQPLPQPDPNAPPQPLPQPDPNSPPQPLPQP 226 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P P P P P P P P P Sbjct: 172 PPLPLPQPDPNAPPQPLPQPDPNNPQPLPQPDPNAPPQP 210 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P Sbjct: 193 PNNPQPLPQPDPNAPPQPLPQPDPNSPPQPLPQPDPNTP 231 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P P P P P P P P PP P Sbjct: 138 PLPLPQPNPNNPQPLPQPDPNAPSLPLPQPDPNAPPLPLP 177 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 P P PPP PP P P PPP P P Sbjct: 99 PVPYPAPPPPSCCPPSTQQCYHCCPEPPPPPPKPKP 134 Score = 28.3 bits (60), Expect(2) = 0.095 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP+ PP P Sbjct: 173 PPPPPPPAIWPPQP 186 Score = 25.4 bits (53), Expect(2) = 0.095 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP 878 PPP P P PPPP P Sbjct: 106 PPPSCCPPSTQQCYHCCPEPPPPPPKP 132 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P +P PPP P P P P PP P P P Sbjct: 57 TQTAPPVPVVISEPPPPQPQPEPQPAAPSQPPPPQEQPSPPPP 99 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P P P P P P Sbjct: 54 PPPTQTAPPVPVVISEPPPPQPQPEPQPAAPSQPPP 89 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXP---PPPXPPSXXPPP 899 PPP PP P P P P PS PPP Sbjct: 54 PPPTQTAPPVPVVISEPPPPQPQPEPQPAAPSQPPPP 90 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P P P PP P PP P P P Sbjct: 71 PPPQPQPEPQPAAPSQPPPPQEQPSPPPPASSNTTQQPPPP 111 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG G G GG GG GG G GGG Sbjct: 82 GGGGVGDVEGGGGGGGAGGGGGGGGGG 108 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G G GGG G GG GG G GGG G+ Sbjct: 78 GAGGGGGGVGDVEGGGGGGGAGGGGGGGGGGQ 109 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G G GG GGG G G Sbjct: 77 GGAGGGGGGVGDVEGGGGGGGAGGGGGGGGGG 108 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG G GGG G G GG Sbjct: 78 GAGGGGGGVGDVEGG--GGGGGAGGGGGGGGG 107 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -3 Query: 901 GGGGXXE--GGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG E GG GGGG G GG GGG G Sbjct: 68 GGGEAMEVDGGAGGGGGGVGDVEGGGGGGGAGGGGGGGGGG 108 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -1 Query: 876 GXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXS 778 G G GG G G G G GG G G+ S Sbjct: 80 GGGGGGVGDVEGGGGGGGAGGGGGGGGGGQQAS 112 >10_08_0146 - 15184123-15184968,15185049-15185519,15185606-15185869 Length = 526 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P PPP P P P PP P P P Sbjct: 8 PTPLLLPPPPPQEPAPLSPPPPLPTPKP 35 >09_06_0081 + 20745627-20748144,20748211-20748308 Length = 871 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PP + P PP P P P PP P PP PP P Sbjct: 174 PPHLRAPCGLAPPVPTPPALATHVPMPPAPAPPVPTPPAPTP 215 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P P P P P PP P PP PP Sbjct: 350 PAPTPPAPATPVPMPPTPTRLVPTPPAPGPPADVPP 385 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP--PXPXPPPXXPP 894 P +P P P P PP P P P PP PP Sbjct: 185 PPVPTPPALATHVPMPPAPAPPVPTPPAPTPPADVPP 221 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P P P P P P P P P Sbjct: 339 PHLRAPRTLAPPAPTPPAPATPVPMPPTPTRLVPTPPAP 377 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPPPXXP 906 P P PP P P PP P P PP PP P Sbjct: 344 PRTLAPPAPTPPAPATPVPMPPTPTRLVPTPPAPGPPADVP 384 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PP P PP P P PP PP Sbjct: 271 PPAPTPPAPTFHVPTPPTPATPAPPADVPP 300 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 P +P P PP P P PP PP PP P Sbjct: 509 PPVPTPPAPAPPVSTLPSPAPSVHTPPVTAPPATAPPMIAP 549 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PP P P PP P PP+ PP Sbjct: 180 PCGLAPPVPTPPALATHVPMPPAPAPPVPTPPAPTPP 216 >09_04_0180 + 15367737-15367755,15368874-15369739 Length = 294 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PRP P P P P P P P P P P P Sbjct: 131 PPPPRPMPIPTPSPRPRPPDPEPKPDPEPDPELEPEPEP 169 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P PP P P P P P Sbjct: 155 PDPEPDPELEPEPEPEPDPEPEPEPPTPKPIPTPIPSPPP 194 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P P P P P P P P P P P P P Sbjct: 148 PPDPEPKPDPEPDPELEPEPEPEPDPEPEPEPPTPKP 184 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P P P P P P P PPP P Sbjct: 167 PEPEPDPEPEPEPPTPKPIPTPIPSPPPRLIP 198 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P P P P P P Sbjct: 132 PPPRPMPIPTPSPRPRPPDPEPKPDPEPDPELEPEPEPEP 171 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P PP P Sbjct: 165 PEPEPEPDPEPEPEPPTPKPIPTPIPSPPPRLIP 198 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P + PPP P P P P P P P P P Sbjct: 119 TNVEPDLELEPEPPPPRPMPIPTPSPRPRPPDPEPKPDPEPDP 161 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P IP P P PP P P P P P P P P P P Sbjct: 136 PMPIPTPSPRPRPPDPEPKPDPEPDPELEPEPEPEPDPEPEPEP 179 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXP-PXPXPPPXXPPP 897 P PRP P P P P P P P P P P PP Sbjct: 142 PSPRPRPPDPEPKPDPEPDPELEPEPEPEPDPEPEPEPP 180 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P P P P P P P P P Sbjct: 134 PRPMPIPTPSPRPRPPDPEPKPDPEPDPELEPEPEPEPDP 173 >09_02_0369 - 8012470-8013120 Length = 216 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP PP PPP Sbjct: 28 PPPAPHAAATKPPPPPPHDDPPLKPPP 54 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 PP + PP P PP PP P PP PPP P Sbjct: 52 PPPQQQFITAQPPPPDEPPLKPPPSFYPAVLPPEPPPPRRP 92 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 742 PXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P L T PP P PPP P PP PP P P P Sbjct: 48 PPLKPPPQQQFITAQPPPPDEPPLKPPPS-FYPAVLPPEPPPPRRPAATP 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 11/48 (22%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX---PPXXPPX--------PPXPXPPPXXPPP 897 PP P PP P PP PP PP P PP PPP Sbjct: 28 PPPAPHAAATKPPPPPPHDDPPLKPPPQQQFITAQPPPPDEPPLKPPP 75 >09_02_0081 - 4041364-4041555,4041830-4041911,4042192-4042443, 4042529-4044001,4044222-4044733,4044824-4045021 Length = 902 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P PP P PP P P P P Sbjct: 494 PAPPSPPEPPSPRHPPRQPTPPPSPSQQPPLPTP 527 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP P P P P P Sbjct: 499 PPEPPSPRH-PPRQPTPPPSPSQQPPLPTPQPVQASPTSP 537 >09_02_0080 - 4020020-4020047,4020160-4022044,4022079-4022817 Length = 883 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PP P PP PP P Sbjct: 356 PHPRVPRAPAPPVPAPPAPTPPIPTPPALAPPADVP 391 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P +PR P P P P P PP PP PP Sbjct: 358 PRVPRAPAPPVPAPPAPTPPIPTPPALAPPADVPP 392 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P P P P P P P P PP PP P Sbjct: 526 PPIPMP---PAPAPPIPTPSMPFPTVPAPPVTVPPATAP 561 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP--PPXXPPPXXP 906 PP RP PP P PP PP P P PP P Sbjct: 741 PPAAARPRAPTPPAAAAAPAAPPAPPSGLPSWPLLVRPPTGP 782 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 +P P P P P PP P P P PP PP Sbjct: 353 VPAPHPRVPRAPAPPVPAPPAPTPPIPTPPALAPP 387 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPP 894 PP +P P PP P P PP PP PP Sbjct: 440 PPLVPTPPAHAPPVATPPTLATPVPTPPVTAPPADVPP 477 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +PR P P P P PP P PP P P P Sbjct: 277 VPRVLSPPAPMPSALATHVPTPPAPAPP--VPTPLAP 311 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP P PP PP P Sbjct: 354 PAPHPRVP--RAPAPPVPAPPAPTPPIPTP 381 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P Sbjct: 514 PAPHLRVSRMPAPPIPMPPAPAPPIPTPSMPFPTVP 549 >08_02_0826 - 21583507-21583555,21584000-21584679 Length = 242 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G G G G G G G Sbjct: 62 GVGIGGGGGGGGGGGSGSGSYSGSGSGSYSGSGSGSG 98 Score = 32.7 bits (71), Expect = 0.41 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G G GGG G G G Sbjct: 40 GVGGGGGLGVGTGGGLGLGSGIGVGIGGGGGGGGGGGSGSG 80 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G Sbjct: 66 GGGGGGGGGGGSGSGSYSGSGSGSYSGSGSGSGSGSG 102 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G G G G G G G G G Sbjct: 66 GGGGGGGGGGGSGSGSYSGSGSGSYSGSGSGSGSGSG 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG GG G G G G G Sbjct: 48 GVGTGGGLGLGSGIGVGIGGGGGGGGGGGSGSGSYSGSGSG 88 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP PP P PPP PPP Sbjct: 91 PEAPPSPPLLALPPPPPPPPPPPPPP 116 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +1 Query: 829 PXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P PP P PP P PPP PPP P Sbjct: 91 PEAPPSPPLLALPPPPPPPPPPPPPPQP 118 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PPP P P Sbjct: 94 PPSPPLLALPPPPPPPPPPPPPPQPQQHLP 123 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 +P PP PP PP PP P P P Sbjct: 90 LPEAPPSPPLLALPPPPPPPPPPPPPPQP 118 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP P PPP P PP PP P P Sbjct: 94 PPSPPLLALPPPPPPPPPPPPPPQPQQHLP 123 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 P P P P P PP PP PP P Sbjct: 91 PEAPPSPPLLALPPPPPPPPPPPPPPQP 118 >08_01_0546 - 4746118-4746580,4747335-4747342 Length = 156 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGG 816 GGG G GG GG GG G GGG Sbjct: 74 GGGGGGGGEGGGGGGGGGGGGG 95 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG GGG G GG GG GG G Sbjct: 74 GGGGGGGGEGGGGGGGGGGGGGG 96 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG GG GG Sbjct: 75 GGGGGGGEGGGGGGGGGGGGGGG 97 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGG 816 GGG G G GG GG G GGG Sbjct: 75 GGGGGGGEGGGGGGGGGGGGGG 96 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGG 816 GGG G G GG GG G GGG Sbjct: 76 GGGGGGEGGGGGGGGGGGGGGG 97 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXP---PPXPXXPPXXPPXPPXPX--PPPXXPPP 897 PP P P P PP P P PP PP P P PPP Sbjct: 56 PPPKPSPTPPPASPPPAPTPPQTRPPSPPPQQQQPRPVSPPP 97 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PP P P PP PP P P PP PP P Sbjct: 44 TCYPVSSAAPTAPPPKPSPTPPPASPP--PAPTPPQTRPPSPPP 85 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T P P P P P PP P P PPP PPP Sbjct: 33 TYGSPIPPSPTTCYPVSSAAPTAPPPKPS-PTPPPASPPP 71 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P PPP P P Sbjct: 65 PPASPPPAPTPPQTRPPSPPPQQQQPRPVSPPPVAEPYYWP 105 >07_03_1155 - 24413270-24413728 Length = 152 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPP--PXXPPPXXP 906 P +P+P PPP P P P P PP P P P P P P Sbjct: 51 PELPKP-ELPPPLPELPRPVVPELPPHPAVPELPPLPKPELP 91 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P P P P P PP P P P P PP P P Sbjct: 42 PELPPHPELPELPKPELPPPLPELPRPVVPELPPHPAVPELP 83 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +PRP P P PP P PP P P Sbjct: 63 PELPRPVVPELPPHPAVPELPPLPKPELPPHPVVPEMLP 101 >07_03_0154 + 14509979-14512033 Length = 684 Score = 34.7 bits (76), Expect = 0.10 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P PP PP P PPP Sbjct: 41 PERGPLPLPAAAPPPPPPPPPPPPPP 66 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + R P P P P P PPP PPP P Sbjct: 28 PFLKREPKSEPASPERGPLPLPAAAPPPPPPPPPPPPPP 66 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP PP P P P P Sbjct: 46 LPLPAAAPPPPPP-PPPPPPPPQVQAATVATPVPATP 81 >07_03_0089 - 13300902-13301645 Length = 247 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P P P P P P P P P P PPP P Sbjct: 204 PKPNPNPKPEPQPDPKPEPKPQPEPSLPKPPPLSP 238 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P PPP P Sbjct: 198 PEPSPNPKPNPNPKPEPQPDPKPEPKPQPEPSLPKPPPLSP 238 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 184 PSPNPKPEPKPEPKPEPSPNPKPNPNPKPEPQPDPKPEPKP 224 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 48 PTPKPQPETKPSPQPNPQPNPQPDPKPSPQPDPKPTPQPEP 88 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 168 PKADPKPNPKPKPQPEPSPNPKPEPKPEPKPEPSPNPKPNP 208 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P P P P P P P P P P P P P Sbjct: 196 PKPEPSPNPKPNPNPKPEPQPDPKPEPKPQPEPSLPKP 233 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P+P P P P P P P P P P P P P Sbjct: 44 PKPDPTPKPQPETKPSPQPNPQPNPQPDPKPSPQPDP 80 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 174 PNPKPKPQPEPSPNPKPEPKPEPKPEPSPNPKPNPNPKPEP 214 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 182 PEPSPNPKPEPKPEPKPEPSPNPKPNPNPKPEPQPDPKPEP 222 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 180 PQPEPSPNPKPEPKPEPKPEPSPNPKPNPNPKPEPQPDPKP 220 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 162 PNPQPSPKADPKPNPKPKPQPEPSPNPKPEPKPEPKPEPSP 202 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P P Sbjct: 192 PKPEPKPEPSPNPKPNPNPKPEPQPDPKPEPKP-QPEPSLP 231 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 64 PQPNPQPDPKPSPQPDPKPTPQPEPKQDPKPNPQPDPKPSPQP 106 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 74 PSPQPDPKPTPQPEPKQDPKPNPQPDPKPSPQPDPKPTPQP 114 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 92 PKPNPQPDPKPSPQPDPKPTPQPDPKQDPQPNPQPDPKPTPQP 134 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 150 PTPQPDPKQDPQPNPQPSPKADPKPNPKPKPQPEPSPNPKP 190 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 T P +P P P P P P P P P P P P P Sbjct: 49 TPKPQPETKPSPQPNPQPNPQPDPKPSPQPDPKPTPQPEPKQDP 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 80 PKPTPQPEPKQDPKPNPQPDPKPSPQPDPKPTPQPDPKQDP 120 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 46 PDPTPKPQPETKPSPQPNPQPNPQPDPKPSPQPDPKPTPQP 86 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 72 PKPSPQPDPKPTPQP-EPKQDPKPNPQPDPKPSPQPDPKP 110 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 116 PKQDPQPNPQPDPKP-TPQPNPKQDPQPNPQPDPKPTPQP 154 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 39 PADPNPKPDPTPKP-QPETKPSPQPNPQPNPQPDPKPSP 76 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 58 PSPQPNPQPNPQPDP-KPSPQPDPKPTPQPEPKQDPKPNP 96 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 100 PKPSPQPDPKPTPQPDPKQDPQPNPQPDPKPTPQPNPKQDP 140 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 120 PQPNPQPDPKPTPQPNPKQDPQPNPQPDPKPTPQPDPKQDP 160 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P Sbjct: 160 PQPNPQPSPKADPKPNPKPKPQPEPSPNPKPEPKPEPKPEP 200 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 T P P P P P P P P P P P P P P Sbjct: 151 TPQPDPKQDPQPNPQPSPKADPKPNPKPKPQPEPSPNPKPEPKP 194 >06_02_0055 + 10986228-10986388,10986717-10986899,10987013-10987652 Length = 327 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/48 (35%), Positives = 20/48 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GGG GGG GG GG G G G G + G V + + Sbjct: 277 GDGGGGGLGGGGSSGGEGGGGGSGDEEGCGDGSGGELGDGLTVRRRAF 324 >04_04_1416 - 33411900-33412148,33412735-33412854,33412986-33413235, 33413998-33414131 Length = 250 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G G G GGG G G GG Sbjct: 208 GDHGGGWHHHGGDHGGGGHHFSGDHGGGGGCGGGGGCGGG 247 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 234 GGGGCGGGGGCGGGGG 249 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G G GG G GGG G G Sbjct: 218 GGDHGGGGHHFSGDHGGGGGC-GGGGGCGGGGG 249 >03_05_0737 + 27258320-27259007,27259263-27259435,27262684-27262758, 27262832-27263296 Length = 466 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G GG G GG G G G GGG GRG Sbjct: 370 GYQNGGRGGRGGRGMGGGGYQNGRGGGGGGGYQNGRG 406 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/39 (51%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG G G GGG GRG GG Sbjct: 361 GGGRGGGRRGYQNGGRGGRGGRGMG-GGGYQNGRGGGGG 398 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG G G G GGG Sbjct: 383 GMGGGGYQNGRGGGGGGGYQNGRGGGEGGG 412 >03_02_0738 - 10824121-10825572 Length = 483 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +1 Query: 820 PPXPXXPPXXPPX---PPXPXPPPXXPPPXXP 906 PP P P PP PP P PP PPP P Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPPPSSPPPPALP 109 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 819 PPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PP P PPPP PPS PPP Sbjct: 80 PPSPPSSSPPPLSFPPPPPPPSSPPPP 106 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 P I P P PP P P P P PPP PPP Sbjct: 67 PTITAVAADTSPPPPSPPSSSPPPLSFPPPPPPPSSPPP 105 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T PP P P PPP PP PP P PPP P Sbjct: 76 TSPPPPSP-PSSSPPPLSFPPPPPPPSSP---PPPALP 109 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GGG GGG G GG GG GG G GG Sbjct: 59 GGGGGGGGGGGGGGGG--GGRGGRGG 82 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG G GG GG G Sbjct: 61 GGGGGGGGGGGGGGGGRGGRGG 82 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G GG RG G Sbjct: 60 GGGGGGGGGGGGGGGGGRGGRGGHARRDARPRDDRGRDG 98 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 854 GGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GGG GRG GG Sbjct: 60 GGGGGGGGGGGGGGGGGRGGRGG 82 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 853 PXPPXPXPPPXXPPPXXP 906 P PP P PPP PP P Sbjct: 3 PLPPLPSPPPPPTPPPSP 20 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T PP P PPP P P P P PPP Sbjct: 418 TVMPPPAPSQQPQPPPPPSHPTPITSVAPAPPPPP 452 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXP----PPXXPPP 897 PP I P PPP P P PP P P P P PPP Sbjct: 409 PPIIAAPAITVMPPPAPSQQPQPPPPPSHPTPITSVAPAPPPP 451 >09_02_0082 - 4060018-4061604 Length = 528 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP--PXPXPPPXXPPPXXP 906 PR PP P P PP P P P PP PP P Sbjct: 330 PRSLVLTPPAPAPPVATPPTPATPVPTPPMTAPPADVP 367 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PP P PP PP P Sbjct: 245 PAPHLRVPRAPAPPVPAPLAPTPPIPTPPALAPPVDVP 282 Score = 31.5 bits (68), Expect = 0.95 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P + P PP P P PP P P P P P Sbjct: 407 PHLRVPRMLAPPIPMPPAPAPPVPTPSMPSPTVPAP 442 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +PR P P P P P PP PP PP Sbjct: 251 VPRAPAPPVPAPLAPTPPIPTPPALAPPVDVPP 283 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P P P P P P P P PP P P Sbjct: 417 PPIPMP---PAPAPPVPTPSMPSPTVPAPPVTAAPATAP 452 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +PR P P P P PP P PP P P P Sbjct: 166 VPRVLSPPAPTPPVLATHVPTPPAPAPP--VPTPLAP 200 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P Sbjct: 405 PAPHLRVPRMLAPPIPMPPAPAPPVPTPSMPSPTVP 440 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +PR P P P P P P P P PP Sbjct: 411 VPRMLAPPIPMPPAPAPPVPTPSMPSPTVPAPP 443 >08_02_0620 + 19387935-19388279 Length = 114 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GG GG G G GR GG Sbjct: 34 GGGGEGGSEGDGGEGGGGGGDVERGDG-GGGRWRAGG 69 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG G GG G G G G GRG Sbjct: 36 GGEGGSEGDGGEGGGGGGDVERGDGGGGRWRAGGRG 71 >08_02_0602 + 19183549-19184919 Length = 456 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG GG GG Sbjct: 61 GASGGGSGGGGGGGGGGGGGGGG 83 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GG G GG GG G GGG G G Sbjct: 50 GSGSGSGGSHRGASGGGSGGGGGGGGGGGGGGG 82 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG G G G GG GG G GGG Sbjct: 52 GSGSGGSHRGASGGGSGGGGGGGGGGGGGG 81 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 881 GGGXGXGGX--GGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG G GGG G G GG Sbjct: 50 GSGSGSGGSHRGASGGGSGGGGGGGGGGGGGGGG 83 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G GG GG G GGG G G Sbjct: 52 GSGSGGSHRGASG-GGSGGGGGGGGGGGGGGGG 83 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P PP P PP P P PPP P P Sbjct: 251 PTLPQPQHQAPP-PSHPPALPALPAPNAPPPPAPQSQPP 288 Score = 28.3 bits (60), Expect = 8.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 790 PXIPRPXXXPP----PXPXXPPXXPPXPP--XPXPPPXXPPPXXP 906 P P P PP P P PP P PP P P PP P Sbjct: 391 PYGPPPQSYPPNVRLPSPYVPPPSGPAPPFYGPNPGMYEPPAVRP 435 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPPP 902 P YPPP PP P PPPP PP P P Sbjct: 37 PQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQP 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP PP P PP PPP PPP Sbjct: 30 PPHQGYPPQGYPPPPGAYPPPPGAYPPP 57 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP P PP PPP Sbjct: 30 PPHQGYPPQGYPPPPGAYP--PPPGAYPPPPGAYPPP 64 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPP 897 P PPP PP PP P PPP PP Sbjct: 37 PQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPP 70 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 2/40 (5%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPP 899 P YPPP PP P PP P PPP Sbjct: 44 PGAYPPPPGAYPPPPGAYPPPPGAYPPQHGYPQPGGYPPP 83 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P P PPP P P P Sbjct: 36 PSPPPPPPSPVPSPAPPPPPHRPSPSPP 63 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P P P PP P P PPP Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPP 64 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P P PP PP P P PPP Sbjct: 36 PSPPPPPPSPVPSPAPPP--PPHRPSPSPPP 64 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPP 897 P P PP PP P P P PPP Sbjct: 32 PFRRPSPPPPPPSPVPSPAPPPP 54 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 RP PPP P PP PP P P PP Sbjct: 35 RPSPPPPPPSPVPSPAPPPPPH-RPSPSPPP 64 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPP 894 PPP P P PP P P P P P Sbjct: 41 PPPSPVPSPAPPPPPHRPSPSPPPNP 66 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P PP P P P P PPP P Sbjct: 20 PPKPFKPLSSAAPFRRPSPPPPPPSPVPSPAP-PPPPHRP 58 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP 864 PP P P PPP P P PP P Sbjct: 41 PPPSPVPSPAPPPPPHRPSPSPPPNP 66 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P P PP P Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPPNP 66 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P P P P P PP P P P P Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPPNP 66 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXX-----PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP P P P P P PPP Sbjct: 334 PPPAPSPSAAGAGSGPPPPP--PPAAPAAPRPPGPGPGPPPP 373 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 +PPP PP PPP P + PPPP Sbjct: 301 HPPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPP 336 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P P PPP P P Sbjct: 324 PPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRP 363 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPP------XPXPPPXXPPP 897 P PPP PP PP PP PPP P P Sbjct: 273 PAAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLP 309 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P P PPP P P Sbjct: 304 PPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSP 340 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P P PPP P P Sbjct: 322 PPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAP 361 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PP P P PPP P + PP P Sbjct: 328 PAAPAPPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPPGP 366 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 9/39 (23%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP---------PXPPXPXPP 879 P P P PPP P PP P P PP P PP Sbjct: 273 PAAPPPPAGPPP-PAPPPLPPSHHHHHGHHPPPPHPLPP 310 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P P P P PP PP PPP P Sbjct: 349 PPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALP 390 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP PP P PP P Sbjct: 398 PPPPPQPPPPPPPPPHQRETPSPSPPPQP 426 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P P PPP Sbjct: 398 PPPPPQPPPPPPPPPHQRETPSPSPPP 424 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPP---XPPXPXPPP 882 P PPP P PP PP P P PPP Sbjct: 396 PAPPPPPQPPPPPPPPPHQRETPSPSPPP 424 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P P P P P P Sbjct: 396 PAPPPPPQPPPPPPPPPHQRETPSPSPPPQPQFPCP 431 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP PP P P P P Sbjct: 396 PAPPPPPQPPPPPPPPPHQRETPSPSPP 423 >03_05_0292 + 22846273-22846377,22847161-22847823 Length = 255 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG GG G GG G G GGG GG G R G Sbjct: 45 GSHGGG---GGRGRGGGGGGRGDGARDGGGARGGGGRGARGGGGARG 88 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRGIXGG 786 G GGG G GG GG G GGG GRG GG Sbjct: 45 GSHGGGGGRGRGGGGGGRGDGARDGGGARGGGGRGARGG 83 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G G GGG G G GG Sbjct: 56 GGGGGGRGDGARDGGGARGGGGRGARGGGGARGGGGRHGG 95 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G GG G GG GGG G G Sbjct: 65 GARDGGGARGGGGRGARGGGGARGGGGRHGGEAATG 100 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 T PP PPP P PP PP PP P Sbjct: 1113 TLGPPLPDDRPPSPPPLPSSPPPVPPPPPAP 1143 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 820 PPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PPP PPP P Sbjct: 1116 PPLPDDRPPSPPPLP--SSPPPVPPPPPAP 1143 Score = 31.5 bits (68), Expect = 0.95 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P PP P P PP PP P P Sbjct: 1117 PLPDDRPPSPPPLPSSPPPVPPPPPAP 1143 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXP 891 P P PP P PP PPP P Sbjct: 1119 PDDRPPSPPPLPSSPPPVPPPPPAP 1143 >02_04_0021 + 18975992-18976408 Length = 138 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P PP P P P Sbjct: 97 PPPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +1 Query: 817 PPPXPX-XPPXXPPXPPXPXPPPXXPPP 897 PPP P PP P P P P P PPP Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 Score = 31.9 bits (69), Expect = 0.72 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P+P PP PP P PP P Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P P P P PP P PPP Sbjct: 98 PPPKPKPTPPPPAPTPKPPAPSPSPPPP 125 >02_01_0692 + 5179778-5181847 Length = 689 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P PP P PP PPP Sbjct: 253 PTPDMLAPPAQAPPPPAPAPPRAQPPP 279 >01_01_0929 - 7344911-7345978 Length = 355 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP----PXPPXPXPPPXXPPP 897 PP P PPP P PP P P P PPP PPP Sbjct: 23 PPSPPSKTRRPPPPP--PPFCPHLSVPCVGLPLPPPCPPPP 61 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P P P PP P P PP PPP P Sbjct: 3 PLHLQSPFLLWSPAPPTPPLPPSPPSKTRRPPPPPPPFCP 42 >11_04_0415 - 17395988-17396161,17397349-17397444,17397489-17398026, 17398106-17398422 Length = 374 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GG G G G GG G GGG G G G Sbjct: 4 GGGNPRGGGGGGPRGFGGGGPRGFGGGGPRGFGGGG 39 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G GG G G GG GG G GGG G G G Sbjct: 10 GGGGGGPRGFGGGGPRGFGG--GGPRGFGGGGPRGFGGGG 47 Score = 33.1 bits (72), Expect = 0.31 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G G GG GG G GGG G G Sbjct: 18 GFGGGGPRGFGGGGPRGFGG--GGPRGFGGGGPRGFG 52 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGG 819 G GGG G GG G G GG GG G GG Sbjct: 26 GFGGGGPRGFGGGGPRGFGG--GGPRGFGG 53 >11_01_0385 + 2915532-2916482 Length = 316 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP----PPXXPPPXXP 906 P P+P PP P P PP P P P PP P P P Sbjct: 236 PAWPQPGNKWPPLPPFPSHPPPTPAWPHPGNQWPPLPPFPFHP 278 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 7/40 (17%) Frame = +1 Query: 799 PRPXXXPPPXPXXP-------PXXPPXPPXPXPPPXXPPP 897 P P PPP P P P PP P P P P P P Sbjct: 202 PLPPFHPPPTPAWPHPGGNKWPPLPPFPSHPPPTPAWPQP 241 Score = 32.7 bits (71), Expect = 0.41 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXP 891 PP P P PPP P P PP PP P PP P Sbjct: 223 PPLPPFP-SHPPPTPAWPQPGNKWPPLPPFPSHPPPTP 259 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP---PXXPPXPPXPXPPPXXP 891 PP P P PPP P P PP PP P PP P Sbjct: 246 PPLPPFPSH-PPPTPAWPHPGNQWPPLPPFPFHPPPMP 282 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP P P PP P P P PP Sbjct: 259 PAWPHPGNQWPPLPPFPFHPPPMPAWPHPGNQWPP 293 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXXPPXPPXPXP----PPXXPPPXXP 906 P P P PP P P PP P P P PP P P P Sbjct: 212 PAWPHPGGNKWPPLPPFPSHPPPTPAWPQPGNKWPPLPPFPSHP 255 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P PP P P P PP P Sbjct: 191 PEWPHPGNKWPPLPPFHP--PPTPAWPHPGGNKWPPLPP 227 >10_08_0338 + 16916429-16916650,16916728-16917900 Length = 464 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G GG + GG Sbjct: 103 GGGGGGGGAGGGGGGGGGDAGGARTKKIFVGG 134 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG G G G GG GG GG Sbjct: 105 GGGGGGAGGGGGGGGGDAGG 124 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG GGG G GG GG GG G Sbjct: 103 GGGGGGGGAGGGGGGG--GGDAG 123 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGG 818 GGGG GG GGGG G GG Sbjct: 107 GGGGAGGGGGGGGGDAGGARTKKIFVGG 134 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G G GG G G G G G G Sbjct: 385 GNHGGYGGYGGRGDGAGNPAAGGGSGYGAGYGSGNGGSG 423 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 878 GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXK 771 GG G GG GG G GGG G G GG K Sbjct: 97 GGRHASGGGGGGGGAGGGGGG---GGGDAGGARTKK 129 >10_08_0127 - 15010125-15011068,15011328-15011835 Length = 483 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG GG G GGG Sbjct: 357 GSGLGGGGGGSGSGGGGGGVGGVGGG 382 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG G G G GG GG GG Sbjct: 363 GGGGSGSGGGGGGVGGVGGG 382 >10_07_0107 - 12936839-12937030,12937305-12937386,12937476-12937586, 12937667-12937918,12938004-12940237,12940328-12940525 Length = 1022 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P P P P P Sbjct: 585 PPPLRSPPRQPTPPPSPSQQPPLPTPQPVQASPTSP 620 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 576 PPSPRHLPSPPPL-RSPPRQPTPPPSPSQQPPLPTP 610 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P P P P P P P PP Sbjct: 573 PPEPPSPRHLPSPPPLRSP---PRQPTPPPSPSQQPP 606 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P P P PP PP PP P Sbjct: 568 PAPPSPPEPPSPRHLPSPPPLRSPPRQPTPPPSP 601 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPP 894 P P P PPP PP PP PP P PP PP Sbjct: 61 PSPPLPPLTPPP-AIVPPALPPPPPLPAIVVPPALPP 96 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXX--PPXXPPXPPXPXPPPXXPPP 897 T P +P PPP P PP PP P PP P P Sbjct: 69 TPPPAIVPPALPPPPPLPAIVVPPALPPTPAIAVPPALPPIP 110 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPP--XXPPXPPXP--XPPPXXPPPXXP 906 P P PP P PP P PP P PPP PP P Sbjct: 41 PAPTVVAPPLPTTPPPAVVAPSPPLPPLTPPPAIVPPALP 80 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 T PP + P PP P PP P P P P PP P Sbjct: 52 TTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLPAIVVPPALP 95 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 P P PP P PP P P PP PPP P Sbjct: 49 PLPTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPPPLP 86 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P PP PP P PP P P Sbjct: 66 PPLTPPPAIVPPALP--PP--PPLPAIVVPPALPPTP 98 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P PP PP PP PP P Sbjct: 43 PTVVAPPLPTTPPPAVVAP-SPPLPPLTPPPAIVPPALPP 81 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXX--PPPPXPPSXXPPPP 902 P PP PP P PPP P PPPP Sbjct: 43 PTVVAPPLPTTPPPAVVAPSPPLPPLTPPPAIVPPALPPPP 83 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPP 894 PPP PP PP PP PPP PP Sbjct: 257 PPPQSVRPPPPPPPPP---PPPPMPP 279 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP RP PPP P PP P PPP P Sbjct: 258 PPQSVRPPPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLP 297 Score = 33.1 bits (72), Expect = 0.31 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP PP P PPP PPP P Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPP 279 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPP 897 P PP PP P PPP PP Sbjct: 257 PPPQSVRPPPPPPPPPPPPPMPP 279 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P PPP P P PP PP P P Sbjct: 52 PALP-PPPPPPPAPFFPFLPDSAPPQLPPPVTTPAP 86 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P P P PP PP P Sbjct: 55 PPPPPPPPAPFFPFLPDSAPPQLPPPVTTP 84 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXX---PPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 PP P P PP P P PP P P PP P PP P Sbjct: 159 PPQDPAPSLPHAPAPPPPQAPAPTPPQAPAPTPPRAPTPTPPQAP 203 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP P P PP P P P Sbjct: 153 PPAPPSPPQDPAPSLPHAPAPPPPQAPAPTPPQA-PAPTPP 192 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P P P P PP P P PP P Sbjct: 171 PAPPPPQAPAPTPPQAPAPTPPRAPTPTPPQAPLP 205 Score = 29.1 bits (62), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PPP P P P Sbjct: 151 PSPPAPPSP-PQDPAPSLPHAPAP-PPPQAPAPTPP 184 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P+P PPP P P PPP PP Sbjct: 58 PPPPPQPAKEPPPPTKPKHPKPKQQQHPPPPPPQKPP 94 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P P P P P P PP P Sbjct: 56 PPPPPPPQPAKEPPPPTKPKHPKPKQQQHPPPPP 89 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P P PPP P Sbjct: 53 PHPPPPPPPPQPAKEPPPPTKP 74 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 P P P P P PP P P P PPP PPP P Sbjct: 53 PHPPPPPPPPQPAKEPPPPTKPKHPKPKQQQHPPP--PPPQKP 93 >05_07_0102 + 27700395-27700426,27701034-27702087,27703205-27703420 Length = 433 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G G G G GGG G G G Sbjct: 12 GGGNPRGGGGGGPRGCGGGGPRSGGGGGPRGGGGGG 47 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG---GXXGGXXGXGGGXXXGRG 798 G GG GG G GG G G GG G GGG G G Sbjct: 14 GNPRGGGGGGPRGCGGGGPRSGGGGGPRGGGGGGPRGSG 52 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG GG GGG G GG GGG Sbjct: 12 GGGNPRGGGGGGPRGCGGGGPRSGGGGGPRGGGG 45 Score = 28.7 bits (61), Expect = 6.7 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 8/44 (18%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--------GGXXXGRG 798 G GGG GG G G GG GG G G GG GRG Sbjct: 26 GCGGGGPRSGG-GGGPRGGGGGGPRGSGSSKPRRGDGGLGCGRG 68 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 GGG RGG G G G GG G GD Sbjct: 36 GGGGPRGGGGGGPRGSGSSKPRRGDGGLGCGRGD 69 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXG 789 G G GGG G GG G G G GGG G G Sbjct: 74 GLGYGGGGSGSDDGGGGLGFGVSGGGGGLRKRLGCGG 110 >05_03_0040 - 7646525-7647775 Length = 416 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P +P P P P P P P P P P P P P P Sbjct: 80 PKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKP 120 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 66 PKPTPKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPKP 106 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PP PP P Sbjct: 372 PEPKPEPKPYPEPKPEPKPKPKPEPKPEAPPKKHKPPHIP 411 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 56 PEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKPEP 96 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 88 PKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEP 128 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 100 PKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYP 140 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 110 PKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 150 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 120 PEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKP 160 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 142 PKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHP 182 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 154 PKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEP 194 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 174 PKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEP 214 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 182 PEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEP 222 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 190 PKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEP 230 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 198 PEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKP 238 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 206 PKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKP 246 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 214 PKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKP 254 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 220 PEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEP 260 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 226 PKPEPKPKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKP 266 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 232 PKPEPKPYPEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEP 272 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 240 PEPKPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKP 280 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 256 PKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKP 296 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 272 PKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKP 312 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 278 PKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKP 318 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 286 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKP 326 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 302 PKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEP 342 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 312 PEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEP 352 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 338 PKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEP 378 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 348 PKPEPKPQPEPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEP 388 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 354 PQPEPKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPKPKP 394 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 358 PKPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPKPKPEPKP 398 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 362 PKPEPKPEPKPEPKPEPKPYPEPKPEPKPKPKPEPKPEAPP 402 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 54 PEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKP 94 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 62 PKPHPKPTPKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKP 102 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 132 PKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKP 172 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 248 PKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKP 288 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 264 PKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKP 304 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 324 PKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKP 364 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 334 PKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKPEP 374 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 +P P P P P P P P P P P P P P Sbjct: 53 LPEPEPKPKPKPHPKPTPKPEPKPEPEPKPVPEPEPKP 90 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 T P P P P P P P P P P P P P P P Sbjct: 69 TPKPEPKPEPEPKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKP 112 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 94 PEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKPEPKPEPKP 134 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 116 PEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPKP 156 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 126 PEPKPEPKPEPKPYPEPKPEPKPEPKPEPKPEPKPKPEPKP 166 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 140 PEPKPEPKPEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKP 180 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 148 PEPKPEPKPEPKPKPEPKPHPEPKPDPKPEPKPHPEPEPKP 188 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 160 PKPEPKPHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEP 200 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 166 PHPEPKPDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEP 206 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 172 PDPKPEPKPHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKP 212 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 188 PEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKP 228 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 212 PEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKPKPEPKPEP 252 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 246 PEPKPEPKPEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHP 286 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 262 PEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEP 302 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 270 PEPKPEPKPKPEPKPHPKPEPKPEPKPEPKPEPKPEPKPEP 310 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 292 PEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYP 332 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 294 PKPEPKPEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEP 334 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 318 PEPKPEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEP 358 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 322 PEPKPEPKPYPEPKPDPKPEPKPHPEPKPEPKPQPEPKPEP 362 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 196 PHPEPEPKPEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEP 236 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 254 PEPKPEPKPEPKPEPKPEPKPEPKPKPEPKPHPKPEPKPEP 294 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 284 PHPKPEPKPEPKPEPKPEPKPEPKPEPKPEPEPKPEPKPEP 324 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 308 PEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKPEPKPHPEP 348 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P P P P P P P P P Sbjct: 344 PHPEPKPEPKPQPEPKPEPKPEPKPEPKPEPKPEPKPYPEP 384 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 86 PEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEPKPEPEPKP 126 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 108 PEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPEPKP 148 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 180 PHPEPEPKPEPKPEPKPHPEPEPKPEPKPEPKPEPKPEPKP 220 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 204 PEPKPEPKPEPKPEPKPEPKPKPKPEPKPKPEPKPYPEPKP 244 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 300 PEPKPEPKPEPKPEPEPKPEPKPEPKPEPKPYPEPKPDPKP 340 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 332 PEPKPDPKPEPKPHPEPKPEPKPQPEPKPEPKPEPKPEPKP 372 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 78 PEPKPVPEPEPKPEPKPEPKPEPKPEPKPYPEPKPEPKPEP 118 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP-XXPPXXPPXPPXPXPPPXXPP 894 P P P P P P P P PP PP PP Sbjct: 376 PEPKPYPEPKPEPKPKPKPEPKPEAPPKKHKPPHIPP 412 >04_03_0747 - 19251617-19251781,19252377-19252502,19252606-19252716, 19252931-19253679,19254034-19254167,19254595-19254740, 19255166-19255336,19255977-19256828 Length = 817 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPP 894 P + P PP P PP P P P P P P PP Sbjct: 118 PFVDAPEHISPPPPPPPPARTPMPTPTPTPTPTPTRPP 155 Score = 31.5 bits (68), Expect = 0.95 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P P P P Sbjct: 133 PPPARTPMPTPTPTPTPTPTRPPVPVWAAPLPARTPTPTP 172 >04_02_0026 + 8708765-8710935,8711021-8711272,8711353-8711463, 8711553-8711634,8711909-8712100 Length = 935 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P P P P P Sbjct: 498 PPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASPTSP 533 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 489 PPSPRHQPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 523 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P P P P P P P PP Sbjct: 486 PPEPPSPRHQPSPPPLRSP---PRQPTPPPSPSQQPP 519 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P P P PP PP PP P Sbjct: 481 PAPPSPPEPPSPRHQPSPPPLRSPPRQPTPPPSP 514 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P P PP PP PP P P Sbjct: 481 PAPPSPPEPPSPRHQPSPPPLRSPPRQPTPPPSPSQQPP 519 >03_02_1033 + 13550955-13551700,13552837-13553290,13553451-13553648, 13553726-13553807,13554496-13554590 Length = 524 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P PPP P P P Sbjct: 4 PRPQAPAGTPPMAPLPVPPPIAPIPAPP 31 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 PRP P P P PP P P PPP P P Sbjct: 4 PRPQAPAGTPPMAPLPVPPPIAPIPAPPPRAPAP 37 >03_02_1031 + 13541327-13542072,13543209-13543662,13543823-13544020, 13544098-13544179,13544868-13544962 Length = 524 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P PPP P P P Sbjct: 4 PRPQAPAGTPPMAPLPVPPPIAPIPAPP 31 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 PRP P P P PP P P PPP P P Sbjct: 4 PRPQAPAGTPPMAPLPVPPPIAPIPAPPPRAPAP 37 >01_02_0031 + 10364487-10365407 Length = 306 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPP-PXXPPP 897 PP P PP P PP P P P PPP Sbjct: 169 PPPPPPPPALPAPPPPPAPMLPLAPPP 195 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 +P P PP P PP PP P P PPP P P Sbjct: 168 VPPPPPPPPALPAPPP--PPAPMLPLAPPPTHVTPAMP 203 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PPP P P PP P P PP Sbjct: 175 PPALPAPP--PPPAPMLPLAPPPTHVTPAMPLSSMPP 209 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P P P Sbjct: 169 PPPPPPPPALPAPPPPPAPMLPLAPPPTHVTPAMPLSSMP 208 >01_01_0219 + 1863478-1864041,1864459-1865109 Length = 404 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P RP P P P P PP P P P PP P Sbjct: 52 PSSSRPIMQPSPSPETPCVWPPPLPSSTPTPAPSPPSTP 90 >12_02_0306 + 17307166-17309091 Length = 641 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 GGG GG GG G G G GGG G G GG Sbjct: 165 GGGARGGARDGGGAGAGVGCSLTGGGGGTLCGGGARGG 202 Score = 31.5 bits (68), Expect = 0.95 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G GGG G G GG Sbjct: 543 GGGARGGAPGGVGSGGGV-ALTGGGGGIVCGGGGSGG 578 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGX-GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G G GGG G G GG Sbjct: 316 GGGARGGARDGVGAGAGVGCSLTGGGGGILCGGGARGG 353 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXG-----XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG GG G G GGG G + GG Sbjct: 545 GARGGAPGGVGSGGGVALTGGGGGIVCGGGGSGGGGARGGFLLGG 589 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P PP PP P P P P Sbjct: 413 PPSPPPLRSPPRQPTPPPSPSQQPPLPAPQPVQASP 448 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PP Sbjct: 401 PPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 437 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PR PPP PP P PP P P P P Sbjct: 407 PPSPRHPPSPPPL-RSPPRQPTPPPSPSQQPPLPAP 441 Score = 31.5 bits (68), Expect = 0.95 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXP-PPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P P PP P PP PP PP PP P P Sbjct: 399 PAPPSPPEPPSPRHPPSPPPLRSPPRQPTPPPSPSQQPP 437 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PP P PP P Sbjct: 404 PPEPPSPRHPPSPPPLRSPPRQPTPPPS--PSQQPPLPAP 441 >10_08_0219 - 15972061-15972110,15972411-15972632,15972673-15972955 Length = 184 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G G G Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASG 61 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G G G GG Sbjct: 30 GGGGGGGGGGGGSNGGSGWGSGSGSGYGQASGGGAYASGG 69 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G GG G G GG Sbjct: 35 GGGGGGGSNGGSGWGSGSGSGYGQASGGGAYASGGGGAGG 74 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXG---GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G GG GGG G GG Sbjct: 103 GQGGGGGQNGGSGSGYGSGSGYGQAGGYGPYGGGYAQAGGQGGG 146 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G GG Sbjct: 36 GGGGGGSNGGSGWGSGSGSGYGQASGGGAYASGGGGAGGG 75 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G G G G GG GGG G G Sbjct: 41 GSNGGSGWGSGSGSGYGQASGGGAYASGGGGAGGGG 76 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G G G G G GG G G Sbjct: 99 GGGGGQGGGGGQNGGSGSGYGSGSGYGQAGGYGPYG 134 >09_01_0165 - 2436769-2437442,2438159-2438224,2438318-2438415, 2439856-2440214 Length = 398 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +1 Query: 817 PPPX--PXXPPXXPPXPPXPXPP-PXXPPPXXP 906 PPP P P PP PP P PP P PP P Sbjct: 245 PPPGQGPVLPRDAPPMPPPPSPPNPGAPPSYQP 277 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PPP P P P Sbjct: 244 PPPPGQGPVLPRDAPPMPPPPSPPNPGAP 272 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPP 894 +P P PPP P PP P PP P P PP Sbjct: 1154 MPLPPPPPPPLPPPPPVAPFHPPGPHFSGPSVPP 1187 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 820 PPXPXX-PPXXPPXPPXPXPPPXXPPP 897 PP P PP PP P P P P P P Sbjct: 1062 PPLPDDKPPSPPPLPSSPPPLPRPPCP 1088 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 854 PXPPXPXPPLXXPPP 898 P PP P PPL PPP Sbjct: 1155 PLPPPPPPPLPPPPP 1169 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP P P P P P Sbjct: 1158 PPPPPPLPP-PPPVAPFHPPGPHFSGPSVP 1186 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P PP P P PP P P P Sbjct: 1063 PLPDDKPPSPPPLPSSPPPLPRPPCP 1088 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P PPP PP PP P P P P Sbjct: 1195 QPPSVPPPNNAYHLQPPPHPPFPNQYPYPPEP 1226 >06_03_0464 + 21043706-21044305,21044418-21044460,21047402-21047421 Length = 220 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G GG G GG G GG Sbjct: 70 GGEGGGGGGGGDG-GGEDGRDGGGEGGGG 97 >05_01_0364 + 2855760-2855801,2855940-2856015,2856759-2857747 Length = 368 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G G G GGG G G Sbjct: 205 GNGNGGGGGGGGGGKKKGKKGGGGGGGGNGNG 236 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G GG G G G Sbjct: 207 GNGGGGGGGGGGKKKGKKGGGGGGGGNGNG 236 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G G GGG G G Sbjct: 207 GNGGGGGGGGGGKKKGKKGGGGGGGGNGNGNG 238 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PPP PP P Sbjct: 19 PPAPAPVPPPPPPPPPPPPANVP 41 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PP PP P PPP P Sbjct: 19 PPAPA--PVPPPPPPPPPPPPANVP 41 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 P P P PP PP PP P P Sbjct: 20 PAPAPVPPPPPPPPPPPPANVP 41 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPP 897 P P PP PP P PPP P Sbjct: 19 PPAPAPVPPPPPPPPPPPPANVP 41 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 12/42 (28%) Frame = +1 Query: 817 PPPXPXXPPXXPPX------------PPXPXPPPXXPPPXXP 906 PPP P PP PP P P PPP PPP P Sbjct: 366 PPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 12/44 (27%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXX------------PPXPPXPXPPPXXPPP 897 RP PPP P PP P PP P P P PPP Sbjct: 364 RPPPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 Score = 31.5 bits (68), Expect = 0.95 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPPXPPSXXPPPP 902 P PPP P P PPP PP+ PPPP Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 9/46 (19%) Frame = +1 Query: 787 PPXIPRPXXXPPPX---------PXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PP P PPP P Sbjct: 366 PPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPPLLAP 411 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 365 PPPPPPPPPPPPPP 378 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-----XXPPXPPXPXPPPXXPP 894 PP P P PPP P P P PP P PPP P Sbjct: 395 PP--PPPPTPPPPPPLLAPKQQSSGGPILPPAPAPPPLFRP 433 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 P PPP PP P PP PP PPPP Sbjct: 366 PPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPP 406 >04_03_1022 - 21778315-21779007 Length = 230 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 5/39 (12%) Frame = +1 Query: 805 PXXXPPPXPXXPPXX-----PPXPPXPXPPPXXPPPXXP 906 P PP PP PP PP P PPP PP P Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPPYVPPHLLP 54 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP----PPXXPPPXXP 906 +P P PPP P PP P P P PP PP P Sbjct: 35 LPPPPPPPPPPPYVPPHLLPPSPAPQQWYDHPPNYHPPHTP 75 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP PP PP P PP PP Sbjct: 17 PPPPPATRARPPCSSAHLLPPPPPPPPPPPYVPPHLLPP 55 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP---XPPSXXPPPP 902 P PP PP P PPPP PP PP P Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPPYVPPHLLPPSP 57 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPP 897 P P P P PP PP P P P P PPP Sbjct: 96 PTPAPAPSTTPGGHGGVPPYYPPPPVTPTPYYYPSPAPPP 135 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIP--RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P PP P P P PP PPP P Sbjct: 83 PYIPPHHPHHHHPPTPAPAPSTTPGGHGGVPPYYPPPPVTP 123 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,265,145 Number of Sequences: 37544 Number of extensions: 603879 Number of successful extensions: 37484 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16396 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -