BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O21 (906 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 58 1e-08 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 50 3e-06 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 49 6e-06 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 48 8e-06 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 48 8e-06 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 47 2e-05 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 46 6e-05 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 44 1e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 44 2e-04 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 43 4e-04 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 42 7e-04 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 42 0.001 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 42 0.001 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 42 0.001 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 41 0.002 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 40 0.004 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 40 0.004 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 39 0.005 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 39 0.005 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 39 0.005 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 39 0.005 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 39 0.006 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 39 0.006 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 38 0.008 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 38 0.008 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 38 0.008 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 38 0.011 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.015 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 38 0.015 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 37 0.026 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 37 0.026 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.026 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 37 0.026 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 37 0.026 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 37 0.026 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 37 0.026 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 37 0.026 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 36 0.045 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 36 0.060 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 36 0.060 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 36 0.060 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 35 0.079 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 35 0.079 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 35 0.079 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 35 0.10 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 35 0.10 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 35 0.10 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 34 0.14 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 34 0.14 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 34 0.14 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.18 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 34 0.18 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 34 0.18 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 34 0.18 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 33 0.24 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 33 0.24 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 33 0.24 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 33 0.32 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 33 0.32 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 33 0.32 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 33 0.32 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 33 0.42 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 33 0.42 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 32 0.55 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 32 0.55 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 32 0.55 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 32 0.73 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 32 0.73 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.97 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 31 0.97 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 31 0.97 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 31 0.97 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 31 0.97 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 31 0.97 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) 31 1.3 SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 31 1.3 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 31 1.3 SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) 31 1.3 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.7 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 30 2.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 30 2.2 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 30 2.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 30 2.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 30 2.2 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 30 2.2 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 30 2.2 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 2.2 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.5 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 30 3.0 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 3.0 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 30 3.0 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 30 3.0 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 30 3.0 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 29 3.9 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 29 3.9 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 29 3.9 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) 29 3.9 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 29 3.9 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 29 5.2 SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) 29 5.2 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 29 5.2 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 29 5.2 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 29 5.2 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 29 6.8 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 29 6.8 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 6.8 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 29 6.8 SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_10098| Best HMM Match : NADH5_C (HMM E-Value=0.94) 28 9.0 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 28 9.0 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 28 9.0 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 28 9.0 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.0 SB_36777| Best HMM Match : VWA (HMM E-Value=0) 28 9.0 SB_32048| Best HMM Match : NADH5_C (HMM E-Value=3.8) 28 9.0 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 28 9.0 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 28 9.0 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 28 9.0 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 55.6 bits (128), Expect = 5e-08 Identities = 21/40 (52%), Positives = 22/40 (55%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PPP P PP PP PP P P P PPP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 55.6 bits (128), Expect = 5e-08 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PP PP P PPP PPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 54.8 bits (126), Expect = 9e-08 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P PP P PPP PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 54.8 bits (126), Expect = 9e-08 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP PP PP PP P PPP PPP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 54.8 bits (126), Expect = 9e-08 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PP P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP P P PPP PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP PP P PPP PPP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP PPP PPP P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 54.4 bits (125), Expect = 1e-07 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP PP PP P PPP PPP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 53.6 bits (123), Expect = 2e-07 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP PP PP P PPP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 51.6 bits (118), Expect = 8e-07 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP PP PP P PPP PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP PP P PP PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P PP P PPP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 51.2 bits (117), Expect = 1e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP PP PP P PP PPP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PPP PP P PPPP PP+ PPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 42.3 bits (95), Expect = 5e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PPP P P PPPP PP PPPP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPPP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP PP PPPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PP PPPP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPPP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP PP PPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP P PPPP PP PPPP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP P PP PPPP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PP PPPP Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP P PP PP PP PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP PP P PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPP PP PPPP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PP P PP PPPP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP PP PPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP P PPPP P PPPP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P PPP PP P PPPP PP+ Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 404 PPPPPPPPPPPPP--------PPAPPPPPPPP--PPPPP 432 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 50.0 bits (114), Expect = 3e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PPP PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 48.4 bits (110), Expect = 8e-06 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP PP PP P PPP P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PPP P PP PP PP P PPP P Sbjct: 464 PPPPPPPPPPPPPPP--PPPPPPPPPFPPPPPPTP 496 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP 878 P PPP PP P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPP PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP---PPP 494 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP 878 P PPP PP P PPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 P PPP PP P PPPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 48.8 bits (111), Expect = 6e-06 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP PRP PPP P P PP PP P PPP P P Sbjct: 202 TQPPPPPPRPPPSPPPPPPPPSPSPPRPP-PPPPPSPPRP 240 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/40 (50%), Positives = 21/40 (52%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I +P PPP P PP PP PP P P P PPP P Sbjct: 198 PSQITQP---PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP 234 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-----PPXPPXPXPPPXXPPP 897 PP P P PPP P PP P PP P PP PPP Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-----PXPXPPPXXPPPXXP 906 PP P P PP P PP PP P P P P P PP P Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 796 GGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGG 835 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGG 822 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG GG G GGG G G G Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GGG G G G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDG 812 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG G G GGG G G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 43.2 bits (97), Expect = 3e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 810 GDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG GG G GGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG GG G GGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G G GG Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G GGG G G GG Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG G GG G GGG G G GG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGG 806 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG G G GG GG GG G GGG G G GG + Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVI 878 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG GG G GGG G G G Sbjct: 806 GYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G G GGG G GG GG GG G GGG G G+ Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 819 GGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGG 859 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG GG G GGG G G Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GGG G G GG Sbjct: 831 GDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G G GGG G G GG Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-----GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG GG G GGG G G GG Sbjct: 825 GDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 35.1 bits (77), Expect = 0.079 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GGG G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGG 825 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGG-GXXGGAGDXG 790 G GGG G G GG G G GG G GG GD G Sbjct: 801 GGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG G G GG G G GGG GG G G Sbjct: 835 GFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GG G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G G GGG G Sbjct: 780 GGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGG 818 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +G GGGG G GG GGG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGG--XGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GGG GG G G Sbjct: 818 GGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGG 858 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGXG-GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG G Sbjct: 821 GGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGG 860 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG G GGGG G GG GGG G Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G G GGG G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG 819 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 48.4 bits (110), Expect = 8e-06 Identities = 22/40 (55%), Positives = 22/40 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/39 (53%), Positives = 21/39 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GGG G G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 45.6 bits (103), Expect = 6e-05 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG GG G GGG G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 44.8 bits (101), Expect = 1e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 44.0 bits (99), Expect = 2e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G G Sbjct: 675 GGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG G G G G G G Sbjct: 681 GGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GG AG Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G GG G G GG GAGD Sbjct: 679 GGGGGGGGGGGGGGGGGGGGGG----GAGGAGAGAGD 711 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/37 (56%), Positives = 21/37 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/48 (43%), Positives = 23/48 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GGG GGG G G GG G G GGG G G GG V + + Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARF 118 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GG G G GG Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGG 104 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G G G G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G GG Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG G GGG G G GG Sbjct: 69 GGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G GGG G GG GG GG G GGG GR G Sbjct: 79 GGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG G G G G G GGG GG G GR Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGG--GGGGGVGR 115 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 46.4 bits (105), Expect = 3e-05 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P P PPP P PP PP P P PPP PP Sbjct: 682 VPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 IP PPP P PP PP PP P P P PPP P Sbjct: 676 IPIQTMVPPPPPPPPPP-PPPPPPPPPQPSTPPPPPP 711 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PP PP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PPP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P P PPP P P PP PP PP Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P PP PP PP P PPP PPP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPP--PPPPQP 703 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P PPP P P P PP P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP PP P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP-PSXXPPPP 902 PPP PP P PPPP P PS PPPP Sbjct: 683 PPPPPPPPP--------PPPPPPPPPPQPSTPPPPP 710 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G G GG Sbjct: 580 GNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGG 619 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G G GG Sbjct: 606 GNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P PP P P Sbjct: 689 PPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GG GG GG GG GG+ + G S G Sbjct: 516 GNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSNNGGNDGSNNNG 562 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GG Sbjct: 545 GNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGG 584 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXP 893 P + + P PPP PP P PPP PPS P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPP------PPPQPSTPPPPPPSTPP 715 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P PP P PPP PP P Sbjct: 151 PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP P P PPP PP P Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP PP P P P PPP P Sbjct: 164 PPNPPPPNAPYPPPPYPPPPNPPYPPPPNP-PYPPPPNAP 202 Score = 45.2 bits (102), Expect = 7e-05 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 PP P P PP P P PP PP P PP P PPP P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP--PPXXPPPXXP 906 PP P P PPP P PP PP P P P PP PPP P Sbjct: 100 PPYPPPPPYPPPPNPPYPP--PPNAPYPPPPNPPYPPPPNAP 139 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P P PPP PPP P Sbjct: 149 PPPPNPPYPPPLYP--PPPNPPPPNAPYPPPPYPPPPNP 185 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP PP PP P P P PPP P Sbjct: 90 PNPPYPPPPYPPYPPP-PPYPPPPNP-PYPPPPNAP 123 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPX---PXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PP P Sbjct: 92 PPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPP 135 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 PP P P PP P P PP PP P PPP PPP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP PP P P PPP PP P Sbjct: 176 PPPYPPPPNPPYPPPPNPP-YPPPPNAPNPPPPNPPYPPP 214 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP--PPXXPPPXXP 906 P P P PPP P PP PP P P P PP PPP P Sbjct: 180 PPPPNPPYPPPPNPPYPP--PPNAPNPPPPNPPYPPPPNAP 218 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P PP PP P PP PP P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPX-PXXPPXXPPXPPXPXPP--PXXPPPXXP 906 P P P PPP P PP PP PP P P P PPP P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPP--PXXPPPXXP 906 T P P P PP P PP PP PP P PP P PPP P Sbjct: 86 TNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPP 131 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P P PP PP P PPP P P P Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYP-PPPNAPYPPSP 144 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 PP P PP P PP PP PP P PP P PPP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPP-PPNPPPPNAPYPPPPYPP 181 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 PP P P PP P PP P PP P PP P PPP P Sbjct: 198 PPNAPNPPPPNPPYP--PPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P PP P P PPP PP P Sbjct: 119 PPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P P P P P P PP P PPP PPP P Sbjct: 127 PPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPX-PPXPXPPP---XXPPPXXP 906 PP P P P P P PP PP PP P PPP PPP P Sbjct: 135 PPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYP 180 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 P P P PP P PP PP PP P PP PP P Sbjct: 173 PYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P PP P P P PP P PPP P P P Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPPP PP P PPPP PP PP P Sbjct: 158 PPLYPPPPNPPPP---NAPYPPPPYPPPPNPPYPPPPNP 193 Score = 37.1 bits (82), Expect = 0.019 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PP PP P PP PP P Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPP 118 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 P P P P P P PP PP P P PP P PPP P Sbjct: 114 PPYPPPPNAPYPPPPNPP-YPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +3 Query: 720 YPXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 YP Y P P PPP PP P P PP PP PPP Sbjct: 108 YPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPP---PNPPYPPPLYPPP 164 Query: 900 P 902 P Sbjct: 165 P 165 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 PP P PP P PP P PP P P P P P P Sbjct: 117 PPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYP 157 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 A YPPP PP P PPP P PP PPPP Sbjct: 146 APYPPPPN--PPYPPPLYPPPPNPPPPNAPYPPPPYPPPP 183 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXX-PPPPXPPSXXPPPP 902 YPPP PP P PPPP PP PPPP Sbjct: 102 YPPPPPYPPPPNPPYPPPPNAPYPPPPNPP--YPPPP 136 Score = 35.1 bits (77), Expect = 0.079 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP P PPPP Sbjct: 177 PPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 1/62 (1%) Frame = +3 Query: 720 YPXXXLSSYXXPXXVXXLXXXXP-AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 YP Y P P A YPPP PP P P PP P + PP Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP--PPNPPYPPPPNAPNPP 205 Query: 897 PP 902 PP Sbjct: 206 PP 207 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P P PP PPP P Sbjct: 125 PPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP-YPPPLYP 162 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P YPPP P P PP P PP+ PP Sbjct: 105 PPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPP 142 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP P + PP P Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP 144 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPPP P P P P PP+ PPP Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PP P P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNP 231 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP P + PP P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYP 223 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP P P PPPP PP PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYP 117 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P PP P PPP PPP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNP 114 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPP--PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPP P PP P P PP PP+ PPP Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP-PPNPPYPPP 135 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP PPPP P+ PPP Sbjct: 198 PPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +3 Query: 720 YPXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP 878 YP Y P P PPP PP PPPP P Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPSXXPPPP 902 P + P PP P PPP P PP+ PPP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 795 YPPPXXX--XPPXXXXXXXXP-XXXPPPPXPPSXXPPPP 902 YPPP PP P PPPP P+ PPP Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 45.6 bits (103), Expect = 6e-05 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G GGG G G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/34 (55%), Positives = 19/34 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG G GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/33 (57%), Positives = 19/33 (57%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG GG G GGG G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 41.9 bits (94), Expect = 7e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG GG GG G GGG G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG G D G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G GG GGG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G GG G G GGG GG GD Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGG----GGGGGGGGGGD 167 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/36 (55%), Positives = 20/36 (55%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 94 GGGGGGGFGGGGG-GGFGGGGGGGGGFGGGGGGGFG 128 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GG GGG G GG GG GG G GGG R Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG G G GGG G G GG Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG GG G G GGG G G G Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXS 778 GGG GG G GG G G GGG GG G R S Sbjct: 96 GGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARPAS 135 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GGG GG GGGG G GG GG G R Sbjct: 88 GGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSR 130 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 43.6 bits (98), Expect = 2e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP P P P PPP PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 42.3 bits (95), Expect = 5e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 IP P PPP P P PP PP P PPP Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP P P PP P PP PP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P P PPP PP PP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 PPP PP P PPPP P+ Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPPTPT 1187 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG---XGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 180 GYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGG 222 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG G G GGG G G GG Sbjct: 160 GYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGG 199 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG G G GGG G G Sbjct: 165 GRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGG 200 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GGG G G GG Sbjct: 175 GYGGGGYGGGGHGGGGYG---GGGYGGGGGGYGGSGYGGG 211 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG G G GGG G G GG Sbjct: 158 GGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGG 194 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G G G GG GGG GR GG V Sbjct: 189 GGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGGYEV 231 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GGG GRG GG Sbjct: 130 GGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGG 169 Score = 38.3 bits (85), Expect = 0.008 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXG---GXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG G G G GGG G G GG Sbjct: 145 GGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 36.3 bits (80), Expect = 0.034 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG GGG G G GG Sbjct: 124 GGGRRGGGYG-GGRGG--GGGYRSGGGYRGGGGYRGG 157 Score = 35.5 bits (78), Expect = 0.060 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 GGG GGG G G G GG G G GG G G GG Sbjct: 151 GGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGG 189 Score = 35.1 bits (77), Expect = 0.079 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GGG G Sbjct: 167 GGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGG 205 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 184 GGHGGGGY-GGGGYGGGGGGYGGSGYGGGGGYGGGGYGG 221 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G G G GG G G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG 216 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G GG GG G Sbjct: 172 GGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGG 210 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G G G G GG Sbjct: 139 GGGYRSGG-GYRGGGGYRGGGGGYRGRGRGGGGYGGG 174 Score = 31.5 bits (68), Expect = 0.97 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G GG G G GGG GG G G Sbjct: 123 GGGGRRGG-GYGG-GRGGGGGYRSGGGYRGGGGYRG 156 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GG G G Sbjct: 153 GYRGGGGGYRGRGRGGGGYGGGGY---GGGGYGGGGHGG 188 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXG-XGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G GG G G GG GG G G Sbjct: 141 GYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGG 180 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG RGG G G G G GGG GG G Sbjct: 147 GYRGGGGYRGGGG-GYRGRGRGGGGYGGGGYGGGGYGGG 184 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXX-GGXXXXGGG*XAG 785 GGGG GG GGGG G GG GGG G Sbjct: 177 GGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGG 216 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXG-GXXXXGGG*XAG 785 GGGG GG GGGG G G G GGG G Sbjct: 187 GGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGG 226 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 901 GGGGXXEGGXGGG-GXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGG G G GG GGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGG 158 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG GG GG G G GGG GG G Sbjct: 126 GRRGGGY--GGGRGGGGGYRSGGGYRGGGGYRGGGG 159 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG R G G G G G G GG G G Sbjct: 135 GRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGG 173 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGG--GXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG G RGG G GG G G GGG GG G Sbjct: 156 GGGGGYRGRGRGGGGYGGGGYGGGGYG--GGGHGGGGYGGG 194 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 43.2 bits (97), Expect = 3e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PPP P PP PP PP PPP Sbjct: 371 TNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP P PP PP PPP PP P Sbjct: 351 TNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGP 394 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP---XXPPXXPP---XPPXPXPPPXXPPPXXP 906 T P P P PPP P PP PP PP P PP PPP P Sbjct: 361 TNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 PP P PPP PP PP P PPP PPP P Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP P PPP P P PP P P P PPP PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP+ PPPP Sbjct: 354 PPSPPPPTNNTPPPPP-----PTNKPPPPPPPTNGPPPP 387 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 817 PPPXPXXPPXXPPXP----PXPXPPPXXPPPXXP 906 PPP P P PP P P P PP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 35.1 bits (77), Expect = 0.079 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 P P PP P P P PP P PPP PP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGP 384 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PP+ PPPP Sbjct: 347 PPPPTNNPP----SPPPPTNNTPPPPPPTNKPPPP 377 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPPP PP+ PP Sbjct: 384 PPPPPPPTNGPPPPPP-----PTNGPPPPPPPTNGPP 415 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 853 PXPPXPXPPPXXPPPXXP 906 P PP P PPP PP P Sbjct: 75 PAPPPPPPPPSSGPPLPP 92 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP P P PPP P Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP P PP PPP P Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P PPP P P PP P P PPP P Sbjct: 76 PPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P PP P P PPP P P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P P PP P P P PPP Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 35.1 bits (77), Expect = 0.079 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX----PPPXXPPPXXP 906 PP P PP P P PP P P PPP P P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P P P PPP PP+ PPPP Sbjct: 51 PPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P P P P PP P P P PP P Sbjct: 81 PPAAP-PPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T P I PPP P P P PP P P PPP Sbjct: 40 TYYPHFISSSPPPPPPSP--PAAAPAAPPPPAAAPAAPPP 77 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXX----PPPPXPPSXXPPPP 902 PPP PP P PPPP P PPPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPP 88 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 42.7 bits (96), Expect = 4e-04 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPP 897 T P +P PPP PP PP PP P PPP PPP Sbjct: 175 TVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPP 218 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P P PP P P PP P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 P P PPP P P P PP P P P PPP P Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAP 159 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 11/51 (21%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP------PXXP-----PXPPXPXPPPXXPPPXXP 906 PP P PPP P P P P P PP PPP PPP P Sbjct: 155 PPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P PPP PPP P Sbjct: 168 PPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P PPP P P P PP P P P P P Sbjct: 142 PPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVP 182 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 PP I P P PP P P P PPP PPP P Sbjct: 167 PPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP PP P P PPP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAP--PPP 219 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP--XXPPXPPXPXPPPXXPPPXXP 906 PP PPP P P PP PP P PPP P Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP 169 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + + PP P P P P P PPP P P Sbjct: 100 PMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAP 138 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PR P P PP PP P PP PPP P Sbjct: 110 PPPPPRAPETPSQAPSPPP--PPTSPATRAPPP-PPPIAP 146 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP PPPP Sbjct: 191 PSGGPPPPPPPPPPPPPP 208 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 805 PXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P P P PP P P PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP 142 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP----PXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P P PP P P P P P P Sbjct: 86 PPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPP 129 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PPP PP P PPPP PPPP Sbjct: 185 AASPPPPSGGPPPPPPPPPPP---PPPPILELAAPPPP 219 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPP P + PPPP Sbjct: 108 PTPPPPPRAPETP-----SQAPSPPPPPTSPATRAPPPP 141 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G G GG Sbjct: 113 GGRGGGGYGGGRGGGGYGGGRGGGYG-GGRRDYGGGSKGG 151 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/40 (52%), Positives = 21/40 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG GR GG Sbjct: 109 GGYGGGRGGGGYGGGRGGGGYGG--GRGGGYGGGRRDYGG 146 Score = 35.1 bits (77), Expect = 0.079 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXG-GGXXXGRGIXGG 786 G GG GG G GG GG GG G G GG G G GG Sbjct: 90 GSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGG 132 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG G G GG GG G GGG GRG Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRG-GGGYGGGRG 134 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGGXXVXKXXY 762 GGG GG G GG GG G G GG G G GG + Y Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDY 144 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G G G G GGG GG D Sbjct: 118 GGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGGYD 154 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG GG GG G GGG GG GR G Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGG 131 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 41.5 bits (93), Expect = 0.001 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP PP P PPP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PRP PP P PP PP PP P PPP Sbjct: 860 PRPRPRRPPPPPPPP--PPPPPPPPPPP 885 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P PPP PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP 864 P PR PPP P PP PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDG 346 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G G G G G G Sbjct: 311 GGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDG 350 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG GG G GGG G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G G Sbjct: 316 GGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDG 352 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GG GR GG Sbjct: 200 GGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGG 239 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G GG G GG G GGG GRG G Sbjct: 182 GSQGGGYRSGGGGYGGSKGGYGGGSG-GGGYGGGRGGGG 219 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG GGG G Sbjct: 213 GGRGGGGYGGGHGGGGYGG--GGRHDYGGGSKGG 244 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G GG G G GG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGG 227 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG +GG G G G GGG GG GR G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGG 222 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G GG GGG G Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGG 244 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG G GG GG G G Sbjct: 218 GGYGGGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG G G GG G G GG GG G G Sbjct: 193 GGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGG 231 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG-GAGDXG 790 G GGG GG G GG G G GGG G G G Sbjct: 205 GSGGGGYG-GGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = -1 Query: 906 GXXGGGXXRGG----XGXGGXGXXXGXXXXXGGGXXGGAGD 796 G G G RGG G GG G G GGG GG D Sbjct: 207 GGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKGGGYD 247 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GGG G GG GG GG G GG GRG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 36.3 bits (80), Expect = 0.034 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 878 GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G GG GG GG G GGG GRG GG Sbjct: 337 GGSGRGGGGGGGGG--GGGGGGGGGRGGGGG 365 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 882 RGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 RGG G GG G G GGG GG G G S G Sbjct: 336 RGGSGRGGGG--GGGGGGGGGGGGGGRGGGGGFSSRGRG 372 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G+ GG Sbjct: 276 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG 315 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 287 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 294 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 301 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GG G GG Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 280 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GG G GG Sbjct: 320 GGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 245 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 284 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 252 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 291 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 259 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 266 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 305 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 280 GATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGG 319 Score = 35.5 bits (78), Expect = 0.060 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG----XGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G G GG Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGG 326 Score = 35.1 bits (77), Expect = 0.079 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G G GG G G+ GG Sbjct: 313 GGGATGG--GGGATGGGVGATGGGGGATGGGGGVTGG 347 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GG G GG Sbjct: 297 GGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGG 336 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG G G GG G G G Sbjct: 273 GATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 896 GGGXXGGGXGX-GGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG G G G Sbjct: 334 GGGATGGGGGVTGGGGGATGGGGGPGSG 361 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG GG G GGG G G G Sbjct: 322 GATGGGVGATGGGGGATGG-GGGVTGGGGGATGGGGGPG 359 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G GG G G GG Sbjct: 294 GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGG 333 Score = 31.5 bits (68), Expect = 0.97 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G G GG G G GG Sbjct: 315 GATGGG--GGATGGGVGATGGGGGATGGGGGVTGGGGGATGG 354 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG GG G GG GGG G G G Sbjct: 326 GGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G G G GG GG G+ G Sbjct: 329 GATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GG GG G G Sbjct: 239 GRLGGGGATGGGG-GATGGGGGATGGGGGATGGGGGATG 276 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = -2 Query: 893 GGXXGGGXGXGGXG--GXXGGXXGXGGGXXXGRG 798 G GGG GG G G GG G GGG G G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGG 272 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -3 Query: 901 GGGGXXEGGXG---GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATG 311 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -3 Query: 901 GGGGXXEGGXG----GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG +G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSG 361 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P PPP PPP P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP PP PP PPP PPP P Sbjct: 954 PPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-----XPPXPXPPPXXPPP 897 PP P PPP PP PP PP PP PPP Sbjct: 936 PPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXX---PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P PP PP PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPSXXPPPP 902 P PPP PP P PPP P PP PPPP Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLP---PPPGGSAPPPPPPPPPPP 992 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP P PPP Sbjct: 914 PPGGSVPPPPPPPGGNAP--LPPPPPGGSAPSQPPPP 948 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-----XPPXPXPPPXXPPP 897 PP P PPP P PP PP P P PPP Sbjct: 925 PPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PP PP P PPP PPPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP PPPP PP PPPP Sbjct: 964 PPPGGGAPPLPPPPGGSAPPPPPPP-PP---PPPP 994 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P PPPP + PPPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPP 958 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPP 897 P P PP P P P PP P P PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPP 947 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-----XXPPPXXP 906 PP P P P P PP P PP P PPP PPP P Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP PP PP PP P PPP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P PP PP PP PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPP 323 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PPP P PP PP PPP PP Sbjct: 304 PPPPPPPGGAPPPPP--PPPPPPPGDGGAPPPPPPP 337 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I P P P P PP P PP PPP P Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPP 319 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA P PP P PPPP PPPP Sbjct: 296 PADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P PPPP PP PPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP---PPPP 325 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PPP PP P PP PP PPPP Sbjct: 289 APVPPP----PPADGSAPAPPPPPPPGGAPPPPPPPPP 322 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PPPP Sbjct: 304 PPPPPPPGGAPPP-------PPPPPPPPPGDGGAPPPPP 335 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G GGG G G GG Sbjct: 756 GGGYRGGG-GYGGGGGGYRGGGGYGGGHRGGGGYGGG 791 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G GG G GGG GG G G Sbjct: 752 GNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGG 790 Score = 35.1 bits (77), Expect = 0.079 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GGG G G GG Sbjct: 758 GYRGGGGYGGGGGGYRGGGGYGGGH-RGGGGYGGGGHRGG 796 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG GG G G G G GGG GG G G S G Sbjct: 762 GGGYGGGGGGYRGGGGYGGGHR--GGGGYGGGGHRGGSYSGYRG 803 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G GG Sbjct: 771 GYRGGGGYGGGHRGGGGYGG--GGHRGGSYSGYRGSYKSGG 809 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/41 (48%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G GGG GGG GG GG GG GGG G G+ GG Sbjct: 1761 GGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGG 1801 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/41 (53%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG-XGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 1756 GGFGGG--GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGG 1794 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/37 (56%), Positives = 22/37 (59%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G+ GG Sbjct: 1788 GGGEFGGGEGMGG-GGMAGGGGGMGGG---GGGMGGG 1820 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/37 (48%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G GG GG G G+ GG Sbjct: 1770 GGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGG 1806 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G G G G Sbjct: 1797 GMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGG 1835 Score = 37.9 bits (84), Expect = 0.011 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG G GGG G G GG Sbjct: 1790 GEFGGGEGMGGGGMAGGGGGMGGGGGGMGGG-GEGMGAAGG 1829 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG GG G GGG G G Sbjct: 1772 GMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGG 1807 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXX-GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G GG G GGG G G GG Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGG 1819 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G G GG G G GGG G G Sbjct: 1811 GGGGGGMGGGGEGMGAAGGGMGA-GGEGGGAGGGGG 1845 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G G G G G GG Sbjct: 1807 GGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 35.5 bits (78), Expect = 0.060 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGGXXVXK 771 G G G GGG G GG G G GG G GG G GG K Sbjct: 1806 GGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQK 1851 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGGGXG--XGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 GGG GG G GG GG GG G G G G G GG Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGG 1838 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIP--RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP PP PP PPP P Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP P P P P PP PP P P PP PP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAP 202 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P PP P P PPP PP Sbjct: 175 PAAP-PAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 P I PP P P P PP P PPP P PP P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAP-PPPGAPAAPPAPP 194 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 P + P PPP P P PPPP PP Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P PP PP P PP P P P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGP 59 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P PP PP PP P PP P P Sbjct: 706 PPGLPGPPG--PASPPSPPG-PPGPPGPNGPPGPNGPLGP 742 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P PP PP PP P PP P P Sbjct: 791 PPGLPGPPG--PASPPSPPG-PPGPPGPKGPPGPNGPLGP 827 Score = 32.7 bits (71), Expect = 0.42 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP PP P P P P P Sbjct: 627 PPGPASPPS-PPGPPGPPGPKGPPGPNGP 654 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPP--PXXPP 894 P P P PPP P P P PP P P P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPP 66 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P P P PP P P P Sbjct: 32 PPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGP 74 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 817 PPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP PP P PP P P Sbjct: 876 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PP P PP PP PP P P P PP Sbjct: 877 PGLPGPPGPASPPS-PPGPPGP-PGPKGPP 904 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 PP +P P P PP PP P P P PP P Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLP 130 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P P P P PP P P Sbjct: 275 PPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGP 317 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P P P P PP P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLP 69 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP--PXPPXPXPPP 882 P PP P PP P P PP P PP Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXP--PXXPPXPPXPXPPPXXP-PPXXP 906 PP P P P P P P P PP P P PP PP P Sbjct: 41 PPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXX--PPXPPXPXPPPXXPPP 897 P P P P PP P PP PP P P PP P Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPGESGP 663 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP P P P P P Sbjct: 111 PPGPPGPP-GPQMPPGPPGLPGPPGPAGP 138 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P PP P PP P P P P PP P P Sbjct: 367 PGLPGPPGPQMPPGPPGLPGAPGPKGPPGTNGPLGP 402 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P PP P PP P P P P PP P P Sbjct: 452 PGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGP 487 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 P PP P PP P P P P PP P P Sbjct: 537 PGLPGPPGPQMPPGPPGLPGAPGPNGPPGINGPLGP 572 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPP 879 PP +P P PP P PP PP P P P Sbjct: 876 PPGLPGPPGPASPPSPPGPPG-PPGPKGPPGP 906 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P PP PP P Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFP 54 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I P P P P PP PP PP P P P Sbjct: 169 PAGIQGPNGLPGPNG---PLGPPGPPGDMGPPGLPGPQGP 205 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXX--PPXPPXPXPPP 882 P P P P PP P PP PP P P PP Sbjct: 710 PGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 3/34 (8%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXX--PPXPPXPXPPP 882 P P P P PP P PP PP P P PP Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG G GG G GGG G G G Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGG 180 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G GG GGG GRG G Sbjct: 169 GGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGG 203 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXG-GXGGXXGGXXGXGG-GXXXGRGIXGG 786 G G G GG G G G G GG GG G GG G G G GG Sbjct: 137 GGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGG 179 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G GG G G GGG GG G Sbjct: 150 GGGRGRGG-GEGGWGGRGGNGGGRGGGEGGGGRGRG 184 Score = 31.5 bits (68), Expect = 0.97 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G GG G G GG Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGGRGGG 175 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GG GG G GG G GGG GG GD Sbjct: 160 GGWGGRGGNGG-GRGGGEGGGGRGRGTGGGSRGGGGD 195 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = -1 Query: 906 GXXGGGXXRGGXGX-----GGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G GG G G GGG G G+ G Sbjct: 118 GWRRGGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGG 161 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GG G GG GG GG G GGG G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGG 104 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G G G G G Sbjct: 81 GGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG GG G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG----XXGGXXGXGGG 816 G GGG GGG G GG GG GG G GG Sbjct: 87 GGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG GG GGGG G G GGG Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGG 113 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GGGG G GG GG Sbjct: 86 GGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG G GG G GGG G G Sbjct: 70 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGG-XXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 74 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 111 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG GG GGG Sbjct: 83 GGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 112 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GG G G GG G G GGG GG D Sbjct: 78 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGND 114 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG G GGGG G GG GGG G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 110 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG G G Sbjct: 95 GDGGGGGDGGGGGDGGGGNDDDG 117 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GG G GG Sbjct: 55 GATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGG 95 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 91 GDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGG 130 Score = 38.3 bits (85), Expect = 0.008 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GG G GG Sbjct: 98 GGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGG 137 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 60 GATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G G G GG Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGG 102 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GG G GG Sbjct: 77 GGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGG 116 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRG 798 G GG GGG GG G GG G GGG G G Sbjct: 44 GGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHG 80 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG G G G GG GG G GGG G G G V Sbjct: 81 GATGGGGGATGDGGGATGG-GGGATGGGGGATGGHGGATGGGV 122 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG GG GG GG G GG Sbjct: 140 GGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG G G GG G G GG Sbjct: 116 GATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGG 155 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG G G GG GG GG GGG G G Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGG 72 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGG--GXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G G G GG G G GG G G G Sbjct: 51 GGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATG 91 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRG 798 G GG G GG G GG G GG G GGG G G Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGG 108 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXG-GXXGGXXGXGGGXXXG 804 G GG G GG G GG G GG G GGG G Sbjct: 133 GGHGGATGGHGGATGGGGGATGGGGGATGGGGGATGG 169 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = -3 Query: 901 GGGGXXEGGXGG----GGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GG GG G GG GGG G Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATG 112 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G G G G GG GG G G Sbjct: 71 GGGGATGGHG-GATGGGGGATGDGGGATGGGGGATG 105 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G G G G G G GG GG G G Sbjct: 88 GATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATG 126 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G G GGG G GG GG GG G GGG G G GG Sbjct: 200 GGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 38.3 bits (85), Expect = 0.008 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GGG GG G GG G GG G GGG GRG GG + Y Sbjct: 186 GSQGGGYRSGGGGYGGSSRGGYGGGRG-GGGYGGGRGGGGGYGGGRRDY 233 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G G G GGG GG D G Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYG 234 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG--GXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G G G G G GGG GG D Sbjct: 205 GGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGGYD 243 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG GG GG G GGG GG GR G Sbjct: 184 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYG 227 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G G G GG GG G G Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 218 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG GG GG G G Sbjct: 214 GGYGGGRGGGGGYGGGRRDYGGGSKGGG 241 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG G GG G GGG G G Sbjct: 85 GDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/38 (52%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGG-XXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GGG G G Sbjct: 89 GGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGG 126 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG GG GGG Sbjct: 98 GGGDGDGGGGGDGDGGGGGDGGGGGDGGGG 127 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GG G G GG G G GGG GG D Sbjct: 93 GGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGND 129 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG G GGGG G GG GGG G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGG 125 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG G G Sbjct: 110 GDGGGGGDGGGGGDGGGGNDDDG 132 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG G GG G GG Sbjct: 101 GRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGG 140 Score = 35.1 bits (77), Expect = 0.079 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G GG GG GG GGG G Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG GGG G G GG Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGG 128 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXE-GGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG E GG GGGG G GG GGG G Sbjct: 92 GGGGRRERGGRGGGGGYGG--GGGYGGGGRSYGGGGGGGG 129 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P PP P PP P P P PP PPP P Sbjct: 2614 PPMVPM--MLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGP 2651 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPP 879 PP +P P P P P PP PP P PP Sbjct: 2622 PPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P PP P P P PPP PP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPP 222 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PPP PP P PPPP PP PPPP Sbjct: 192 AGMPPPPPPPPPPGF-----PGGAPPPPPPPFGAPPPP 224 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 817 PPPXPXXPPXXPP--XPPXPXPPPXXPPP 897 PPP P PP P PP P PP PPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P PPP PP P Sbjct: 188 PSPMAGMPPPPPPPP--PPGFPGGAPPPPPPPFGAP 221 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 38.7 bits (86), Expect = 0.006 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P P P P P PP P P PPP PPP P Sbjct: 885 TKNPKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T P P PPP P PP PP P PPP Sbjct: 946 TTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 35.1 bits (77), Expect = 0.079 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP IP PPP P PP PP P P PP Sbjct: 959 PPPIPATQVPPPPLPPLPP--PPPPVQTTTAPTLPP 992 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP PP P P P P PPP P Sbjct: 952 PPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P PP P PP P P P PP P P Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 RP PP PP P P PP PPP Sbjct: 948 RPTPPPPTSALPPPIPATQVPPPPLPPLPPPP 979 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PPP PP P Sbjct: 949 PTPPPPTSALPPPIPATQVPPPPLPPLPPP 978 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP PP PP P PP PP P Sbjct: 368 PPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P PPP P PP PP PPP PP Sbjct: 346 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPPXXP 906 PP R PPP PP P P PPP PPP P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXX----PPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P PPP PP P Sbjct: 339 PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP + PPP P PP PP PP PPP P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPP 397 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP PPP Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 PP R PP PP P P PPP PPP P Sbjct: 338 PPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P PPPP S PPPP Sbjct: 307 PPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPP 897 PP PPP P PP P PPP PPP Sbjct: 317 PPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP IP P PP P P PP P P P P P P PPP P Sbjct: 54 PPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 44 PPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 88 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 64 PPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 74 PPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P PP P P PP P P P P P P PPP P Sbjct: 34 PPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTP 78 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P PPP P PP P P PPP P P P Sbjct: 24 PPNTTIPRA-PPPNTAIPGDRPPNTPIPGDPPPNIPIPGNP 63 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P PP PP P P PPP P Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP P PP PPP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPP-PEPPEECPPP 589 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 557 PPPGVDIPPPLPPSED-PKPPPPPPEPPEECPPPP 590 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP + P PP PP PP PP PPP PP Sbjct: 558 PPGVDIPPPLPPSEDPKPPPPPPEPPEECPPP--PP 591 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PPP PP PP P P PPP PP P Sbjct: 557 PPPGVDIPPPLPPSEDPKPPPPPPEPPEECP 587 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP PP P P PPP Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEP-PEECPPPP 590 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P P P P PP PP PP PP P Sbjct: 539 VPIPAVAPAVTPSEEP--PPPPPGVDIPPPLPPSEDP 573 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG G G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG G GG GG GG G G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG G GG GG GG G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 35.5 bits (78), Expect = 0.060 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G GG GG GG G GG V Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDAV 97 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG GG GG Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGG 75 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P P P PP PP P Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIP 185 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIP--RPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP P PP P P P PP PP P Sbjct: 166 TQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIP 211 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP P PP PPP P P P Sbjct: 189 PPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTP 230 Score = 35.1 bits (77), Expect = 0.079 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPP-XXPPPXXP 906 P I P PPP P PP P P P PP PPP P Sbjct: 185 PPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFP 225 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIP--RPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P P P PP PP P Sbjct: 156 PPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP 198 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PP 897 T P +P PP PP P PP PPP P PP Sbjct: 149 TPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPP 190 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP PP P PP PP P Sbjct: 163 PPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPP 203 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPP 894 PP PP PP PP P PPP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 2/28 (7%) Frame = +1 Query: 829 PXXPPXX--PPXPPXPXPPPXXPPPXXP 906 P PP PP PP P PPP PPP P Sbjct: 93 PACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PP PP PP P PPP PPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPP--PPP 120 Score = 35.9 bits (79), Expect = 0.045 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 17/60 (28%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPP-----------------XPXPPPXXPPPXXP 906 T P P PPP P PP PP PP P PPP PPP P Sbjct: 89 TSCAPACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 35.1 bits (77), Expect = 0.079 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P PPP PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 15/51 (29%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX---------------PPXPPXPXPPPXXPP 894 PP P P PPP P PP PP PP P P P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PPPP PP PPPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 14/50 (28%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPX--------------PPXPXPPPXXPPPXXP 906 P P PPP P PP PP P P PPP P P P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMP 151 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 13/49 (26%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXX-------------PPXPPXPXPPPXXPPPXXP 906 P P PPP P PP PP PP P P P PP P Sbjct: 138 PPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPP-PAPMPAPPPMVVP 185 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 38.3 bits (85), Expect = 0.008 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG GG GG G GG G+G Sbjct: 55 GGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGGQG 92 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G G GG G G GG G+ + G Sbjct: 51 GQGVGGQGGGGQGGGQGVGGQEVGGQGGGGQGVGGQEVGG 90 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP P P PPP P Sbjct: 777 PP--PPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKP 814 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP P PP P PP P P Sbjct: 782 PPTKPATPRVPPNIPSRPPGARPTPP-PPPPGKPTKPTKP 820 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP IP P P PP P P P PP Sbjct: 792 PPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG--GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G GG G G G G G GG Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGX-GGXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G GG G G G G G GD Sbjct: 448 GDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGGD 485 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 433 PPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 443 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 453 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P P PPP P Sbjct: 563 PPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPX---PPXPXPPPXXPPPXXP 906 PP P P PP P P PP P PP P P PPP P Sbjct: 473 PPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 PP P P PP P P PP P P P P P PPP P Sbjct: 523 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 PP P P PPP P PP P P PPP P P P Sbjct: 513 PPGAPHPRV-PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 552 Score = 37.1 bits (82), Expect = 0.019 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP P P PP P P PP P PP P P PPP P Sbjct: 533 PPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P P PP P P P P P PPP P Sbjct: 463 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAP 507 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P PP P P P P P P PPP P Sbjct: 483 PPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P PP P P PP P P P P P P PPP P Sbjct: 493 PPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P P PP P PP P P P P P P PPP P Sbjct: 543 PPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 34.7 bits (76), Expect = 0.10 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP P PP P P PP P P P P P P PPP P Sbjct: 553 PPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P P PPP PP P P PPP P P P Sbjct: 403 PPGAPHPRV-PPPGASHQRVRPPGAPHPRVPPPGAPHPRFP 442 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P PP P PPP PPP Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPP--PGMGPPPRIPPP 330 Score = 31.5 bits (68), Expect = 0.97 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXP--PXPXPP-PXXPPPXXP 906 PP PP P P PP P P P P P P PPP P Sbjct: 413 PPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAP 457 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 PP P P PP P P PP P P P PPP P Sbjct: 583 PPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PP PP P P P PP P P Sbjct: 302 PQYMPHPRMRPPTR-IPPPGMGPPPRIPPPPIRAPVDVYP 340 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPR-PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P +P P PP P PP P P P PP PP P Sbjct: 1013 TNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPP 1056 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 787 PPXIPR--PXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PP P PP P P P PP P Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXG 804 GGG GGG GG G GG GGG G Sbjct: 817 GGGMAGGGSSMGGAGSTVHGGLDMDGGGGVIG 848 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PRP PP P PP P PP P P P P P Sbjct: 1355 PSTPRPR---PPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PP P P P P P P Sbjct: 1355 PSTPRPRPPTPPRPPTPRPRPPTPRPGPP 1383 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PP P P PP P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRP 1380 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G G G GG Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGG 77 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G G G G GG Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGG 79 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G G GG Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGG 81 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G GG Sbjct: 44 GGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAGD 796 G GGG GG G G G G GGG GG GD Sbjct: 47 GGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGD 84 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G GG Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGG 82 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GGG G G G Sbjct: 48 GGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX---PPXPPXPXP-----PPXXPPP 897 PP + PPP P PP PP PP P P PP PPP Sbjct: 702 PPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP----XXPPPXXP 906 PP P PPP P P PP P PPP PPP P Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPP 897 PP P P PP PP PP P PPP PPP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP + PPPP Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP 729 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PPP P PP PP PPP P P Sbjct: 728 PPPSPQPGCAGLPPPPPPPPPGCAGLPP---PPPPIDVPMKP 766 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P PP PP P PP P P Sbjct: 696 PPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 P P P PP PP PP P P PPP PPP Sbjct: 710 PMPPPPPPPPPGCAGLPP--PPPSPQPGCAGLPPPPPPPP 747 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 796 IPRPXXXPPPX---PXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP PP P PPP P Sbjct: 693 VPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P PP PP PPP P P Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP----SXXPPPP 902 P PP PP PPPP PP + PPPP Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPP 757 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.5 bits (83), Expect = 0.015 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG GG G G G G GGG G G G Sbjct: 33 GVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGG 72 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G G GG G GG G G GG Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGG 80 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G G G G G G G GG Sbjct: 67 GNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGG 106 Score = 35.5 bits (78), Expect = 0.060 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGIXGG 786 G G G GGG G GG G G G GGG G G GG Sbjct: 71 GGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG G G GG G G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGG 67 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG GG GG GG G G GGG G Sbjct: 52 GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNG 85 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G G G GG GG G G G G Sbjct: 59 GCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG G GG GG Sbjct: 61 GGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GG G G GG G G G G G G Sbjct: 54 GAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAG 92 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG G G G + GG Sbjct: 63 GNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G GG G G GG G G G Sbjct: 44 GNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAG 83 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G G G G G G G G Sbjct: 76 GGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP P P P PP PP P Sbjct: 130 LPPPPVTPPPGPETPPP-PDTPAPPVPPTEAPPTAPP 165 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P P PP P PP P PP P P P PP P Sbjct: 122 PP--PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAP 160 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 PP P P P P PP P P P P PPP PPP Sbjct: 1043 PPRKPSPP--PSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP PR PP P PP PP P P PPP P P Sbjct: 1057 PP--PRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQPDP 1093 Score = 35.1 bits (77), Expect = 0.079 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP P P P PPP P Sbjct: 1043 PPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQP 1076 Score = 35.1 bits (77), Expect = 0.079 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PP P PP P PP PPP P P Sbjct: 1051 PSAVPIP---PPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 33.9 bits (74), Expect = 0.18 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-----XXPPPXXP 906 P P PPP PP P PP PPP PPP P Sbjct: 1047 PSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPPPRQP 1091 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPP----PXXPPPXXP 906 PP P P PP P P PP P P P P PPP P Sbjct: 1065 PPSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPX-PXXPPXXPPXPP--XPXPPPXXPPP 897 P PPP P PP P PP P PPP P P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAP 1071 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPP 897 P P+ PP PP P PP P PPP P P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSP 1064 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPP---XXPPPXXP 906 P P PP PP P PP P PPP PPP P Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKP 1062 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P PPP P Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEP 1069 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXP--PPP 902 PPP PP P PPP P+ P PPP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXP-XPPPXXPPP 897 PP P P P P P P P P P PPP P P Sbjct: 1072 PPRQPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKP 1111 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPPP PPP Sbjct: 1057 PPPRKPSPPPSEPAP--PPRQPPPPSTSQPVPPP 1088 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T P PR P P P PP P P P P Sbjct: 1081 TSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 37.5 bits (83), Expect = 0.015 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG G GGG G GI GG Sbjct: 137 GMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG G GGG G G+ GG Sbjct: 127 GMAGEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGG 166 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GGG G G+ G Sbjct: 62 GMGGGGMAGEGMGRGGMAGE-----GMGGGGMAGEGMGRG 96 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GGG G G+ G Sbjct: 82 GMGGGGMAGEGMGRGGIAGE-----GMGGGGMAGEGMSRG 116 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G G GGG G G+ GG Sbjct: 122 GMGRGGMAGEGMGRGGMAGE-----GMGGGGMAGEGMGGG 156 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GG GGG G G G GG G G GG G G+ G Sbjct: 36 GGIAGGRMGGG-GMAGEGMGRGGMAGEGMGGGGMAGEGMGRG 76 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGG-GXGXGGXGGXXGGXXGXGG-----GXXXGRGIXGG 786 G GGG G G G GG G G G G G G G+ GG Sbjct: 41 GRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGG 86 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+ PPP P P PP PP PPP PP P Sbjct: 1243 PDGPPKFMGLPPPPPGMRPM-PPQPPFMPPPPRMQPPGPP 1281 Score = 35.5 bits (78), Expect = 0.060 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP P P P PP PPP Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP 1272 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P PP PP P PP P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPP 894 PP RP PP PP PP PP P PP P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P P P PP PP PP PP PP P Sbjct: 1252 LPPPPPGMRPMPPQPPFMPP-PPRMQPPGPPGPPGPP 1287 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P PP PP PPP P P Sbjct: 1225 PPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P P PP P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPP 1271 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GG G GG GG GG G G GG G G GG Sbjct: 95 GSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGG 137 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG GG GGG Sbjct: 109 GGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 34.7 bits (76), Expect = 0.10 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG--RGIXGG 786 G GGG G G GG GG GG G GGG G R GG Sbjct: 313 GGRGGGYRSG--GGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G G G GG GG D G Sbjct: 105 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGRRDYG 143 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG GG GG G GGG GG GR G Sbjct: 93 GGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYG 136 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG G G G GG GG G G Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGG 127 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GG GG GG G G GG GG+ GR Sbjct: 100 GYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGGR 139 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP PP P PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 31.5 bits (68), Expect = 0.97 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P PPP P PP PP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP + P PPP P PP PP P P Sbjct: 73 PPPLCAPPPPPPPPP--PPPPPPGAKKPDDP 101 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P PP PP P P PP P P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPS-PPIPTAPPTPPMPETPLPP 215 Score = 35.5 bits (78), Expect = 0.060 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXP-----PXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P PP PP P PP P P P Sbjct: 306 PSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIP 351 Score = 35.1 bits (77), Expect = 0.079 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXP--PXXPPXPPXPXPP--PXXPP-PXXP 906 P IP P P PP P P P PP P P PP P PP P P Sbjct: 182 PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHP 227 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 6/49 (12%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPP----PXXPP-PXXP 906 T PP P P P P P PP PP P P PP P PP P P Sbjct: 250 TPLPPATPNPFIPPASPNPSIPPA-PPNPSIPAPPNPSIPLAPPNPYIP 297 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P PP P P P P P Sbjct: 197 PPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNP 236 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP P P PP P P Sbjct: 315 PPAPPNPYIPTAPPNPSIPP-APPNPSIPPAPPNPSIPPAP 354 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-----PXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P PP PP P P P P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIP 315 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P P P PP PP P P P P P Sbjct: 175 KPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMP 209 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P PP P P PP P P PP P P Sbjct: 262 PPASPNPSIPPAPPNPSIP--APPNPSIPLAPPNPYIPPAP 300 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P PP P P PP PP P Sbjct: 324 PTAPPNPSIPPAPPNPSIPPAPPNPSIPPAPPNLFIPPATP 364 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 T PP P P P PP P P P P P P P P Sbjct: 242 TPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNP 285 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P P P P P PP PP P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPP 207 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PP P P PP P P PP P P P Sbjct: 233 PPNPSKAIATPNPPMPETP--LPPATPNPFIPPASPNPSIP 271 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP P P P PP P P P Sbjct: 159 TSKPPVTETTTTKPETKPPKPPA-PSTIPTPPTPPAPPSPPIP 200 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 790 PXIPRPXXX-PPPXPXXPP-----XXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP P PP P P P Sbjct: 280 PAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIP 324 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 778 TXXPPXIPRPXXXP--PPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 T P P P P PP P P P PP P P P P P Sbjct: 205 TPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETP 251 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP P P PP P P Sbjct: 292 PNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAP 327 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP 864 P +P P PPP P PP PP PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPP 897 P PP PP PP P PPP PPP Sbjct: 59 PTVPIPPTLPP-PPPPPPPPLPPPP 82 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP PPPP Sbjct: 65 PTLPPPPPPPPPPLPPPP 82 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP P P P PP Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 842 PXXXPXPPXPXPPLXXPPP 898 P P PP P PPL PPP Sbjct: 65 PTLPPPPPPPPPPLPPPPP 83 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 70 PPPPPPPPLPPPPP 83 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P P P P PPP PPP P Sbjct: 59 PTVPIPPTLPPPPPPPPPPLPP 80 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PPP PP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 36.7 bits (81), Expect = 0.026 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +1 Query: 805 PXXXPPPXPXXPPXX-----PPXPPXPXPPPXXPPPXXP 906 P PPP P PP PP PP P P PPP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP P + PPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PPP P P P PP P PPP Sbjct: 667 PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPP 703 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + PPP P P PP P PPP P Sbjct: 666 PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 36.7 bits (81), Expect = 0.026 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP PP P PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 31.5 bits (68), Expect = 0.97 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P PPP P PP PP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP + P PPP P PP PP P P Sbjct: 274 PPPLCAPPPPPPPPP--PPPPPPGAKKPDDP 302 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP 864 P +P P PPP P PP PP PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPP 897 P PP PP PP P PPP PPP Sbjct: 283 PTVPIPPTLPP-PPPPPPPPLPPPP 306 Score = 32.3 bits (70), Expect = 0.55 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP PPPP Sbjct: 289 PTLPPPPPPPPPPLPPPP 306 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP P P P PP Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 842 PXXXPXPPXPXPPLXXPPP 898 P P PP P PPL PPP Sbjct: 289 PTLPPPPPPPPPPLPPPPP 307 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 294 PPPPPPPPLPPPPP 307 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P P P P PPP PPP P Sbjct: 283 PTVPIPPTLPPPPPPPPPPLPP 304 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PPP PP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPP 894 PP P P P PP PP PP P PP PP Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P PP P PP PP PP P P Sbjct: 228 PTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P PP P P PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPP 894 P PRP P P P PP PP P PP PP Sbjct: 215 PTQAPRPPTTQTP-PTKAPTDPPVPPTNPPVPPTNPP 250 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 T P P P PP P PP P PP P Sbjct: 229 TKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P PP P P PP P P PP P Sbjct: 214 VPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPP 250 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T PP + PP P PP P PP P P P Sbjct: 224 TQTPPT--KAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 36.7 bits (81), Expect = 0.026 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP PP PPP PPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPP 248 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PP P P PP P PPP PP P Sbjct: 211 TPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P+ P P P P PP P P PPP Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPP 237 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 36.7 bits (81), Expect = 0.026 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPP 897 P PP PP PP P PPP P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 Score = 35.9 bits (79), Expect = 0.045 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP P PPP PPP P Sbjct: 1307 PPESPPPPPPP-PPPPPPPPLPP 1328 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPP 894 P P PP PP P PPP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 33.1 bits (72), Expect = 0.32 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 709 RXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 R TP P + PP P PPP P PP PP PP P Sbjct: 1281 RDTPESQRLPHPNISGQKANNKEQIQPPESP----PPPPPPPPPPPPPPLPPTP 1330 Score = 32.7 bits (71), Expect = 0.42 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXP 876 +P PPP P PP PP P P P Sbjct: 1306 QPPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 32.7 bits (71), Expect = 0.42 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P PPP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLPPTP 1330 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 36.3 bits (80), Expect = 0.034 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P PP PP P P P Sbjct: 415 PPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAPWIERP 451 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP-PSXXPPPP 902 PPP P P PPPP PS PPPP Sbjct: 307 PPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPP 342 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PPP PP P PPPP P + PPP Sbjct: 319 APAPPPSQAPPPPKTI----PSTLPPPPVPSATSAPPP 352 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P P PP P PP P P Sbjct: 376 PPGAGNGPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIP 415 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP + P P PP P P PPP PP Sbjct: 371 PPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXPPXXPPXPPX-PX--PPPXXPPPXXP 906 PP P P PP P PP PP P PPP PP P Sbjct: 402 PPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 896 GGGXXGGGXGXGG---XGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G GGG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P PP PP P P PPP P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPP 321 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P P PP P PPP P Sbjct: 293 PPFGGHPAAAPPPPPL--PAGVPAPPPPPPPPMLGGP 327 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P P P PP P P P PPP PPP Sbjct: 291 LPPPFGGHPAAAPPPPPLPAGVPAPPPPP--PPP 322 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 35.9 bits (79), Expect = 0.045 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G GGG G G GG Sbjct: 430 GAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG-GSTGG 468 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G G GG G G G G G G Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGG 460 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G G G G G GGG G G Sbjct: 438 GGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 35.9 bits (79), Expect = 0.045 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXP 891 PPP P PP PP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPP 894 P PP PP PP P PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.9 bits (74), Expect = 0.18 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP P PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPP 879 P PPP P PP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP 861 PP P P PPP P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G G G GRG GG Sbjct: 9 GRGSGGGWGQGPG-GGWGRGQGGGMGRGPGGGWGRGSGGG 47 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G GG G G GRG GG Sbjct: 37 GGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGPGGG 79 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GGG RG G G G G GGG G G Sbjct: 29 GGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPG 61 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG GG G GGG G GG Sbjct: 179 GGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGG 218 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G GG G GG Sbjct: 157 GYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGG 196 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G G G GGG +G Sbjct: 195 GGGDYGGGPGYGG-GQGYGSYSGGGGGNYDYQG 226 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G G G G G G GGG G G Sbjct: 167 GYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGG 202 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGG---XXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG G GGG G G+ GG Sbjct: 138 GRDGGGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYGMGGG 181 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG G G G G GG Sbjct: 165 GGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGG 202 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G G G GG GG G G Sbjct: 142 GGGGYRGGYRGGYRGGYRGGRDRGGGYGGGGEGGYG 177 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 35.5 bits (78), Expect = 0.060 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG GG G GG G GG Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGG 206 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G G GG GG G GG G G GG Sbjct: 162 GDDDDGDGGGSNGSG--GGDDGGDGGDDGGGSGGGGDDGG 199 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G G GG GG GG G G GG Sbjct: 176 GGGDDGGDG-GDDGGGSGGGGDDGGSDGGGGGNDGG 210 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG G G G Sbjct: 185 GDDGGGSGGGGDDGGSDGGGGGNDGGRDDG 214 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRG 798 G G GGG GG G GG G GGG G G Sbjct: 147 GDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDG 184 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 35.5 bits (78), Expect = 0.060 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGG----XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG G GG G GGG G G GG Sbjct: 188 GRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG RGG G GG G G GGG GG+G G Sbjct: 187 GGRGGRGGRG-GGRGAPRGRGGPRGGG--GGSGGYG 219 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 R PPP P P PP PP P P P P Sbjct: 419 RSLVQPPPPPPPAPLPPPPPPPPQPTTALPDP 450 Score = 31.5 bits (68), Expect = 0.97 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP+ PPPP Sbjct: 424 PPPPPPPAPLPPPP 437 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 RP P PP PP P P PP PPP P Sbjct: 408 RPFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQP 443 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +1 Query: 838 PPXXPPXP-PXPXPPPXXPPPXXP 906 PP PP P P P PPP P P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALP 448 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPP 894 P P PP P P P P PP P PPP PP Sbjct: 335 PSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P PPPP PP PPP Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 T PP P P P P P P P PPP PPP Sbjct: 327 TNAPPS-DSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPP 366 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T P P P PP PP PP P PPP Sbjct: 339 TPTTPQPPTPTTPKTHPQLGPPPPPP-PPPPTPPP 372 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 35.5 bits (78), Expect = 0.060 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPP 894 PPP PP PP P PPP PP Sbjct: 304 PPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 32.7 bits (71), Expect = 0.42 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P P PP P P PPP P Sbjct: 301 PPPPP--PTDFAPPPPPPEPTSELPPPPPP 328 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P PPPP P PPPP Sbjct: 280 PPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPP 314 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP P PP PPP Sbjct: 303 PPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P PPP P PP PP P Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P PPP P P P PP P Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 35.5 bits (78), Expect = 0.060 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P P P PP PP P PPP Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 + P P P P P P P PPP PPP P Sbjct: 354 VANPPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P P P P PP PP PP P P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 35.1 bits (77), Expect = 0.079 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP PP P PP PP P Sbjct: 450 PLPSDEPPPLP-PDEEKPPPPPAPALPPLPLPPELP 484 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP +P PPP P P P P P P PP P Sbjct: 456 PPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSP 496 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 820 PPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PPP P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLP 478 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 35.1 bits (77), Expect = 0.079 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP PP PP P Sbjct: 430 PPPTP--PPTPPPTPPPTTLPPTTQPPPQP 457 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP 882 P PPP P P PP PPP Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 T PP P P P P P P PP P Sbjct: 427 TATPPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 35.1 bits (77), Expect = 0.079 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP PP PP P P P PPP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 34.3 bits (75), Expect = 0.14 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXP-PPXXP 891 PP P P PPP P P P PP P P PP P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMP 322 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +1 Query: 778 TXXPPXIPRPXXX---PPPXPXXPPXXPP----XPPXPXPPPXXPPP 897 T PP P P PPP P PP P PP PP PPP Sbjct: 295 TAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P +P P PPP P PP P P P P PPP Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P P PP PPPP Sbjct: 213 PGLMPPPGMLPPPGGMPPGRMPPQGLPFP-PPGPIPPPP 250 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G GG GG G GGG GRG GG V Sbjct: 45 GGGRGGPRGGGRG-GGRGGGGGFKSPRGGGRGGGRG--GGRGV 84 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG GG G G G RG Sbjct: 54 GGRGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIARG 89 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -1 Query: 906 GXXGG-GXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GG G RGG GG G G GGG GG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRG 79 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 P P PPP P PP PP P P PP P P P P Sbjct: 95 PPPPATPPP-PTMPP-TPPPPQTPAPPGPDTPAPPAP 129 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P P PP P PP P P PP Sbjct: 97 PPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P P PP P + PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 T PP +P P PP P P P PP P Sbjct: 100 TPPPPTMP-PTPPPPQTPAPPGPDTPAPPAP 129 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP PRP PP P P P P PPP P Sbjct: 857 PPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 T P P PP PP PP P P PP PP P Sbjct: 847 TDRPLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPP 894 PP P PPP P PP PP PPP PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 6/36 (16%) Frame = +1 Query: 817 PPPXPXX---PPXXPPX--PPXPXPP-PXXPPPXXP 906 PPP P PP PP PP P PP PPP P Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAP 214 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P P PPPP PP PPP Sbjct: 179 PPPAP--PGVLAPPPAPPGVLPPPPAPPGALIPPP 211 >SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) Length = 483 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPP 897 P P P P P PP PP PP P P PPP Sbjct: 167 PAPHSSPSPTPPPPPIIPPCPPVINLLIPTARPCMPPP 204 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P +P P P P P P PP P PP P Sbjct: 155 PTTTKKPTTKPTPAPHSSPSPTPPPP-PIIPPCPP 188 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P PPP P P P PP P PP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXP---XPPPXXPPP 897 PPP P PP PP P P P PPP Sbjct: 653 PPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG GGG G GG GG GG G Sbjct: 492 GGGASGGGGGGGGGGGFSGGACG 514 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG GG G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGG 819 GG GGG GG GG GG GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GG G GG GG G Sbjct: 488 GFGGGGGASGGGGGGGGGGGFSG 510 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 34.3 bits (75), Expect = 0.14 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G G G G G Sbjct: 18 GDSGGGSDGGGDGGDGGGGSDGG-DGEGDDDGDGEGDDDG 56 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+ PP P P PP P P P P P P Sbjct: 751 PPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAP 790 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP P PPP P Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPPCAP 776 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P+ PPP PP P P P P P P Sbjct: 758 TPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPFSAAPHLP 800 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 T PP P P P P P P PP P PP P P Sbjct: 745 TKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPP 788 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Frame = +1 Query: 778 TXXPPXIPR-------PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP IP P PPP PP P PP PPP PP P Sbjct: 221 TSLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMP-PPGMMPPPGFPPMGMP 269 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P PPP P P PP P PP PP P Sbjct: 249 PPGMPPPGMMPPPGFPPMGMPGMGGMPP-PGMPPPMPPGGMP 289 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPPPXXP 906 PP P P P PP PP PP PP PP P Sbjct: 260 PPGFP-PMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPP 299 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 PP P PP PP P P PPP PPP P Sbjct: 242 PPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPP 285 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPP 894 P + P P P PP PP PP PP PP Sbjct: 264 PPMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GG G GG G GG G GG G G G Sbjct: 1265 GGSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAG 1300 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRG 798 G GGG GGG G G GG G G GG G G Sbjct: 1266 GSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYG 1302 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNG 356 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G G G Sbjct: 321 GGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDG 360 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG GGG G GG GG Sbjct: 320 GGGGGGGGGGGGGGGGGGG 338 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNG 354 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PP P P PP PP PP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 Score = 33.1 bits (72), Expect = 0.32 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP + P PPP P PP PP PP PP P Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP PP PPP Sbjct: 2161 PSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P P PP PPP Sbjct: 2180 PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPP 897 P + P PPP P PP P PPP PP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPP 897 PP + PPP P P P P P PP PPP Sbjct: 2140 PPPMGSSRYGPPP-PMGPARHSPSGPSPLGAPPSVPPP 2176 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP P P PP PPS PP Sbjct: 2170 PPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPP 2206 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXP--PXPPXP-XPPPXXPPP 897 P+P PP P PP P PP P PPP PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPP 55 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P PP P P PP PP PP Sbjct: 25 PTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPP 897 P P P PPP P PP PP PP PPP Sbjct: 40 PTPPSPNT-PPPVTQPPVTQPPVTQPPVTQPPVTQPPP 76 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P PPP PP P Sbjct: 522 PAPQ-PPSPPAPPPKPAPPPRSPPAAAP 548 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PP P P P PP P Sbjct: 511 PTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPP 544 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP P P P P P PP P P P Sbjct: 526 PPSPPAPPPKPAPPPRSPPAAAPCNPAMAP 555 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G G GG GG GG G G G Sbjct: 473 GGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGG 505 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG G G GG GG G GG R Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSR 497 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG GG G G GGG Sbjct: 480 GGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG GG GG G GGG G G GG Sbjct: 458 GGRSNQNDVEGGFGGG-GGPNGAGGGGGGGGGYSGG 492 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G G G GG G Sbjct: 478 GAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GG GG Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGG 503 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 33.5 bits (73), Expect = 0.24 Identities = 13/21 (61%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 838 PPXXPPXPP-XPXPPPXXPPP 897 PP PP PP P PPP PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPP 49 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PP P PP P PP P PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GG G GG G G G G GGG GRG GG K Y Sbjct: 500 GPRGGRGGSRGGPPRGAPRGRSGPPRGRGGGDFGGRGGRGGTTPGKRKY 548 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 P P PPP P PP PP P P PPP Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXP--PPP 902 PPP PP P PPPP P + P PPP Sbjct: 209 PPPMGGPPPMGGPPGGYP---PPPPPPGAGDPAYPPP 242 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP--PP 902 P + PP PP P PPPP PP P PP Sbjct: 204 PGMWGPPPMGGPP---PMGGPPGGYPPPPPPPGAGDPAYPP 241 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G GG G G+ GG Sbjct: 159 GMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEG-GMGGG 197 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG G G G GG Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGG 210 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG G G G G G G GG Sbjct: 130 GEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGG 168 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG GG G G GGG G G G Sbjct: 114 GGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGG 152 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G G GGG G G GG Sbjct: 110 GGEAGGEAGGQAGGGGQAGGQAGSQA-GGGAAGGGGQEGG 148 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG GG G G GG G G Sbjct: 119 GQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGG 157 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GG GGG GG GG G G G G GG V Sbjct: 137 GGAAGGGGQEGGGQGGAQAG--GSTSGSSSGGATSGGGGV 174 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRGIXGG 786 G GGG G G G GG GGG G I GG Sbjct: 144 GQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGG 185 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P P P PP PP P PPP Sbjct: 295 TQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 334 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPXPPXPXPPPXXPP 894 P P+P PPP P PP PP P PP P Sbjct: 361 PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-----XXPPXPPXPXPPPXXPPPXXP 906 PP R PPP P P PP PP P P PP P Sbjct: 331 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 375 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPP 894 PP I +P P PP P P P P PP PP Sbjct: 343 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 381 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP PP P PPP Sbjct: 2 PPPP--PPPGPPPPPSAPSGPVKPPP 25 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PPP P PP P P P PP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P P PPPP S PPPP Sbjct: 245 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 283 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX----PPXPPXPXPPPXX-PPPXXP 906 PP + PPP PP PP PP P P PPP P Sbjct: 332 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 376 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPP 897 T PP R PP P PP PP PP PPP Sbjct: 317 TPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 864 PPPXPPSXXPPPP 902 PPP PPS PPPP Sbjct: 464 PPPVPPSRGPPPP 476 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXP 876 P PPP P PP P P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPP 897 P RP PPP PP P P PP PPP Sbjct: 233 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 272 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PPP PP P PPP PP Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PP PP P PPPP PPPP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPL--PPPPLRGQIAPPPP 344 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPPXXP 906 PP PP P PPP P P Sbjct: 2 PPPPPPPGPPPPPSAPSGP 20 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXX--PXXXPPPPXPPSXXPPPP 902 PPP PP P PP PP PPPP Sbjct: 141 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 177 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-------PPXPPXPXPPPXXPPP 897 PP R PPP P P PP PP P PPP Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P+P PP P PP PP P P PP Sbjct: 227 PASPKPPTAPPNTPP-PPVTPPPPNTPGPP 255 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP PP PP PPP P P Sbjct: 230 PKPPTAPPNTPP-PPVTPPPPNTPGP 254 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P P P PP PP P PPP Sbjct: 207 TQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPP 246 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPXPPXPXPPPXXPP 894 P P+P PPP P PP PP P PP P Sbjct: 273 PGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-----XXPPXPPXPXPPPXXPPPXXP 906 PP R PPP P P PP PP P P PP P Sbjct: 243 PPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPP 287 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPP 894 PP I +P P PP P P P P PP PP Sbjct: 255 PPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPP 293 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P P PPPP S PPPP Sbjct: 157 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPP 195 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX----PPXPPXPXPPPXX-PPPXXP 906 PP + PPP PP PP PP P P PPP P Sbjct: 244 PPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPP 288 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPP 897 T PP R PP P PP PP PP PPP Sbjct: 229 TPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +3 Query: 864 PPPXPPSXXPPPP 902 PPP PPS PPPP Sbjct: 376 PPPVPPSRGPPPP 388 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPP 897 P RP PPP PP P P PP PPP Sbjct: 145 PTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPP 184 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PPP PP P PPP PP Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PP PP P PPPP PPPP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPL--PPPPLRGQIAPPPP 256 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXX--PXXXPPPPXPPSXXPPPP 902 PPP PP P PP PP PPPP Sbjct: 53 PPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPP 89 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-------PPXPPXPXPPPXXPPP 897 PP R PPP P P PP PP P PPP Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP P P P P PP P Sbjct: 432 PPPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPP 897 P PP P PP PPP P P Sbjct: 429 PSHPPPLPQPPPSIIPPPTTPLP 451 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G GG G G GG Sbjct: 333 GDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGG 372 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G GG G G GG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGG 382 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G GG G G GG Sbjct: 353 GDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGG 392 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G GG G G GG Sbjct: 358 GDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGG 397 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G GG G G GGG G G Sbjct: 189 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSG 223 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G G G G G GRG GG Sbjct: 253 GRGSGGGWGQGPG-GGWGRGQGRGMGRGPGGGWGRGSGGG 291 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PP P PP P P PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = +1 Query: 823 PXPXXPPXXPPXPP---XPXPPPXXPPPXXP 906 P PP PP PP P PPP PPP P Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPP--PPPVMP 105 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P P P PP PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPP---PPPPVMPP 106 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 T P P PPP P PP PP PP Sbjct: 73 TTDGPAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 32.7 bits (71), Expect = 0.42 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GG RGG G GG G GG GG GD Sbjct: 204 GRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGD 240 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G GG G G GGG G G Sbjct: 235 GASAGGGGGVGTTGGSTGAAGGGGGGTSTSTGSSG 269 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PP PP+ PPP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPP 462 Score = 32.7 bits (71), Expect = 0.42 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP--PSXXPP 896 P +PPP PP P PPPP PS PP Sbjct: 479 PRGFPPPPFGPPPPFYRGPPPPRGMPPPPRQRMPSQGPP 517 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P P P P P PPP PPP Sbjct: 455 PPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPP 491 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P PPP PP P P PPP P Sbjct: 451 PPQLP-PNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGP 489 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP R PP PP P PP PPP PPP Sbjct: 461 PPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPP 499 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 P P PP PP PP P P PP PPP Sbjct: 469 PPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T P +P P P PP P PP PPP Sbjct: 108 TDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPXIP-RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + P PPP P P P P PP PP Sbjct: 101 TVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPP 141 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIP-RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP + P PPP P P P P PPP P Sbjct: 89 TVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQP 132 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPXIP-RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + P PPP P P P P PPP Sbjct: 77 TVPPPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVPPP 117 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP P PPP P P P Sbjct: 291 PTPKPRTPT---PSPPTPTPPPRSPTPLHP 317 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 32.3 bits (70), Expect = 0.55 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPP 894 P P PP P PP P PP PP Sbjct: 122 PSGPRAPPGGPGAPPPPPPPAVVPP 146 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 820 PPXPXXPPXXPPXPP-XPXPPPXXPPP 897 PP P P P PP P PP PPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPP 141 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P +P PP P PP PP PP PP Sbjct: 118 PTSVPSGPRAPPGGPGAPP--PPPPPAVVPP 146 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G G G+ GG Sbjct: 224 GGFGGG--GGGSEDNGASGGGGGYSGGGSGTHSGQAGGGG 261 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXG 804 G G GGG G GG G G G GGG G Sbjct: 232 GSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCG 266 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPP 894 PP PR P PP PP PP P PP PP Sbjct: 272 PPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PR PP P P PP P P P PP Sbjct: 349 PPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYPP 385 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP R PP P P PP PP P P P P Sbjct: 328 PPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHP 367 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP P P PP P Sbjct: 262 PRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPP 304 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P PP P P P P Sbjct: 336 PSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPP 371 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PP PP P PP P PP P Sbjct: 258 LPSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPP 294 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPP PP P PP PP P PP Sbjct: 268 PLRYPPIPPRYPPSLIRYPTLPPRY--PPSPPRYPPSPP 304 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG G GG GG GG G GG G Sbjct: 789 GANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G GG G G G Sbjct: 795 GSSSGGASGG--AGGSSGGASGGAGGSSGGASGGAGSSSG 832 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG-RGIXGG 786 G GG G GG G GG G GG G G GG Sbjct: 778 GASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG 818 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGR--GIXGG 786 G GG G G GG GG GG G G G G GG Sbjct: 799 GGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGG 841 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 31.9 bits (69), Expect = 0.73 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG G G G GG GG GG G Sbjct: 231 GGGVWGNGGGGGGGGGYSGGGSG 253 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG GG G GG Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGG 250 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG GG G G GGG Sbjct: 236 GNGGGGGGGGGYSGGGSGNPHYYACGGGGG 265 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G G G GG Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGG 263 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.9 bits (69), Expect = 0.73 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG G G G GG GG G GGG Sbjct: 76 GGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXG---GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G G G G G GG G GG G G Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGG 101 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GG G G GG G G G GGG G GG Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGG 100 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 31.9 bits (69), Expect = 0.73 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P PP P P PP PP PP P Sbjct: 126 PPQVPYPGAAGPPMPHPTASVYP-PPGGYPPTSYPPQPYP 164 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP PP P Sbjct: 120 PPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYP 159 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 T PP P P P P PP PP P P PP PP P Sbjct: 156 TSYPPQ-PYPAQ-PYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.5 bits (68), Expect = 0.97 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPPXXP 906 PP PP P PPP PP P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 859 PPXPXPPPXXPPPXXP 906 PP P PPP PPP P Sbjct: 142 PPPPPPPPSPPPPCHP 157 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXP 891 PP PP PP P PP P Sbjct: 144 PPPPPPSPPPPCHPPALP 161 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPP 894 P PP PP P PPP PP Sbjct: 142 PPPPPPPPSP-PPPCHPP 158 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXP--PPXXP 906 P P PP P PP P PP P PP PP P Sbjct: 188 PTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAP 226 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXP--PPXXP 906 +P PPP P PP P PP P PP P PP P Sbjct: 524 LPTQPYYPPPQPY-PPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP 891 P P P PP P PP PP P PP P Sbjct: 528 PYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXP-PPXXP--PPXXP 906 PP P PP P PP P PP P PP P Sbjct: 173 PPTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAP 205 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P+ YPP PP P PP PP PS P P Sbjct: 190 PSSYPPTQPSYPPTAPSYPPTPSSYPPIAASYPPTAPSYNPTAP 233 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG GGG G GG GG G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTG 3720 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G G G Sbjct: 260 GGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 297 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGG-XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G G G G G G G G G Sbjct: 329 GGGGDGGGDDGGDGDGDGDGDGDGDGDGDRDGDGDGDG 366 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 4/34 (11%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX----PXPPPXXPPPXXP 906 PPP P PP PP P P P P PPP P Sbjct: 512 PPPPPASPP--PPLPAEEDNSPPPLPAGPPPDEP 543 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P P P PPP P PP P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPP-PLPAGPPPDEP 543 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GGG GGG G GG GG GG G G Sbjct: 1003 GGGGGGGG-GGGGGGGRRGGRGGARG 1027 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 860 GXGGXXGGXXGXGGGXXXGRG 798 G GG GG G GGG GRG Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG G G GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGG 1024 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG GG GG G Sbjct: 1006 GGGGGGGGGGGGRRGGRGGARG 1027 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXXPPXP--PXPXPPPXXPPPXXP 906 P P P PP P P P PPP P P P Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 P P P P P PP PP P PP Sbjct: 138 PPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P P P P PP P PPP PPP Sbjct: 1337 PSGLPLPLPRLPLPPLRLP--PPHSRLPLPPPKLPPP 1371 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PPP P PP PP P PPP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAP-PPPPNPAPDVP 35 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 +P P PPP P PP P P P P Sbjct: 4 VPPPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 >SB_38491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G G G G G G G G G Sbjct: 12 GGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDG 45 >SB_25799| Best HMM Match : DUF618 (HMM E-Value=2e-26) Length = 687 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 329 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 371 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 336 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 378 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 343 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 385 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 350 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEP 392 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P PP P PP P PP P PP P PP P Sbjct: 319 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 357 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PP 897 P P PP P PP P PP P PP P PP Sbjct: 357 PGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 396 >SB_25716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G G G G GGG G+G GG Sbjct: 57 GKGDGKGEGGGKGEGEGKGEGKSEGKGEGGGKGDGKGEEGG 97 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P P PP PP P P PP P P Sbjct: 928 PEPLPEVDIMRSPTPTPPPSPPPKEPTP-PPSSKPSP 963 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG 828 GGG GGG G GG GG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 860 GXGGXXGGXXGXGGGXXXGRG 798 G GG GG G GGG GRG Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP----PXPXPPPXXPPP 897 P P P P P P PP P P P P PPP Sbjct: 52 PTPCYGPVPHPLLRPCVPPPATALVPHPLPRPCAPPP 88 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPP 897 P P P P PP PP PPP PPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP + PPP P PP P PPP Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPPP 277 >SB_26407| Best HMM Match : UQ_con (HMM E-Value=0) Length = 1282 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 95 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 137 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 102 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 144 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 109 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEP 151 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P P PP P PP P PP P PP P PP P Sbjct: 116 PGRPPHEPGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEP 158 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PPXXP 906 P PP P PP P PP P PP P PP P Sbjct: 85 PHDQGRPPYEPGRPPHEPGRPPHEPGRPPHEPGRPPHEP 123 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXP--PP 897 P P PP P PP P PP P PP P PP Sbjct: 123 PGRPPHEPGRPPHEPGRPPHEPGRPPYEPGRPPHEPGRPP 162 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P PP P PP PP P P Sbjct: 401 PGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMGPGP 439 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 795 YPPPXXXXP-PXXXXXXXXPXXXPPPPXPPSXXPP 896 YPPP P P PPPP PP PP Sbjct: 153 YPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 PP PP P P PP PPP PPP P Sbjct: 145 PPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYP 186 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 1.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP P PPP PPP Sbjct: 211 PPPPPPPPPPP--PPP 224 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-----PXPPXPXPPPXXPPP 897 PP +P P P P PP P P P P PPP Sbjct: 686 PPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPP 727 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P R PP P P PP P P P PPP P Sbjct: 25 PSSTRTKLAVPPIPHGPRPLPPLREPPTPAP-TPPPALP 62 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P PP P P P P P P Sbjct: 41 PRPLPPLREPPTPAPTPPPALPSTPTLPLAPRPRPTASQP 80 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G G GG G G GG GRG Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRG 395 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXG--XGGXGGXXGGXXGXG 822 G GG GGG G GG GG GG G G Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 GGG RGG GG G G GGG G D Sbjct: 368 GGG--RGGGRGGGRGGFRGGRGGRGGGGRGAGSD 399 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPP PP PPP + PPPP Sbjct: 34 PGGYPPAPGGYPPSGGYGYPPAGGYPPPQPGYAGGPPPP 72 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP 864 PP P P PPP P PP PP Sbjct: 196 PPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P P PP PP P PPP Sbjct: 195 PPPPPPGPGGIPP-PPPPIRGGVPPPP 220 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +P P PPP PP P PPP Sbjct: 347 PPAVPTPATAPPPVVAPPPSVFASSSGVPTPVKAPPP 383 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P + P PPP P P P PPP PP Sbjct: 531 PTPVTEPPPAPPPSVFAPSSGVP-TPVTAPPPAPPP 565 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P + P PPP P P P PPP PP Sbjct: 509 PTTVTAPPAAPPPSVFAPSSGVP-TPVTEPPPAPPP 543 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGP 1687 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +1 Query: 799 PRPXXXPPPXPXXP-PXXP---PXPPXPXPPPXXP-PPXXP 906 P P PPP P P P P P P P P P PP P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P P P PP P P Sbjct: 1666 PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG 816 GG GGG G GG GG G GG Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGG 284 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GG GG GG G GG G GG G Sbjct: 292 GGITAGGTAEGGNAGGNGGNAGGNGGMTGG 321 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 30.3 bits (65), Expect = 2.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPP 864 R PPP P PP PP PP Sbjct: 157 RSYYSPPPQPPPPPLPPPPPP 177 Score = 30.3 bits (65), Expect = 2.2 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 838 PPXXPPXPPXPXPPP 882 PP PP PP P PPP Sbjct: 162 PPPQPPPPPLPPPPP 176 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/70 (25%), Positives = 22/70 (31%), Gaps = 1/70 (1%) Frame = +1 Query: 700 IVXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPP-XPPXPXP 876 I+ P + + P + PP IP P PP PP PP P Sbjct: 366 IIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPPIG 425 Query: 877 PPXXPPPXXP 906 P P P Sbjct: 426 VPNRPSVLYP 435 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 363 PPPIIPIPPPAMPAMFNPHV-PPPMIGPVTVPPPP 396 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPP 872 P + + P PPP PP P PPPP Sbjct: 384 PPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G G G G GRG GG Sbjct: 2232 GGGGGGAGIGQGDCMDGDPGQAGGNGTRHGGRGGKGG 2268 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 25.8 bits (54), Expect(2) = 2.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP PP PPP Sbjct: 237 PPPPPYTSLPPDDPPP 252 Score = 23.0 bits (47), Expect(2) = 2.2 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPP 855 P PP P PP PP Sbjct: 192 PGAPEPPEPDNPPASPP 208 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP P PP PPP Sbjct: 1455 PPPPPPPAPP--CPPP 1468 Score = 23.0 bits (47), Expect(2) = 2.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXP 870 P P P PP PP P Sbjct: 1423 PAPPPPMAFPPMPPAP 1438 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP PPP PPP Sbjct: 463 PPPPPMSPPPPTPPPP 478 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXP 891 P P PP PP PP P PP P Sbjct: 461 PIPPPPPMSPP-PPTPPPPATSP 482 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PPP P PP PP PP P P Sbjct: 463 PPPPPMSPP--PPTPPPPATSP 482 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 6/33 (18%) Frame = +1 Query: 817 PPPXPXX------PPXXPPXPPXPXPPPXXPPP 897 PPP P PP P P PPP PPP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPP 464 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 PPP P PPP PPS PP Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPP 464 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP P P PP PP Sbjct: 27 PTDPPTDPPTDPPTDPPTDP-PTDPPTDPP 55 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P PP PP P Sbjct: 27 PTDPPTDPPTDPPTDP-PTDPPTDPPTDPP 55 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P P P P PP PP P PP Sbjct: 26 PPTDP-PTDPPTDPPTDPPTDPPTDPPTDPP 55 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP I +P PP P PP PP PP P P Sbjct: 949 PPGIMQPPTSIPPSQPMAPPSFPPSSMGGFPPSSQPSMYNP 989 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 859 PPXPXPPPXXPPPXXP 906 PP P PPP PPP P Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 859 PPXPXPPPXXPPPXXP 906 PP P PPP PPP P Sbjct: 154 PPPPSPPPSPPPPSPP 169 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXP 891 PP PP PP P PP P Sbjct: 33 PPSPPPSPPPPSPPLDCP 50 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXP 891 PP PP PP P PP P Sbjct: 156 PPSPPPSPPPPSPPLDCP 173 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G G + GG Sbjct: 354 GGFGGG--GGGSEDNGASGGGGGYSGGGSGITWNQAGGGG 391 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T P P P PP P PP P PPP P Sbjct: 203 TIKPRSGPLPPTAAPPPPPTTGAPPPTPVTNKPPPPRP 240 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PR PP PP PP P P PPP P Sbjct: 206 PRSGPLPPTAAPPPPPTTGAPP-PTPVTNKPPPPRP 240 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP----PXPPXPXPPPXXPPPXXP 906 P P PPP PP P P PP P PP P Sbjct: 210 PLPPTAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG G G G G G GG G GGG GRG Sbjct: 406 GGYRGRGGGRGYYRGGRGG--GRGGGGRGGRG 435 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 5/48 (10%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-----PXXPPPXXP 906 T P P P PPP PP PP P PPP P Sbjct: 187 TRMPDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPPP 234 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PPP P P PP P PPP Sbjct: 756 PPPPPPAVPGEGARPPPPPPPP 777 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP P P PPP PPP Sbjct: 755 PPPPP--PPAVPGEGARPPPPP--PPP 777 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-----PXXPPXPPXPXPP--PXXPPPXXP 906 P P+ PPP P P P P P P P P PPP P Sbjct: 48 PGWPQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPP 93 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG G G GG G G GGG Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGG 294 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGG 816 GGG G G G GG G GGG Sbjct: 399 GGGGGGGSAFGIEGGRGGHGGG 420 >SB_17742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P RP PP PP P P P P PP P Sbjct: 170 PQHDDRPQHRAPPRNFPVENAPPKQPFPGPMPTMHPPQSP 209 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +1 Query: 823 PXPXXPPXXPPXPPX--PXPPPXXPPP 897 P P PP P PP P PP PPP Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPP 105 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP PP P PP Sbjct: 148 PSSTPSSSLLPPPSSSPPLSSPPPPPPSTPSSSLLPP 184 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPP 879 P PPP PP P P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPP 897 P PP PP P P PP PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 P P PP P P P P P P P PPP P Sbjct: 643 PGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPPPQLP 684 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/64 (29%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = +1 Query: 709 RXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPR-PXXXPPPXPXXPPXXPPXPPXPXPPPX 885 R P + ++ P PP I + P P P P PP P P P P P Sbjct: 440 RIHPVIVPFHTPPRVEHVPFPIPVHSPPQIEKVPIPFPYPVPS-PPQIKPM-PYPVPVPV 497 Query: 886 XPPP 897 PP Sbjct: 498 RQPP 501 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG GG GG G G G G Sbjct: 84 GDGGGGGDGGG---GGDGGGDGDGDGDGDG 110 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXP 870 PP P PP PP PP P Sbjct: 74 PPQPTPPPPRPPTPPPP 90 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP+ PPPP Sbjct: 75 PQPTPPPPRPPT--PPPP 90 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T P P P P PP P P PP P P Sbjct: 737 TPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 >SB_43343| Best HMM Match : fn3 (HMM E-Value=3.4e-39) Length = 2865 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 388 NRETGILLSRQDXNTAEISTIVSQTYKHEY--LQKLI-EQW 501 NR +G+LLSRQ S +S TY+ + L+ L+ E+W Sbjct: 968 NRSSGVLLSRQSTGHMNASIKISTTYETSFSTLRPLVNEEW 1008 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGG-GXXXGRGIXGG 786 GGG G G G G G GG G GG G GRG G Sbjct: 19 GGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSG 57 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGX--XXGRGIXGG 786 G G G G G GG GG G G G G GRG G Sbjct: 24 GRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSG 65 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG GGG G G GG GG Sbjct: 154 GGGGRGGGRGHGRGGGSGGG 173 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G G G GG G G GGG GAG Sbjct: 228 GLGGLGGLGGVGGLGGVGGLGGIGGLGGGGVIAGAG 263 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG +GG GGG G GG GG Sbjct: 519 GGGAIGDGGDNGGGDDGGDDGAGNSDGGGGNDNGG 553 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GG G G G GG Sbjct: 516 GAIGGGAIGDGGDNG--GGDDGGDDGAGNSDGGGGNDNGG 553 >SB_13211| Best HMM Match : Extensin_2 (HMM E-Value=0.0053) Length = 545 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GGG GG GG G GG G GG Sbjct: 491 GGGSMGGASMAGGSMGGLGGLGGFGG 516 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 3/22 (13%) Frame = +1 Query: 838 PPXXPPXPPX---PXPPPXXPP 894 PP PP PP P PPP PP Sbjct: 785 PPEYPPPPPGLARPNPPPPNPP 806 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP-PXPPXPXPP 879 P PP P PP P PP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 >SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GGG GG G GG GG GG G G Sbjct: 20 GGGGLGGSGGSGGSGG-SGGSSGQTG 44 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 + P PP PP P PP P PP Sbjct: 147 LAHPSITQPPPRHSPPQTPVPPPPPLPP 174 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG----GGXXXGRGIXGGXXV 777 G GGG GGG GG G G G GG G GG V Sbjct: 126 GDGGGGSDGGGGSDGGGGDGEDDDGGDGDDDDGGDVEDDGDGGGMVV 172 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG GG G G G GG Sbjct: 423 GGSSGGGFGGSSG-GSFGGSSGGSFGGSGFGSKSSGGGGG 461 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GG GG G GG GG GG G G G Sbjct: 419 GGAFGGSSG-GGFGGSSGGSFGGSSGGSFG 447 >SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXP--XXPPXXPPXPPXP-XPPPXXPPPXXP 906 P P+P PPP P P PP P PPP P P Sbjct: 584 PSYPQPGTYPPPHPSGGYPQPSPPHGGHPHHPPPTGYPGGYP 625 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP P P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPP 879 P PP PP PP PP P P Sbjct: 1260 PLPPLPPPDAQPPSLPPQPPQPPQP 1284 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P PP P P P Sbjct: 1259 PPLPPLPPPDAQPPSLPPQPPQPPQP 1284 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGG 800 GGGG +G GGGG G G GG Sbjct: 101 GGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGG 134 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +1 Query: 838 PPXXPPXPPXPXP-PPXXPPPXXP 906 P PP P P P PP PPP P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPP 864 + P PPP P PP PP P Sbjct: 144 VSSPPRTPPPEPTPPPTPPPLRP 166 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP-PXPPXPXP 876 P P P PP P PP P P PP P Sbjct: 424 PPQPSPTGAPPQRPHPPPQQPSPRPPMGVP 453 >SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG G GG G GG G Sbjct: 186 GGGGGGTTGGG-GSGGEGTTGGGVSG 210 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +1 Query: 820 PPXPXXPPXXP---PXPPXPXPPPXXPPP 897 PP P PP P PP P PP P P Sbjct: 3809 PPGPQGPPGQASQIPGPPGPQGPPGPPGP 3837 >SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) Length = 487 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = -1 Query: 897 GGGXXRGGX-----GXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG RGG G G G G GGG G GD G Sbjct: 203 GGGPMRGGPMGGRGGPRGRGMQRGRGGPRGGGRGGFGGDFG 243 >SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPP 879 V R P L Y+ T PP I RP PPP P PP P P Sbjct: 290 VFRGLPQLPQYFEACHSSPSISRPATA-PPSISRPATAPPPVFRGLPQLPPVFRCLPQLP 348 Query: 880 PXXP 891 P P Sbjct: 349 PVFP 352 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 153 GGGRGGGGGGCGGGGG 168 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 419 GGGGRGGGGGDGGGGG 434 >SB_10098| Best HMM Match : NADH5_C (HMM E-Value=0.94) Length = 310 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 4/74 (5%) Frame = -1 Query: 483 LKIFMFICLRYYCR----YFCCIXVLAAKQYPCFSISLFGLTITSFL*YFFLKLYRSISL 316 L++ F+CL Y C Y + Y C S++ L + FF+ L + S Sbjct: 23 LRVLFFVCLNYNCSRASVYDLRVLFFVCLNYNCSRASVYDLRV-----LFFVCLNYNYSR 77 Query: 315 CSTTTLYLILFVFL 274 S Y LFV + Sbjct: 78 VSVIYAYCSLFVLI 91 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-----PXPXPPPXXPPPXXP 906 P P PPP P PP P P P P PP P Sbjct: 1445 PPFPAEHRIPPPDPAERRVPPPFPAERRTPAPDPAERRVPPPFP 1488 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P P P PP P Sbjct: 180 PPLNPYQPPPFPP-PHLMYPQPTAPPAAIP 208 >SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) Length = 402 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPP 879 RP P PP PP PP P P Sbjct: 232 RPTPQTEDNPGPPPVYPPNPPEPYSP 257 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG GG GG G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 >SB_36777| Best HMM Match : VWA (HMM E-Value=0) Length = 1303 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG GG G GG G Sbjct: 1099 GVGGGGAAGGGMVTGGAGINVGGSAG 1124 >SB_32048| Best HMM Match : NADH5_C (HMM E-Value=3.8) Length = 347 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 4/74 (5%) Frame = -1 Query: 483 LKIFMFICLRYYCR----YFCCIXVLAAKQYPCFSISLFGLTITSFL*YFFLKLYRSISL 316 L++ F+CL Y C Y + Y C S++ L + FF+ L + S Sbjct: 23 LRVLFFVCLNYNCSRASVYDLRVLFFVCLNYNCSRASVYDLRV-----LFFVCLNYNYSR 77 Query: 315 CSTTTLYLILFVFL 274 S Y LFV + Sbjct: 78 VSVIYAYCSLFVLI 91 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG GG GG G Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGG 89 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXP---PXPXPPPXXPPPXXP 906 PP +P+ PP P P P P P P P P P P Sbjct: 231 PPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEP 274 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 250 PVAEPEPERQPEPEP-EPEQEPEPEPEPEPEPEPEPEPEP 288 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPP 882 P P P P P P P P P P P P P Sbjct: 260 PEPEPEPEQEPEPEPEPEPEPEPEPEPEPEPEP 292 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG 840 G GGG GGG GG GG G Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,484,063 Number of Sequences: 59808 Number of extensions: 490905 Number of successful extensions: 11533 Number of sequences better than 10.0: 210 Number of HSP's better than 10.0 without gapping: 1602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5373 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -