BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O21 (906 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 52 7e-07 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 49 5e-06 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 48 6e-06 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 46 3e-05 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 46 3e-05 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 46 3e-05 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 46 3e-05 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 46 5e-05 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 46 5e-05 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 45 8e-05 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 45 8e-05 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 44 1e-04 At4g01985.1 68417.m00265 expressed protein 44 1e-04 At5g46730.1 68418.m05757 glycine-rich protein 43 3e-04 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 43 3e-04 At1g75550.1 68414.m08780 glycine-rich protein 43 3e-04 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 42 4e-04 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 42 4e-04 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 42 4e-04 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 42 6e-04 At2g30560.1 68415.m03722 glycine-rich protein 42 6e-04 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 42 7e-04 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 42 7e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 41 0.001 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 41 0.001 At2g05510.1 68415.m00583 glycine-rich protein 41 0.001 At1g61080.1 68414.m06877 proline-rich family protein 41 0.001 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 41 0.001 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 41 0.001 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 40 0.002 At4g30460.1 68417.m04325 glycine-rich protein 40 0.002 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 40 0.002 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 40 0.002 At1g29380.1 68414.m03592 hypothetical protein 40 0.002 At1g26150.1 68414.m03192 protein kinase family protein similar t... 40 0.002 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 40 0.002 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 40 0.002 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 40 0.002 At1g27710.1 68414.m03387 glycine-rich protein 40 0.002 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 40 0.003 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 40 0.003 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.003 At1g62240.1 68414.m07021 expressed protein 40 0.003 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 39 0.004 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 39 0.004 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 39 0.004 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 39 0.004 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 39 0.004 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 39 0.004 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 39 0.004 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 39 0.005 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 39 0.005 At1g70990.1 68414.m08190 proline-rich family protein 39 0.005 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 39 0.005 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 39 0.005 At1g04660.1 68414.m00463 glycine-rich protein 39 0.005 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 38 0.007 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 38 0.007 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 38 0.007 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 38 0.007 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 38 0.009 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 38 0.009 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 38 0.009 At4g18570.1 68417.m02749 proline-rich family protein common fami... 38 0.009 At3g50180.1 68416.m05486 hypothetical protein 38 0.009 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 38 0.009 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.009 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 38 0.009 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 38 0.009 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 38 0.012 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.012 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 38 0.012 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 38 0.012 At2g05440.2 68415.m00575 glycine-rich protein 38 0.012 At1g15830.1 68414.m01900 expressed protein 38 0.012 At1g04800.1 68414.m00476 glycine-rich protein 38 0.012 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 37 0.016 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 37 0.016 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 37 0.016 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 37 0.016 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 37 0.021 At1g53625.1 68414.m06096 expressed protein 37 0.021 At1g15840.1 68414.m01901 expressed protein 37 0.021 At1g02710.1 68414.m00222 glycine-rich protein 37 0.021 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 36 0.028 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 36 0.028 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 36 0.028 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 36 0.028 At1g10620.1 68414.m01204 protein kinase family protein contains ... 36 0.028 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 36 0.037 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 36 0.037 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 36 0.037 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 36 0.037 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 36 0.037 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 36 0.037 At2g05440.1 68415.m00574 glycine-rich protein 36 0.037 At1g11850.2 68414.m01364 expressed protein 36 0.037 At5g61660.1 68418.m07736 glycine-rich protein 36 0.049 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 36 0.049 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 36 0.049 At5g38560.1 68418.m04662 protein kinase family protein contains ... 36 0.049 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 36 0.049 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 36 0.049 At4g33660.1 68417.m04781 expressed protein 36 0.049 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 36 0.049 At4g16240.1 68417.m02464 hypothetical protein 36 0.049 At4g08230.1 68417.m01358 glycine-rich protein 36 0.049 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 36 0.049 At2g05530.1 68415.m00585 glycine-rich protein 36 0.049 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 36 0.049 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 35 0.065 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 35 0.065 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 35 0.065 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 35 0.065 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 35 0.065 At3g51290.1 68416.m05614 proline-rich family protein 35 0.065 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 35 0.085 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 35 0.085 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 34 0.11 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 34 0.11 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 34 0.11 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 34 0.15 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 34 0.15 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 34 0.15 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 34 0.15 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 34 0.15 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 34 0.15 At2g11005.1 68415.m01177 glycine-rich protein 34 0.15 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 34 0.15 At1g53620.1 68414.m06094 glycine-rich protein 34 0.15 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 33 0.20 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 33 0.20 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 33 0.26 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 33 0.26 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.26 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 33 0.26 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 33 0.26 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 33 0.26 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 33 0.26 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 33 0.26 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 33 0.26 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 33 0.26 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 33 0.26 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 33 0.26 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 33 0.34 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 33 0.34 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 33 0.34 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 33 0.34 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 33 0.34 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 33 0.34 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 32 0.45 At5g17830.1 68418.m02090 hypothetical protein contains Pfam doma... 32 0.45 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 32 0.45 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 32 0.45 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 32 0.45 At4g21720.1 68417.m03145 expressed protein 32 0.45 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 32 0.45 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.45 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 32 0.45 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 32 0.45 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 32 0.45 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 32 0.45 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 32 0.45 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 32 0.45 At1g11850.1 68414.m01363 expressed protein 32 0.45 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 32 0.60 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.60 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 32 0.60 At3g55950.1 68416.m06217 protein kinase family protein contains ... 32 0.60 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 32 0.60 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 32 0.60 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 32 0.60 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 32 0.60 At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein ... 32 0.60 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.79 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 31 0.79 At4g34150.1 68417.m04846 C2 domain-containing protein similar to... 31 0.79 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 31 0.79 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 31 0.79 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 0.79 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 0.79 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 31 1.1 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 31 1.1 At3g43583.1 68416.m04636 hypothetical protein 31 1.1 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 31 1.1 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 31 1.1 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 31 1.1 At1g30780.1 68414.m03763 F-box family protein 31 1.1 At1g07135.1 68414.m00759 glycine-rich protein 31 1.1 At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP... 31 1.4 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 31 1.4 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 1.4 At5g51300.2 68418.m06360 splicing factor-related contains simila... 31 1.4 At5g51300.1 68418.m06359 splicing factor-related contains simila... 31 1.4 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 31 1.4 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 31 1.4 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 31 1.4 At3g59640.1 68416.m06654 glycine-rich protein 31 1.4 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 31 1.4 At2g41420.1 68415.m05111 proline-rich family protein contains pr... 31 1.4 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 31 1.4 At1g74720.1 68414.m08658 C2 domain-containing protein contains I... 31 1.4 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 31 1.4 At1g47660.1 68414.m05295 hypothetical protein 31 1.4 At1g35617.1 68414.m04424 hypothetical protein 31 1.4 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 1.4 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 31 1.4 At5g56140.1 68418.m07003 KH domain-containing protein 30 1.8 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 30 1.8 At5g25425.1 68418.m03017 glycine-rich protein 30 1.8 At5g13760.1 68418.m01604 expressed protein similar to unknown pr... 30 1.8 At4g37900.1 68417.m05360 glycine-rich protein 30 1.8 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 1.8 At3g49300.1 68416.m05388 proline-rich family protein contains pr... 30 1.8 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 30 1.8 At3g13225.1 68416.m01660 WW domain-containing protein contains P... 30 1.8 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 30 1.8 At2g27660.1 68415.m03352 DC1 domain-containing protein contains ... 30 1.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 30 1.8 At1g77030.1 68414.m08970 glycine-rich protein 30 1.8 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 30 1.8 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 30 1.8 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 30 1.8 At3g46270.1 68416.m05008 receptor protein kinase-related contain... 30 2.4 At3g46240.1 68416.m05005 protein kinase-related similar to light... 30 2.4 At3g24250.1 68416.m03044 glycine-rich protein 30 2.4 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 30 2.4 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 30 2.4 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 30 2.4 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 30 2.4 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 30 2.4 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 30 2.4 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 30 2.4 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 29 3.2 At5g62440.1 68418.m07837 expressed protein 29 3.2 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 29 3.2 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 3.2 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 29 3.2 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 29 3.2 At3g15400.1 68416.m01954 anther development protein, putative si... 29 3.2 At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) fa... 29 3.2 At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) fa... 29 3.2 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 29 3.2 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 29 3.2 At1g36675.1 68414.m04563 glycine-rich protein 29 3.2 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 29 3.2 At1g28240.1 68414.m03466 expressed protein 29 3.2 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 29 4.2 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 29 4.2 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 29 4.2 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 29 4.2 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 29 4.2 At4g19920.1 68417.m02918 disease resistance protein (TIR class),... 29 4.2 At4g15460.1 68417.m02363 glycine-rich protein 29 4.2 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 29 4.2 At3g55790.1 68416.m06199 expressed protein predicted protein, Ar... 29 4.2 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 4.2 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 4.2 At3g10720.2 68416.m01291 pectinesterase, putative contains simil... 29 4.2 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 4.2 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 29 4.2 At2g28500.1 68415.m03463 LOB domain protein 11 / lateral organ b... 29 4.2 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 4.2 At1g53640.1 68414.m06100 hypothetical protein ; expression suppo... 29 4.2 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 29 5.6 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 29 5.6 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 29 5.6 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 29 5.6 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 5.6 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 5.6 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 5.6 At1g35880.1 68414.m04457 hypothetical protein 29 5.6 At1g21170.1 68414.m02647 expressed protein 29 5.6 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 5.6 At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar... 28 7.4 At5g11550.1 68418.m01347 expressed protein 28 7.4 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 28 7.4 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 28 7.4 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 28 7.4 At3g08640.1 68416.m01003 alphavirus core protein family contains... 28 7.4 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 28 7.4 At3g07195.1 68416.m00858 proline-rich family protein 28 7.4 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 28 7.4 At1g71830.1 68414.m08301 leucine-rich repeat family protein / pr... 28 7.4 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 28 7.4 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 28 7.4 At1g63830.2 68414.m07224 proline-rich family protein contains pr... 28 7.4 At1g63830.1 68414.m07223 proline-rich family protein contains pr... 28 7.4 At1g62510.1 68414.m07053 protease inhibitor/seed storage/lipid t... 28 7.4 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 28 7.4 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 28 7.4 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 28 7.4 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 28 7.4 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 25 8.0 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 28 9.8 At5g58540.1 68418.m07330 protein kinase family protein contains ... 28 9.8 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 28 9.8 At5g13910.1 68418.m01627 AP2/EREBP-like transcription factor LEA... 28 9.8 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 28 9.8 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 28 9.8 At4g32375.1 68417.m04610 glycoside hydrolase family 28 protein /... 28 9.8 At4g31580.1 68417.m04485 splicing factor RSZp22 (RSZP22) / 9G8-l... 28 9.8 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 28 9.8 At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet... 28 9.8 At3g45540.1 68416.m04918 zinc finger (C3HC4-type RING finger) fa... 28 9.8 At3g44950.1 68416.m04843 glycine-rich protein 28 9.8 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 28 9.8 At3g16350.1 68416.m02068 myb family transcription factor ; conta... 28 9.8 At2g34870.1 68415.m04281 hydroxyproline-rich glycoprotein family... 28 9.8 At2g30505.1 68415.m03716 Expressed protein 28 9.8 At2g23770.1 68415.m02839 protein kinase family protein / peptido... 28 9.8 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 28 9.8 At1g53560.1 68414.m06078 expressed protein 28 9.8 At1g45688.1 68414.m05202 expressed protein 28 9.8 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 9.8 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 28 9.8 At1g09460.1 68414.m01058 glucan endo-1,3-beta-glucosidase-relate... 28 9.8 At1g02460.1 68414.m00195 glycoside hydrolase family 28 protein /... 28 9.8 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 51.6 bits (118), Expect = 7e-07 Identities = 22/43 (51%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP P P PPP P PP PP PP P PPP PPP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 50.8 bits (116), Expect = 1e-06 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P P PPP P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/40 (52%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP P P PPP P PP PP P P P PPP PPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 46.0 bits (104), Expect = 3e-05 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-----PXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P P PP P PPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP PP P PP PPP P Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPPPPPPSP-PPYVYPPPPPP 431 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPP 448 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP PP PP PPP PP P Sbjct: 403 PPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYP 445 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 P+ PPP PP P PPPP P PS PPPP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PPP PP P Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP--PPSPQP 453 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXPPX---PPXPXPPPXXPPPXXP 906 PP P P PP P P PP PP PP P P PPP P Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 P P P PPP PP P PP P PP PPP Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPP 447 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP PP PPPP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPP-PPYVYPPPP 438 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPPP Sbjct: 393 PPPPPPPPPPPPPPPYVYPSPP--PPPPSPPPYVYPPPP 429 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P PP PP P P PP Sbjct: 426 PPPPPPYVYPPP-PSPPYVYPPPPPSPQPYMYPSPP 460 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P P PP PP PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP-PSXXPPPP 902 PPP PP P PPPP P P P PP Sbjct: 428 PPPPYVYPPPPSPPYVYP---PPPPSPQPYMYPSPP 460 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 48.8 bits (111), Expect = 5e-06 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP P P P PPP PPP Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 48.8 bits (111), Expect = 5e-06 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PPP PP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSP 497 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/42 (50%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 PP P P PPP PP PP PP P PPP PPP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX----PPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP P PP PPP P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP P P PP PP P PP PPP P Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP PP PPP PPP P Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 PP P PPP P P PP PP P P PP PPP P Sbjct: 433 PPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPP 475 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP PP PPP PPP P Sbjct: 455 PPPPPPPPVYSPPPPPPPP--PPPPPVYSPPPPSPPPPPP 492 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 PP P P PP P PP PP PP P PPP PP P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSP 512 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P PP PP P PPP PPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPP 476 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP P PP PP P PPP PP P Sbjct: 424 TSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSP 466 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP PP P PPP PP P Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPP--XXPPPXXP 906 PP + P PPP P PP P PP P PPP PPP P Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 447 PVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP 485 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P Y PP PP P PPPP PP PPPP Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP + P PP P P PP PP P PPP PPP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP P P P P PPP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PPP P P PP PP PP P P Sbjct: 491 PPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +3 Query: 735 LSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 L+S P + P PPP PP P PPP PP PPPP Sbjct: 423 LTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P Y PP PP P PPPP PP PPP Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPP 484 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P P PP P PP PPP P Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP P PPPP Sbjct: 478 PVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP P P P PP PPP P Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P PP PPP PPP Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPP 445 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPP---XXPPPXXP 906 PP P P PPP P P PP PP P PPP PPP P Sbjct: 571 PPHSPPPPHSPPP-PIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P PP PPP PPP Sbjct: 541 PPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP 577 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP--PPPPP 508 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPP--PXXPPPXXP 906 PP P P PPP P P PP P P PP PPP P Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 PP P P PPP P PP P P P P PPP P Sbjct: 502 PPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP 545 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP---PPXXP 906 PP P PPP PP P PP PPP P PP P Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPP 595 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P P P P P PP P Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P Y PP PP P PPP PP PPP Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPP 499 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP S PPPP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 PP + P P P P P PP PP P PP PPP P Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP PP P P PP PPP P Sbjct: 535 TRPPP--PPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSP 575 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPPP P PPP Sbjct: 566 PHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPP 603 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP PP PPPP Sbjct: 514 PPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP--PXPXPPPXXPPPXXP 906 P P PPP PP PP P P PPP P P Sbjct: 564 PPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSP 601 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP P P PP P PP PP P P P PPP P Sbjct: 501 PPPPPPPPVYSPPPPPV-YSSPPPPPSPAPTPVYCTRPPPPPP 542 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPP P PPP Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP PPPP PP PPP Sbjct: 415 PIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPP 453 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PP PP PPPP Sbjct: 421 PTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPP 459 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YP PP PPP PP PPPP Sbjct: 583 PPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPP 621 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXX--PPPPXPP----SXXPPPP 902 PPP PP P PPPP PP S PPPP Sbjct: 403 PPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPP 443 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P + PP PP P PPPP P S PP P Sbjct: 570 PPPHSPPPPHSPPPPIYPYLSP---PPPPTPVSSPPPTP 605 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXX--PPPPX--PPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 540 PPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPP 578 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P PP PP PPP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPP 644 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPP---XXPPP 897 PP P PPP P PP PP P PPP PPP Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPP 653 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P P P P P PPP PPP Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPP 433 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P PP PP P PPP Sbjct: 630 PPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P P PP P PPP Sbjct: 682 PPPSPVHYSSPPPPPSAPCEESP-PPAPVVHHSPPPP 717 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA P PP P PPPP P PPP Sbjct: 527 PAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPP 565 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP---PPPXP-PSXXPPPP 902 P PPP PP P P PPP P S PPPP Sbjct: 572 PHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PPPP Sbjct: 612 PPPCIEPPPPPPCIEYSPP--PPPPVVHYSSPPPP 644 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP P PPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSPPPPPPVHYSSP--PPP 675 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 PRP P P P PP P PP PPP P Sbjct: 394 PRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSP 431 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PP P P PP PP PPPP Sbjct: 408 PSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 PPP P P PPP P PP PPPP Sbjct: 521 PPPPPSPAPTPVYCTRPPP--PPPHSPPPPQFSPPPP 555 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP PPP S PPPP Sbjct: 611 PPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPP---XXPPPXXP 906 PP P PPP P P PP P PPP PPP P Sbjct: 619 PPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPP 666 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 563 PPPPHSSPPPHSPPP--PHSPPPPIYPYLSPPPPP 595 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P P P PPP Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPP 539 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P PPPP S PPPP Sbjct: 621 PPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPPP PPPP Sbjct: 597 PVSSPPPTPVYSPPPPPPCIEP--PPPPPCIEYSPPPPP 633 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/44 (47%), Positives = 21/44 (47%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP----PXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P P P PP PP P PPP PPP P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXPPPXXPPPXXP 906 PP P P P P PP PP PP P PPP PPP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P P PP P PP PPP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLP 101 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P PP PP P P PPP PPP P Sbjct: 67 PPPCPPPPSPPPCPPPPSPPPSPPPPQLP-PPPQLPPPAPP 106 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PP P P P P P P P Sbjct: 76 PPPCPPPPSPPPSPP--PPQLPPPPQLPPPAPPKPQPSPP 113 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P P PP P PP PP P Sbjct: 72 PPPSP-PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P P PP P P PP PP P P P P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P P P P P P P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 35.5 bits (78), Expect = 0.049 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP +P P PPP P P PP P P Sbjct: 91 PPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPPP Sbjct: 62 PPPPPPPPCPPPP--SPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP P PP P PPS P PP Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPP 90 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P P P P P PPPP PP PPP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PPP PP P PPPP P PPPP Sbjct: 58 PADCPPPP---PPPPCPPPPSPPPCPPPPSP-PPSPPPP 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP PPP Sbjct: 67 PPPCPPPPS--PPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P+ P P P P PPP PP PPP Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPP 87 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +3 Query: 786 PAXYPPPXXXXP-PXXXXXXXXPXXXPPPP--XPPSXXPPP 899 P PPP P P P PPPP PP PPP Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PP PP P PPP PP P P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXX---XPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP PP P PP Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PP P P PP P Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXX-XPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP P PP P Sbjct: 69 PCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKP 108 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 46.4 bits (105), Expect = 3e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP P PP PP PP PPP P P P Sbjct: 118 TVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPP 897 T PP P P PPP P P PP P P PP P PPP Sbjct: 102 TVKPP--PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP PP P P PP PPP Sbjct: 113 PPPPPTVKPPPPPTPYTPP--PPTPYTPPPPTVKPPP 147 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PP IP P PP P P PP PP P PPP PP P Sbjct: 70 PPYIPCPP--PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P PP P PP P PPP PP P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PPP P P PP P PP PPP Sbjct: 86 TVKPP--PPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPP 123 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXPPPXXPPPXXP 906 PP P P PPP P P PP P P P P PPP P Sbjct: 97 PP--PPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP P P PP P PPP PP P Sbjct: 108 PPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP + P PPP P PP PP P PPP P Sbjct: 147 PPPVVTP---PPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPP-XXPPPXXP 906 T PP + P PPP PP P P P P PPP PPP P Sbjct: 137 TPPPPTVKPP---PPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P PP P P PP P P PP PPP Sbjct: 57 PTHTPKPPTVKPPPPYIP--CPPPPYTPKPPTVKPPP 91 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPX--PXXPPXXPPXPPXPXP------PPXXPPPXXP 906 T P P P PPP P PP P PP P P PP P P P Sbjct: 126 TPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPP 894 P P+P PP P P PP P P PPP P Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTP 82 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP P PP PP PPPP Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P P P PP+ PPP Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPP 140 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 4/38 (10%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPPXXP 906 P P P PP P PP PP P PPP P Sbjct: 45 PAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTP 82 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 P PP PP PPP P PP+ PPPP Sbjct: 52 PTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPP 92 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPPP Sbjct: 107 PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPP 897 P P P PP P PP P P P PP PPP Sbjct: 32 PKPSPHPVK-PPKHPAKPPKPPTVKPPTHTPKPPTVKPPP 70 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP + P P P PP PP P P P P P Sbjct: 148 PPVVTPPPPTPTPEAPCPPP-PPTPYPPPPKPETCP 182 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP PP+ PPP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPT-VKPPP 123 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P P P PP+ PPP Sbjct: 114 PPPPTVKPPPPPTPYTPPPPTPYTPPPPT-VKPPP 147 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P+P PPP PP P P P PP PPP Sbjct: 121 TKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPP 160 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P+P PPP P PP P PP PP PP P Sbjct: 144 TKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITP 187 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I +P PPP PP PP P P PP PPP P Sbjct: 114 PPIVKPPTKPPPSTPKPPTKPP-PSTPKPPTTKPPPSTP 151 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P+P PPP PP P PP P PPP P P P Sbjct: 132 TKPPPSTPKPPTTKPPPSTPKPPHHKP-PPTPCPPP-TPTPTPP 173 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 T PP P+P P P P P PP P P P P PPP P Sbjct: 96 TVKPPH-PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTP 139 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP PP P PP PPP PP P Sbjct: 127 TPKPPTKPPPSTPKPPTTKPPP-STPKPPHHKPPPTPCPPPTP 168 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 T PP P P P PP P PP P P PP PP Sbjct: 138 TPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPP 178 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P PP P P P P P P Sbjct: 207 PPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 PP + P PP P P P P PPP P PP P Sbjct: 94 PPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKP 134 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P PP P PP PP PP Sbjct: 104 PPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPP 142 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP PP PP P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTP 197 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPX--PPPXXPPPXXP 906 P P P PP P P PP P P PP PP P Sbjct: 177 PPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITP 217 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPX--PPPXXPPPXXP 906 P P P PP P P PP P P PP PP P Sbjct: 187 PPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTP 227 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP P P P P P Sbjct: 197 PPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXI-PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PPP P P PP P PP PP P Sbjct: 150 TPKPPHHKPPPTPCPPPTPTPTPPV-VTPPTPTPPVITPPTPTP 192 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P PP P P P P P Sbjct: 166 PTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 T PP I P PP P P PP P PP PP P Sbjct: 179 TPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTP 222 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 T PP P P PP P PP PP P PP PP P Sbjct: 161 TPCPPPTPTP---TPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 T PP + P PP P P PP P PP PP P Sbjct: 169 TPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 T PP + P PP P P PP P PP PP P Sbjct: 189 TPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP P P PP P P P P P Sbjct: 217 PPTPTPPVVTPPTPTPPVVTPPTPTPPTPIPETCP 251 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P PP PP PP PP P Sbjct: 34 PAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKP 72 Score = 32.7 bits (71), Expect = 0.34 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 PP + P+P PP P P P P PP PP PPP P Sbjct: 85 PPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIV-KPPTKPPPSTP 128 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXP-----PXXPPXPPXPXPPPXXPPPXXP 906 PP + P+P PP P P P P P P PP P P P Sbjct: 49 PPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP PP P Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKP 67 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP P P P Sbjct: 43 PVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPP 77 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P P P P PP P P P Sbjct: 46 PPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPP 86 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P PP P P PP P P P PP Sbjct: 43 PVKPPKPPAVKPPKP--PAVKPPTPKPPTVKPHPKPP 77 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 PP + P PP P P P P P PP P P P P Sbjct: 57 PPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPP 100 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PP P Sbjct: 142 PTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTP 180 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P P P PP P PP PP P Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 46.0 bits (104), Expect = 3e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP PP P PPP PPP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P+ PPP P PP PP PP P PPP Sbjct: 35 PPLFPQSPPPPPPPPPPPP--PPPPPPPPPPP 64 Score = 40.3 bits (90), Expect = 0.002 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PP PP PP P PPP PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PP PPP Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP PP PPP P Sbjct: 42 PPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PPP PPP Sbjct: 46 PPPPPPPPPPPPPPPPPPPAVNMSVETGIPPP--PPP 80 Score = 31.9 bits (69), Expect = 0.60 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 20/59 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX-----------PXPPPXX---------PPPXXP 906 P P P PPP P PP PP PP P PPP PPP P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPP 97 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 819 PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP P PPPP PP PPP Sbjct: 77 PPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 20/60 (33%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP----------PXPPXPX----------PPPXXPPPXXP 906 PP P P PPP P PP P P PP P PPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P P PP P PP PPP P Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQP-PPRSQPPPKPP 107 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP------PSXXPPPP 902 P PPP PP PPPP P P PPPP Sbjct: 50 PPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P PPP Sbjct: 92 PPPQPPPRSQPPPKPPQKNLPRRHPPP 118 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP---XXPPXXPPXPPXPXPP 879 PP P P PPP P P PP P P P Sbjct: 92 PPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKP 125 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P P P P PP PPP P P Sbjct: 72 TGIPP--PPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLP 112 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 9/44 (20%) Frame = +3 Query: 798 PP--PXXXXPPXXXXXXXXPXXXPPPPXPP-------SXXPPPP 902 PP P PP P PPPP PP + PPPP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPP 78 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PP PP PP P P P PP P Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKP 87 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPP-PXXP 906 PP P+P P P P P PP P P P PPP PP P P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPP-XPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PP P+P PPP P PP P P P P P P PP P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 39.5 bits (88), Expect = 0.003 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P PP P P P PPP P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P PPP P P P PP P P P PP P Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSP-PPKPQPKPVPPPACPP 70 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXP---PPXXPPP 897 P P P PPP P P PP PP P P PP PPP Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+P P P P P PP P P P P P P P Sbjct: 69 PPTPPKPQPKPAPPPEPKPAPPPAPK-PVPCPSPPKPPAP 107 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P PP P P PP P P P PPP P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPP 44 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P PPP P P P P P P PPP P P Sbjct: 25 PPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVP 64 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP P P P PP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPP 105 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/40 (45%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P PPP P P PP P P P P P PP P Sbjct: 72 PPKPQPKPAPPPEP--KPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P P PP P P PPP P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCP 99 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P P P P PP P P P PP PP P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P PP P P P Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 PP P P P P PP P P P P P P PP Sbjct: 101 PPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PP P PP PP P P P P P P Sbjct: 93 PKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAP 135 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P PP P P P P P P PP P Sbjct: 6 PDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSP 48 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP P PP P P P PP P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKP 58 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P PP P P P P P P P P P P Sbjct: 104 PPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA P P PP P PP P P P PP Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P+P P P P P PP P P P P P P P Sbjct: 99 PSPPKPPA-PTPKPVPPHGPPPKPAPAPTPAPSPKPAPSP 137 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P PP P P PPP P P Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQ-PKPPPAPSPSPCP 52 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P P P PP P P PP P PPP Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P P P P P P P PP P Sbjct: 113 PPHGPPPKPAPAPTPAPSPKPAPSPPKP 140 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/38 (31%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP P P P P PP+ P P Sbjct: 60 PKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP PP PP PPP P Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP PP PP P P PPP PPP P Sbjct: 1084 PPLPPSSLPPPPPAALFPP-LPPPPSQPPPPPLSPPPSPP 1122 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P PP P P PPP PPP Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP PP P P PP PPP Sbjct: 1063 PLPQESPPPLPPLPPSPPP-PSPPLPPSSLPPP 1094 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 P P PP PP PP PP P PP P PP P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLP 1092 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP PP P PPS PPPP Sbjct: 1076 PPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPR--PXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 P +P+ P PP P PP PP PP P PPP P P Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLP 1104 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P P PP PPS PPPP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPP-PSPPLPPSSLPPPP 1095 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 3/53 (5%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPP-PXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 P + L P PP P PP P PP PP PP PP P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP----PSXXPPPP 902 P+ PPP PP P PPP P PS PPPP Sbjct: 1088 PSSLPPP----PPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P PPP PP P PPPP PPS Sbjct: 1101 PPLPPPPSQPPPP----PLSPPPSPPPPPPPPS 1129 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 P L PA PP P P PPPP PP Sbjct: 1085 PLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP PP P PPP PPP P Sbjct: 65 PPPPPTSPP--PPSPPPPSPPPPSPPPPSP 92 Score = 44.0 bits (99), Expect = 1e-04 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 + P PP P P PP PP P PPP PPP Sbjct: 61 VDEPPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P PPP P P PP PP P PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP P PP P PPP PPP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSP-PPPSPPPP 95 Score = 37.1 bits (82), Expect = 0.016 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 PP P P PPP P P PP PP P Sbjct: 68 PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 64 PPPP---PPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P P P P PP P PP P PP Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P PP P PPP PPP P Sbjct: 64 PPPPPPTSPPPPSP-PPPSPPPPSPP 88 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP 861 T PP P P PPP P PP PP P Sbjct: 70 TSPPPPSPPPPSPPPPSP--PPPSPPPP 95 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GG G GG G G G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGG 162 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G G G G G G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGG 158 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG G GG G GGG G GG Sbjct: 133 GGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGG 169 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GG G GG GG GG G GG G G Sbjct: 141 GGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYG 172 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G GG GG GG G GG G G Sbjct: 141 GGYGGG-AGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGG 178 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G G G GG G G GG Sbjct: 126 GGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGG 165 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG G G GG G G GG Sbjct: 164 GGNSGGGYGGNAAGGYGGSGAGGYGGDATGHGGAGG 199 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GG G GG G GG G G G G G Sbjct: 146 GAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGG 181 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG G G GG G G GG Sbjct: 168 GGGYGGNAAGGYGGSGAGGYGGDATGHGGA-GGGYGSSGG 206 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG G G GG G G GG Sbjct: 154 GGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGG 189 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG GG GGGG G G GG G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGG 159 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 44.8 bits (101), Expect = 8e-05 Identities = 22/37 (59%), Positives = 22/37 (59%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG GRG GG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGG---GRGGGGG 181 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG GG GG GG G GGG Sbjct: 152 GGGGGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GG GG GG GG G GGG G Sbjct: 95 GGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGG 128 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX---GGXXGXGGGXXXGRGIXG 789 G GGG GG G GG G GG G GGG GRG G Sbjct: 84 GNSGGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGG 125 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/35 (54%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG G GGG G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGG-GGRGGGGGGG 183 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG GG G GGG GRG GG Sbjct: 76 GPDGAPVQGNSGGGSSGGRGGFGGGRGGGRGSGGG 110 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXS 778 G GGG G G GG G G GGG GG G G S Sbjct: 149 GGYGGG----GGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYS 187 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG G GG G G GGG G G Sbjct: 154 GGGGYGGGGGYGGGGGGYGGGGRGGGGGGGSCYSCG 189 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -3 Query: 901 GGGGXXEGGXG-GGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG G GGG G GG GGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGG 182 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GG G GG GGGG G G GGG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P P PP PP PPP PPP Sbjct: 673 PLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PP P P PP PP P PPP PP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGPPPPP 702 Score = 33.9 bits (74), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP 864 PP P P PPP P P PP PP Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GG GGG G GG GG GG G GG G G GI GG Sbjct: 454 GGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGG 495 Score = 42.3 bits (95), Expect = 4e-04 Identities = 23/43 (53%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG--IXGG 786 G GGG GGG G G G GG GG G GGG G G I GG Sbjct: 109 GRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG GG GG G G GG G GI GG Sbjct: 104 GGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGG 143 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG G GGG G GG Sbjct: 155 GVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG G GG GRG GG Sbjct: 74 GGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G GG Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGG 139 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG GG G GG G G+ GG Sbjct: 50 GAGAGGGASGGIGVGG-GGGGGGGIGGSGGVGAGGGVGGG 88 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG GG GG G GGG G G GG Sbjct: 458 GSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGG 499 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G G G G G G+ GG Sbjct: 242 GSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGG 281 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRG 798 G GG GGG G G G GG GG G GGG G G Sbjct: 164 GGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGG 200 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G G G GG Sbjct: 62 GVGGGG--GGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGG 100 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GGG G G+ GG Sbjct: 402 GGASGGASGGVGGAGGAGGSVGAGGGVGGG--VGGGVGGG 439 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G G GGG G + G Sbjct: 518 GAVGGGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVG 557 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G G G + GG Sbjct: 485 GVGGGGGIGGGAG-GGVGGGVGGGVGGGVRGAVGGAVGGG 523 Score = 37.5 bits (83), Expect = 0.012 Identities = 20/42 (47%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGG-XXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G GG G G+ GG Sbjct: 304 GGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGG 345 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG GG GG G G G G G+ GG Sbjct: 473 GTGGSVGAGGGVGVGGGGGI-GGGAGGGVGGGVGGGVGGG 511 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG-XGGGXXXGRGIXG 789 G GGG GG G G GG GG G GGG G G G Sbjct: 66 GGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGG 105 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG GG G GG G G GG Sbjct: 223 GGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGG 263 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G G G G GG G G+ GG Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG 277 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG G G GG GG G G G G G+ G Sbjct: 322 GGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG G G G G G+ GG Sbjct: 468 GGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGG 507 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG G G G GGG G G GG Sbjct: 94 GGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGG 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G GG G G G GGG G G+ G Sbjct: 522 GGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAG 561 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG G G G GGG G G G Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGG-GVGGGVGAGGGAGG 187 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G GG GG G GGG G G G Sbjct: 347 GGGVGGGVGGGVG-GAVGGAVGGAVGGGGGGSVGGGGRG 384 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G G GG G GGG G G+ GG Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGG--VGGGVGGG 435 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G GG GG G GGG G G G Sbjct: 429 GGGVGGGVGGGVG-GAVGGAVGGAVGGGGGGSVGGGGRG 466 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G G G G G+ G Sbjct: 141 GGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG---XXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG G GG G GGG G G G Sbjct: 168 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRG 209 Score = 35.5 bits (78), Expect = 0.049 Identities = 21/42 (50%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXG-GGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GG G G GGG G G+ GG Sbjct: 246 GSVGGGGRGSGGVGASGGAGGNVGAGGGLGGG--VGGGVGGG 285 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG-XGGGXXXGRGIXGG 786 GGG GG G GG GG G G G G G+ GG Sbjct: 312 GGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGG 349 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G GG GG G G G G G GG V Sbjct: 533 GASGGAGAGGGAG-GGVGGGANVGVGVGAGGSTGGGAAGGGGV 574 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G GG G G GGG G G G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGG-GVGGGVGAGGGAGG 132 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GG G G G + GG Sbjct: 271 GGGLGGGVG-GGVGGGVGGSVGGAVGGAVGGAVGGG 305 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GG G G G + GG Sbjct: 339 GGGVGGGVG-GGVGGGVGGGVGGAVGGAVGGAVGGG 373 Score = 34.7 bits (76), Expect = 0.085 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GGG G G GG G G GGG G GG V Sbjct: 446 GAVGGAVGGGGGGSVGGGGRGSG--GAGGGTGGSVGAGGGVGV 486 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG G G GG G G G Sbjct: 493 GGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSG 532 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGGG----XGXGGXGGXXGGXXGXG--GGXXXGRGIXGG 786 G GG GGG G G GG GG G G GG G G+ GG Sbjct: 78 GVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGG 123 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G G GG G GG GRG G Sbjct: 129 GAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSG 168 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GGG G G+ GG Sbjct: 314 GRGSGGASGGASGGASGGAGGSVGAGGGVGGGV--GGGVGGG 353 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG G G G G G+ GG Sbjct: 318 GGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGG 357 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG GG GG GG G G G G + G Sbjct: 330 GGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGG 368 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG GG G G G G GG Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASG-GASGG 411 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG G G G G GG Sbjct: 381 GGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGG 420 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG GG G G G + GG Sbjct: 416 GGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGG 455 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGGXXV 777 G GG GG G GG G GG G GG G G + G V Sbjct: 441 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGV 484 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/40 (47%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGGXXV 777 GG GGG G G G G G G GGG G G+ GG V Sbjct: 517 GGAVGGGVGGAGRGSGGASGGAGAGGGA--GGGVGGGANV 554 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GG GG G GG G GGG GGAG Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAG 90 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G GG G G GG Sbjct: 117 GGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGG-GASGG 155 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG G G GGG G G GG Sbjct: 149 GGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGG 184 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG GG G G G GG Sbjct: 528 GRGSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGG 567 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -2 Query: 896 GGGXXG---GGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 GGG G G G G GG GG G GG G G G+ GG Sbjct: 137 GGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGG 178 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GG G GG GG GG G G G G + G Sbjct: 411 GVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGG 450 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GG G G Sbjct: 291 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG 330 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GG G G Sbjct: 359 GGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASG 398 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = -2 Query: 905 GXXGGGXXGG------GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GG G G+ GG Sbjct: 386 GGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGGGVGGG 431 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG GG G GG G GG GG G GG V Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTV 220 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G G G GG G G GG G G G G G GG V Sbjct: 206 GGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSV 248 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = -2 Query: 893 GGXXGGGXG---XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GG G G G + GG Sbjct: 425 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGG 463 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G GG G G G GGG GG G G+ G Sbjct: 122 GGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSG 168 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG G GG G GGG G G G Sbjct: 218 GTVGAGGRGSGGASGGV-GVGGGAGGSGGGSVGGGGRGSG 256 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG--XXXGRGIXG 789 GGG GG G G GG G GGG GRG G Sbjct: 192 GGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGG 229 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G G G G G G + GG Sbjct: 212 GASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGG 251 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GG G GG G G GG Sbjct: 376 GSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGG 417 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG G G G G G GG GG G GR G Sbjct: 490 GGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASG 536 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G G GG G + G Sbjct: 184 GAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAG 223 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GG GG GG GG G G G + G Sbjct: 262 GGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGG 300 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG G G G GG Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGG 403 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGX--GGXGGXXGGXXGXGGGX-XXGRGIXGG 786 G GGG GG G G GG GG G GGG G G G Sbjct: 276 GGVGGGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSG 318 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G G G G GG G G G Sbjct: 537 GAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVG 575 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G GG G G GGG G G G Sbjct: 45 GSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVG 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G GG G G GG GG G GGG G G Sbjct: 407 GASGGVGGAGGAGGSVGAGGGVGG--GVGGGVGGGVG 441 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GG G G G GG GG G G G GG V Sbjct: 194 GIGSGGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGV 236 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G G G G GG Sbjct: 229 GASGGVGVGGGAG-GSGGGSVGG-GGRGSGGVGASGGAGG 266 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG--GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G G GG GG G G G G GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASG-GASGG 407 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GG Sbjct: 295 GGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGAGG 334 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G GG G G G GGG GG G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GGG G GG Sbjct: 352 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 391 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG GGG G GG Sbjct: 434 GGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGG 473 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/47 (36%), Positives = 18/47 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G GGG GG G G G GGG GAG G + G Sbjct: 173 GGVGGGVGAGGGAGGSVGAGGGIGS--GGGGTVGAGGRGSGGASGGG 217 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG GG G GG G GG G GG Sbjct: 177 GGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G G G GG GG G G Sbjct: 183 GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVG 221 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GG G G G G GGG GG G Sbjct: 252 GRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVG 287 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXG--GGXGXGGXGGXXGGXX--GXGGGXXXGRGIXGG 786 G GGG G GG G GG GG GGG G GG Sbjct: 280 GGVGGGVGGSVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGG 323 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RG G G G G GG GGAG G Sbjct: 505 GGGVGGGVRGAVG-GAVGGGVGGAGRGSGGASGGAGAGG 542 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -3 Query: 895 GGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG GG GGGG G GG GG G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGG 95 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G RG G G G G GG GG G G Sbjct: 200 GGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGG 238 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG G GG G GGG G G GG Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGG 225 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXX-GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG G GGG G G GG Sbjct: 227 GAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGG 267 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/42 (52%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG GG G GGG G G GG Sbjct: 191 GGEGGGAGGGGSHGGAGGYGGGGGGGSG-GGGAYGGGGAHGG 231 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG GG GG GG G G G G G G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGG 75 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 173 GGGGGGSAGGAHGGSGYGGGEGGGAG-GGGSHGGAGGYGG 211 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG GGG G G GG Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G G GG GG G GGG G G G Sbjct: 182 GAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GGG G G GG Sbjct: 249 GGYGGGGGGGEGGGGSYGGEHGG--GSGGGHGGGGGHGGG 286 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GG GGG G G GG GG G G GG G G GG Sbjct: 245 GGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGG 285 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG-XXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG GG GG GGG G G G Sbjct: 196 GAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSG 236 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G G GG GG G GGG G G Sbjct: 212 GGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G GG G G G GGG G G G Sbjct: 163 GAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGG 201 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G GG G GG Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHGG 271 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG G G G G G GG Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGG 72 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GG GGG G G GG GG G G G G GG Y Sbjct: 54 GGESGGGYGGGSGEGA-GGGYGGAEGYASGGGSGHGGGGGGAASSGGY 100 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG G GG G GG G G GG Sbjct: 153 GGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG 192 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G GGG G G GG Sbjct: 216 GSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG 256 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG GG GG GG GG G G GG Sbjct: 177 GGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGG 216 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G G G G G G Sbjct: 121 GGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASG 159 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GG GG GG GG G GG G G G GG Sbjct: 237 GGEGGGY--GGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGG 276 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG G GGG G GG Sbjct: 152 GGGAGASGYGGGAYGG--GGGHGGGGGGGSAGGAHGG 186 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG G G G G GG Sbjct: 169 GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG 208 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G G GG GG GGG Sbjct: 258 GEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G G G G G G Sbjct: 99 GYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAG 138 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXX-GGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG GG G GGG G G GG Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGG--GGGGSAGG 182 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG G G GG G G GG Sbjct: 159 GYGGGAYGGGGGHGGGGGG--GSAGGAHGGSGYGGGEGGG 196 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGG----GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G GG GG G G GG G G GG Sbjct: 89 GGGGGAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGG 132 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG G G GG G G G Sbjct: 113 GGAAGGHAGGGGGGSGGGG--GSAYGAGGEHASGYGNGAG 150 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G G G G G GGG G G GG Sbjct: 138 GGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGG 173 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG EGG G G G GG GGG Sbjct: 253 GGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGG 287 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G GG G G GGG G G GG Sbjct: 84 GSGHGGGGGGAASSGGYASG-AGEGGGGGYG-GAAGG 118 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G G G G Sbjct: 117 GGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG----GGXXXGRGIXGG 786 G GG GG G GG G G G GG G G GG Sbjct: 66 GEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGG 109 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXG--XXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GG G G Sbjct: 241 GGYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGG 281 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G GG GG G Sbjct: 188 GYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GG GGGG G G GGG G Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGG 246 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GG G G GGG G Sbjct: 224 GGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGG 800 GGG GG GGG G GG GG Sbjct: 82 GGGSGHGGGGGGAASSGGYASGAGEGGGGGYGG 114 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 PP P PPP P P PP PP PPP PPP P Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLP 86 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPP--XXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP PP P PPP PPP P Sbjct: 75 LPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEP 113 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPP 897 PP P P P P PP P PP P PPP PPP Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP PP P PPP PPP P Sbjct: 60 PALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEP 99 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 8/47 (17%) Frame = +1 Query: 790 PXIP-RPXXXPPPXPXXPPXXPP-----XPPXPXPPP--XXPPPXXP 906 P +P P PPP P PP PP PP P PP PPP P Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFP 81 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-----XXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP PP P P PP PPP P Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPP 108 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +1 Query: 742 PXLXXXXXXXXXTXXPPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P L T PP + P PPP P P PP P P P P P P Sbjct: 14 PSLGNLPPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +3 Query: 753 PXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPP-PPXPPSXXPPPP 902 P V L P PPP PP P PP PP PP PPP Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPP--RLPPPFPALFPPEPPLPPRFELPPP 78 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 720 YPXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPP---XPPSXX 890 +P LS P P +P PP P PPPP PP Sbjct: 34 FPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLL 93 Query: 891 PPP 899 PPP Sbjct: 94 PPP 96 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPP-SXXPPPP 902 PPP PP P PPP PP PPPP Sbjct: 76 PPPLFPPPPLPRLP---PPLLPPPEEPPREPPPPPP 108 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG G GG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/31 (58%), Positives = 18/31 (58%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG G GG GG GG G GGG G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/35 (54%), Positives = 19/35 (54%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG GG GG G GGG G G GG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/34 (52%), Positives = 18/34 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG GGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG GG G G G G G Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G G GGG + GG Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/48 (41%), Positives = 21/48 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GGG GGG G GG GG G GG G+G G K Y Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGREGRGEFVKREY 129 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G GG G GG G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G GG GG GG G GGG G GG Sbjct: 61 GSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG G GG GG GG G GGG G G G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWG 94 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GGG GG G G G G G GG GR Sbjct: 79 GGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKGR 118 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 878 GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G GG G GGG G G GG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGG 90 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -3 Query: 892 GXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 G GG GGGG G GG GGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPP---XPXPPPXXPPP 897 PP RP PPP P P PP PP P PPP PPP Sbjct: 57 PPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPP 97 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP--XXPPXXPPXPP--XPXPPPXXPPP 897 PP P PPP P P PP PP P PPP PPP Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPP 84 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 PP P P PPP P PP PP P PPP PP P Sbjct: 67 PP--PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTP 105 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P PPP P PP PP P PP Sbjct: 78 PPIYPPPIYSPPPPPIYPPPIYSPPPTPISPP 109 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPP 897 PP I P P PPP P PP PP P P P PPP Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPPP 902 P +PPP P P PPPP PP PPP Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 8/43 (18%) Frame = +1 Query: 802 RPXXXPPPXPXXPP-XXPPXPP-------XPXPPPXXPPPXXP 906 +P PPP P P PP PP P PPP PP P Sbjct: 37 QPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPP 79 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP---XPPSXXPPPP 902 P PPP P PPPP PP PPPP Sbjct: 50 PVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-PPXPPSXXPPPP 902 P PPP PP P PP PP+ PPP Sbjct: 71 PIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISPPP 110 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PP PP P PP PPP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP PP PP P PP PPP P Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P P PPP PP P PP PPP PPP P Sbjct: 44 TPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T P P P PPP PP PP PPP PPP P Sbjct: 38 TPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP PP PP PP PPP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPP 897 P P P PPP PP PP PPP PPP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + P P PPP PP PP P PP PPP Sbjct: 55 TTSPPPVTTAPPPANPPPPVSSPPPASPP--PATPPPVASPPP 95 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRP-XXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP P P P PP Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P P P P P P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 778 TXXPPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T P P P PPP PP P P PPP PPP P Sbjct: 24 TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 T P P PP P PP PP PPP PPP Sbjct: 19 TGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PPP P PP P PP P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP PP PP PP PP P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P PP PP P PP PPP PPP Sbjct: 71 PPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 41.9 bits (94), Expect = 6e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP PP PP P PP PPP P Sbjct: 63 TAPPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATP 105 Score = 41.5 bits (93), Expect = 7e-04 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +1 Query: 778 TXXPPXIPRPXXX-PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P P PPP PP P PP PPP PPP P Sbjct: 44 TPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATP 87 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T P P P PPP PP PP PPP PPP P Sbjct: 38 TPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP PP PP PP PPP Sbjct: 77 PPPASPPPATPPPVASPPPPVASPPPATPPPVATPPP 113 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPP 897 P P P PPP PP PP PPP PPP Sbjct: 36 PTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPP 72 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + P P PPP PP PP P PP PPP Sbjct: 55 TTSPPPVTTAPPPANPPPPVSSPPPASPP--PATPPPVASPPP 95 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRP-XXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP P P P PP Sbjct: 83 PPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPP 120 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P P P P P P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSP 137 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +1 Query: 778 TXXPPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T P P P PPP PP P P PPP PPP P Sbjct: 24 TSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANP 70 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 T P P PP P PP PP PPP PPP Sbjct: 19 TGQAPTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPP 60 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PPP P PP P PP P P Sbjct: 87 PPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAP 126 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP PP PP PP PP P Sbjct: 51 PPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASP 93 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 41.9 bits (94), Expect = 6e-04 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP P P PP PP PPP PP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PPP P P PP P PPP PP Sbjct: 537 PPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP P PP PPP Sbjct: 518 PP--PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPP 552 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PP PPPP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PP P P PPP PP P PP P PP PPP P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 36.7 bits (81), Expect = 0.021 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPPP P PPP Sbjct: 571 PVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPP 608 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 P P P PP P P PP P P PPP PP P Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXP--XPPPXXPPP 897 P P P PPP PP PP PP P PPP PP Sbjct: 596 PPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP P P PPP P PP P PP P PP PPP Sbjct: 550 PP--PPPVYSPPPPP--PPVHSPPPPVFSPPPPVYSPPP 584 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXP---PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P PP P PPP PP Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPP 583 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPX--PXPPPXXPPP 897 PP + P PPP PP P PP P PP PPP Sbjct: 552 PPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 34.7 bits (76), Expect = 0.085 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 PP + P P PPP PP PP P PPP PPP P Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPP--PPAPVHSPPPPVHSPPPPPP 617 Score = 34.3 bits (75), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 819 PPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP P PPPP PP PPPP Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPP 546 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXI---PRPXXXPPPX--PXXPPXXPPXPPXP---XPPPXXPPPXXP 906 PP + P P PPP PP P PP P PPP PP P Sbjct: 569 PPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP PP PPP Sbjct: 585 PVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PP PP P P P PPP P Sbjct: 606 PPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP P PPPP Sbjct: 578 PVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPP 897 PP + P P PP P PP P PPP PP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPP 629 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PPPP Sbjct: 564 PVHSPPPPVFSPPPPVYSPPPPVHSPPPPV---HSPPPP 599 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPP---PXPPSXXPPPP 902 PPP PP P PPP P PP PPPP Sbjct: 551 PPPPVYSPPPPPPPVHSP---PPPVFSPPPPVYSPPPP 585 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP PP PP P Sbjct: 623 PPVFSPPPSQSPPVVYSP---PPRPPKINSPPVQSPPPAP 659 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P PPP P P Sbjct: 612 PPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSP 650 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PPP Sbjct: 522 PVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPP 560 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX---PPSXXPPPP 902 P Y PP PP P PPPP PP PPP Sbjct: 553 PPVYSPPP---PPPPVHSPPPPVFSPPPPVYSPPPPVHSPPP 591 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX---PPSXXPPPP 902 P Y PP PP P PPPP PP PPPP Sbjct: 528 PPVYSPPP---PPPPVHSPPPPVHSPPPPPVYSPP--PPPPP 564 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP---XPPSXXPP 896 P PPP PP P PPPP PPS PP Sbjct: 601 PVHSPPPPVHSPP-----PPPPVYSPPPPVFSPPPSQSPP 635 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G G GG GG G GGG G G G Sbjct: 75 GGSGGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGG 113 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG GG GG GG G GGG G G GG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKG-GCGGG 40 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G G GG G G GGG G G GG Sbjct: 8 GSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG GGG G G GG GG G GG G GG V Sbjct: 102 GGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGGYMV 141 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GGG GG GG GG G GG G G Sbjct: 103 GGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G GG G GG G G GGG GG G G+ G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGG 49 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GGG G GG GG GG GGG G G GG V Sbjct: 13 GKGGGGGGSGGGRGGGGGGGAKGGC--GGGGKSGGGGGGGGYMV 54 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG GGG G + G Sbjct: 18 GGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPG 57 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G GGG G GG Sbjct: 83 GGGGGGGISGG-GAGGKSGCGGGKSGGGGGGGKNGGGCGG 121 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = -2 Query: 905 GXXGGGXXGGGXGX-----GGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G GG GGG G G GG Sbjct: 84 GGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGG 128 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGX---GGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG G G G GG GG GG G GGG G+ G Sbjct: 92 GGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGG 133 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG + G G G G G GG GG G G+ G Sbjct: 93 GGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGG 136 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 PP P P P P PP P P P P PP PPP P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 140 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 PP P P P P PP P P P P PP PPP P Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 158 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 PP P PPP P P PP PP P P P P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 114 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PPP PPP P Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P PP P PP P P P PP P P P Sbjct: 167 PPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 PP P P P P P P P PP P PPP P P P Sbjct: 154 PPPTPTPSV-PSPTPPVPTDPMPSPPPPVSPPPPTPTPSVP 193 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 P P PPP P P PP P P P PPP P Sbjct: 147 PTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP 183 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP P P P PP PPP Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPP 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P P P P P P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P P P P P PP P P P P P Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSP 195 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP P P P P P Sbjct: 131 PPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 PP P P P P P PP P P PP PPP P Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTP 122 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P P PP PPP P P P Sbjct: 93 PTPPVSPPPPTPTPSVPSPTPPV-SPPPPTPTPSVP 127 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P P PP PPP P P P Sbjct: 111 PTPPVSPPPPTPTPSVPSPTPPV-SPPPPTPTPSVP 145 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P P PP PPP P P P Sbjct: 129 PTPPVSPPPPTPTPSVPSPTPPV-SPPPPTPTPSVP 163 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP---XXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PPP P P P PP P P P P P P Sbjct: 87 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP---XXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PPP P P P PP P P P P P P Sbjct: 105 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 150 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP---XXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PPP P P P PP P P P P P P Sbjct: 123 TPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 168 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP----XXPP---XXPPXPPXPXPPPXXPPPXXP 906 T P P P PPP P PP PP P P PP P P P Sbjct: 171 TDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 220 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P P P PP P P PP P P P Sbjct: 195 PPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTP 235 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P P PP P P P P P P P P P Sbjct: 166 TPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVP 208 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P P P P P P Sbjct: 184 PPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVP 223 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPP 897 P P P PP P PP P P PP PPP Sbjct: 215 PTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ P PP P PP P P PPPP Sbjct: 142 PSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP--PXPXX--PPXXPPXPPXP--XPPPXXPPPXXP 906 T P +P P P P P PP P PP P P P PP P Sbjct: 201 TPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVP 249 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP P P P P PP PPP Sbjct: 149 PPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPP 894 P P P PP P P P PP P P PP Sbjct: 200 PTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP PP PPPP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPP 894 P P PPP P PP P PP P PPP PP Sbjct: 573 PPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 IP P PPP PP PP P P PPP P Sbjct: 587 IPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPP 623 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P P PPP P P P P PPP PPP P Sbjct: 563 TLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP + +P PPP P PP PP P P PP PPP Sbjct: 588 PPPLAQP---PPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 11/48 (22%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-----------PXPPPXXPPP 897 PP P P P P PP PP PP P PPP PPP Sbjct: 601 PPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 9/46 (19%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-----PPXXPPXPPXP----XPPPXXPPP 897 PP P P PPP PP PP PP PPP PPP Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP P PPPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP------XPPXPXPPPXXPPPXXP 906 PP P+ P P PP PP PP P PPP P P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPP 729 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 IP P PPP P P PP PPP P Sbjct: 612 IPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX----PPXPXPPPXXPPP 897 P IP PPP P P PP PPP PPP Sbjct: 648 PTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 R PPP P PP P PPP PP Sbjct: 635 RQAQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP R PPP P P PP P PPP Sbjct: 705 PPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P PPP Sbjct: 717 PPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P PPP PP PPPP PPS Sbjct: 595 PPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPS 627 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS----XXPPPP 902 P PPP PP P PPP PPS PPPP Sbjct: 676 PPSTPPPPPP-PPPKANISNAPKPPAPPPLPPSSTRLGAPPPP 717 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P+P PP P P PP P P P P P Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 10/47 (21%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP----------PXPXPPPXXPPP 897 PP P P P PP PP P P PPP PPP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPP 687 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +1 Query: 790 PXIPRPXXXPPPXP--XXPPXXPPXP----PXPXPPPXXPPPXXP 906 P P P PP PP PP P P P PPP P P Sbjct: 696 PKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPP 740 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PPP PPP Sbjct: 639 PPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PPP P P P PPP PP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +P PPP P P P PPP PP Sbjct: 503 QPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP----PXXPPP 897 PP P P P PP P P PP P PPP Sbjct: 702 PPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPP 742 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 817 PPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PPP P PP P PPP PPP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPP 512 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 P+ PPP P P PPPP PP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +1 Query: 817 PPPXPXXPPXX---PPXPPXPXPPPXXPPP 897 PPP P PP P PPP PPP Sbjct: 504 PPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P P PP PPPP Sbjct: 590 PLAQPPPPRPPPPPPPPPSSRSI--PSPSAPPPPPPPPP 626 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP PPPP PP PPPP Sbjct: 618 PPPPPPPPPSFGSTGNKRQAQPPPP-PP---PPPP 648 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PP PP P PPPP + PPPP Sbjct: 695 APKPPAPPPLPP-SSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 16/56 (28%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPX--------PXXPPXXPPXPPX--------PXPPPXXPPP 897 T PP P P PPP P PP PP PP P PP PPP Sbjct: 479 TLLPPPPPPP---PPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P PP P PPP P P Sbjct: 549 PPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIP 588 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P PPP P P PP P PPP Sbjct: 639 PPPPPPPPP-PTRIPAAKCAPPPPPPPP 665 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP------PPXXPPPXXP 906 PP P P P P PP PP PP PPP P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPP 685 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PPP P PP P P P PP Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPP 881 PPP PP PPPP PP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 11/50 (22%) Frame = +3 Query: 786 PAXYPPPXXXXP----PXXXXXXXXPXXXPPPPXPPS-------XXPPPP 902 P PPP P P P PPPP PPS PPPP Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPP 621 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 14/50 (28%) Frame = +1 Query: 790 PXIPRPXXXPPPX---------PXXPPXXPPXPPXPXP-----PPXXPPP 897 P P P PPP PP PP PP P PP PPP Sbjct: 615 PSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + + PPP P PP P PPP Sbjct: 719 PPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX----PPXPXPPPXXPPP 897 PP P P P P P PP PP PP P PPP PPP Sbjct: 52 PPSPPPPSCTPSPPPPSPP--PPKKSSCPPSPLPPPPPPPP 90 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 P P PPP P PP PP P PP PPP P Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPP 88 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPP---PXPPSXXPPPP 902 PPP PP P PPP PPS PPPP Sbjct: 49 PPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 IP PPP P PP P P P PPP PPP Sbjct: 42 IPCLQNQPPPPPSPPP--PSCTPSP-PPPSPPPP 72 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PP PP PP P PP PPPP Sbjct: 53 PSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 9/39 (23%) Frame = +1 Query: 817 PPPXPXXPPXXP-PXPPXPXPP--------PXXPPPXXP 906 PPP P P P P PP P PP P PPP P Sbjct: 51 PPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 PPP PP P PPPP PP+ Sbjct: 64 PPPPSPPPPKKSSCPPSPLPPPPPPPPPN 92 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 PPP PP P PP PP P PPPP Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPP 89 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG G G GGG G G GG Sbjct: 40 GEWGGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGG 79 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G GG GG G GG G G GG Sbjct: 35 GGAGGGEWGGAEGGGAWGG-GGGGGGAWGGEGEGGGEWGG 73 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGG--XGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GGG GG G G Sbjct: 44 GAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRG 84 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAGXXXXR 770 GGG GG GGGG G GG GGG G R Sbjct: 47 GGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGGGGRRGWFMMR 89 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG G GGG G G GG Sbjct: 64 GGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGG 100 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G G GG GG GGG G G G Sbjct: 78 GGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHGGGGHG 116 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG G G G G GGG G GG Sbjct: 49 GHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGG 90 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG GG G G GGG GG G G Sbjct: 73 GLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHYGGGGHHG 111 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXGXG--GXGXXXGXXXXXGGGXXGGAGDXG 790 G G G GG G G G G G GGG GG G G Sbjct: 59 GGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHG 99 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GGG G Sbjct: 57 GGGGHGHGGHNGGGGH-GLDGYGGGHGGHYGGGGGHYGG 94 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G GG GG G G Sbjct: 58 GGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYG 93 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G G G G G GG GGG G G Sbjct: 65 GHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGG 101 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP PR PPP P PP PP P PPP PPP P Sbjct: 526 PPPPPRAAVAPPP-PPPPPGTAAAPPPPPPPPGTQAAPPPPPP 567 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/43 (44%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP +P PPP P PP PP P PPP PPP P Sbjct: 513 PPPLPTTIAAPPP-PPPPPRAAVAPPPPPPPPGTAAAPPPPPP 554 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 P PPP P PP PP P PPP PPP Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 P I P PPP P PP PP P PPP PPP Sbjct: 517 PTTIAAPP-PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P PPP P PP PP P PPP Sbjct: 539 PPPPPGTAAAPPP-PPPPPGTQAAPPPPPPPP 569 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P PP PP P PP P Sbjct: 542 PPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 PPP P PP P P PPP PP P Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPLPPAVMP 486 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P PPP P PP P PPP PP P Sbjct: 464 PAVMPLKHFAPPPPPPLPPAVMPLKHF-APPPPTPPAFKP 502 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P PP P PPP PPP Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPP--PPP 464 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 PP P P P PP PP PP P PPP P Sbjct: 457 PPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTP 497 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 P P P P PP PP PP P PPP PPP Sbjct: 492 PPPPTPPAFKPLKGSAPPP-PPPPPLPTTIAAPPPPPPPP 530 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 + PP P P PPPP P + PPP Sbjct: 490 FAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPP 525 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP--SXXPPPP 902 P PP PP PPPP PP PPPP Sbjct: 525 PPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPXP------PPXXPPP 897 PP + PPP P PP PP P P PP PPP Sbjct: 567 PPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXX-----PPPXXP 906 P +P PPP P P PP P PPP PPP P Sbjct: 482 PAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPP 528 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 +P P PP PP PP P PP P Sbjct: 437 LPSPPPTPPIADIAISMPPPPPPPPPPPAVMP 468 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 13/49 (26%) Frame = +1 Query: 799 PRPXXXPPPXPXX-------P-PXXPPXPP-----XPXPPPXXPPPXXP 906 P P PPP P P P PP PP PPP PPP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + PP P P P P PPP P P Sbjct: 481 PPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLP 517 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP---SXXPPPP 902 PA P PP PPPP PP + PPPP Sbjct: 498 PAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP 539 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP PP P PPP + PPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPP 541 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 9/49 (18%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPX-------PPPXXPPPXXP 906 PP P PPP P P P PP P PPP PPP P Sbjct: 552 PPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPP--PPPPMP 598 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 P PPP P PP PP P PPP P Sbjct: 590 PPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPP 626 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPP------SXXPPPP 902 PPP PP PPP PP S PPPP Sbjct: 418 PPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPP 458 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 PPP PP P PPPP P PPPP Sbjct: 508 PPPPP--PPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP P P P PPP P Sbjct: 148 PPESPPPESLPPPSPESP--SPPSPEPPPPSSLEPPPPPP 185 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 817 PPPXPXXPP--XXPPXPPXPXPPPXXPPP 897 PPP PP PP P P PP PPP Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPP 174 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP PPPP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 A PPP PP P P P PPS PPPP Sbjct: 143 AGQPPPPESPPP-----ESLPPPSPESPSPPSPEPPPP 175 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G GG GG G GGG G G GG Sbjct: 779 GGHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/35 (51%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXG 804 G GGG GGG GG GG G G G GGG G Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGGCGGGGDGG 814 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G GG GG G G GGG Sbjct: 786 GCGGGHHGGGGGGCGGCGGGGCGGGGDGGG 815 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 15/54 (27%) Frame = +1 Query: 790 PXIPRPXXXPPPXP-------XXPPXXPPXPPXP--------XPPPXXPPPXXP 906 P +PRP PPP P PP PP PP P PPP PPP P Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PP P PP PP P PPP P P Sbjct: 704 TKVPPP-PPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PP P P PP P PPP P P P Sbjct: 706 VPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTP 742 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP----PXPXPPPXXPPPXXP 906 PP PP P P PP P P PPP PPP P Sbjct: 696 PPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 32.3 bits (70), Expect = 0.45 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP PPP Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPP 779 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA PP PP PPPP PP+ PP P Sbjct: 684 PALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPA--PPTP 720 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP +P PPP PP P PP PP Sbjct: 760 PPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPPPXXP 906 PP P P P PP P PP P PPP P Sbjct: 754 PPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSAPPPPPP 795 Score = 29.1 bits (62), Expect = 4.2 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 17/57 (29%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXP-----------PXXPPXPP------XPXPPPXXPPP 897 T PP P P PPP P P P PP PP PPP PPP Sbjct: 724 TSSPP--PPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPP 778 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--------XPPPXXPPPXXP 906 P P P P P PP PP P PPP P P P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G G G G G GG Sbjct: 122 GGGHGGGGGGGGGRGG--GGGSGNGEGYGEGGGYGGG 156 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G GG GG GG G GGG G G Sbjct: 109 GRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G G G G G GG GG G GGG G G G Sbjct: 104 GSGSGGRSGSGRGRGSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GG G G GG GG G GGG G G G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEG 150 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG GG G G G GGG G G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGG 805 G GGG RGG G G G G GGG GG Sbjct: 127 GGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG G G G G G G GG Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGGG G GGG Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G G G G G G GG Sbjct: 96 GSYAGSHAGSGSGGRSGSGRGRGSGGGGGHGGGGG 130 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG G G GG G Sbjct: 121 GGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYGG 159 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 18/33 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG GG G GG G G Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG GG G GGG G G Sbjct: 123 GGGGYSGGGGGYG-GGGGGYGGGGGGYGGGGDGGGG 157 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 881 GGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G GGG G G GG Sbjct: 124 GGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGG 156 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P PP PP P PPP PP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 591 PVHSPPPPVHSPPPPVHSPPPPVYSPPPP-PPVHSPPPP 628 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP P P PP P PPP PP P Sbjct: 495 PPPVHSP---PPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P PP P PP PPP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPP 554 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP PP PP P PPP PP Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPP 546 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +3 Query: 723 PXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPSXX 890 P + S P V P PPP PP P PPP P PP Sbjct: 520 PPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 579 Query: 891 PPPP 902 PPPP Sbjct: 580 PPPP 583 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PP PP P PP PPP P P Sbjct: 530 PPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXP---PXPPX--PXPPPXXPPPXXP 906 PP + P P PPP P P P P PP P PP PPP P Sbjct: 574 PPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP P PPPP Sbjct: 628 PVFSPPPPVHSPPPPVYSPPPPVYSPPPP-PVKSPPPPP 665 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P PP P PP PPP Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPP 634 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP + P PP PP P PP P PP PPP Sbjct: 610 PPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPP 648 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P PPP PP P PP PP PP PPPP Sbjct: 555 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPP 598 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 P P P PPP PP PP P PPP PP P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P PPP PP P PP PP PP PPPP Sbjct: 621 PVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P PP P PPP PP Sbjct: 527 PPPPPPVYSPPPPP--PVHSPPPPVHSPPPPVHSPP 560 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP P P PP P PPP PP P Sbjct: 633 PPPVHSPPPPVYSPPPPVYSPPPPPV-KSPPPPPVYSPPLLP 673 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PP P PP P PP PPP P P Sbjct: 521 PPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPP 562 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P PPP PP P Sbjct: 546 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPX---PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP P PP P PP PPP P P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP P P PP P PPP P P Sbjct: 512 PPPVYSP---PPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP PP PPP P P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPP 605 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXI---PRPXXXPPPX--PXXPPXXPPXPP--XPXPPPXXPPPXXP 906 PP + P P PPP PP P PP P PPP PP P Sbjct: 619 PPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP P PPPP Sbjct: 506 PIHSPPP----PPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP PP PP P P PPP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPX---PXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P PP P PPP PP Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 574 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PP PPP P P Sbjct: 537 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP + P P PP P PP P PP P PP PPP Sbjct: 603 PPPVHSPPPPVYSPPPP--PPVHSPPPPVFSPPPPVHSPPP 641 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P P P PPP PP P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPP 522 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXX--XPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PP PPPP Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPP 530 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP PP P P PP PPP P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPP 523 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP P PP PP P PP P PP PPP Sbjct: 617 PPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPP 655 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P P PP P Sbjct: 553 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP S PPPP Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVY-SPPPPPP 621 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXX---PPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP P PP P PP PPP P P Sbjct: 539 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXP---PXPXPPPXXPPP 897 PP + P PPP P P PP P P P PP PPP Sbjct: 589 PPPVHSP---PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPP 627 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP + P P PPP P P PP PP P PP P Sbjct: 640 PPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSPPTQTP 684 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP PP PPPP Sbjct: 605 PVHSPPPPVYSPPPPPPVHSPPPPVFSPP-PPVHSPPPP 642 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 569 PVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHS--PPPP 605 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 576 PVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHS--PPPP 612 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP--PP 902 P PPP PP P PPP PP PP PP Sbjct: 635 PVHSPPPPVYSPPPPVYSPPPPPVKSPPP-PPVYSPPLLPP 674 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PP P PPP Sbjct: 598 PVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P PP P P P P Sbjct: 447 PPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSP 486 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P P PP PP P P Sbjct: 653 PP--PPPVKSPPPPPVYSP--PLLPPKMSSPPTQTPVNSP 688 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP---PPXXP 906 P P+P P PP PP PPP P PP P Sbjct: 472 PKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPP 514 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G G G GGG G G Sbjct: 105 GGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAG 140 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG G G G GG GG GG G GGG G+ Sbjct: 115 GGGGGGDTGAGAGGGGYGG--GGDTGAGGGVGSGQ 147 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/37 (54%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG GG G GGG G G GG Sbjct: 96 GGGDVGGG-GGGYGGGTPGG--GGGGGGDTGAGAGGG 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 G GGG GG G GG GG G GGG G G V Sbjct: 101 GGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGV 143 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G G GG GG G G G G G GG Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGGDTGAGAG---GGGYGGG 134 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G GG G GG G G+ G Sbjct: 106 GYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 T PP P PP P PP PP P P PP P PP P Sbjct: 130 TEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVP 174 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXP---PXPPXPXPPPXXPPPXXP 906 P P P PPP P PP P P PP PPP PP P Sbjct: 114 PVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLP 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP P PPP PP P Sbjct: 94 PPPEPSP---PPPLPTEAP--PPANPVSSPPPESSPPPPP 128 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P P P P PPP Sbjct: 85 PPPTTIPVS-PPPEPSPPPPLPTEAPPPANPVSSPPP 120 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 P P P PP P P P PP P PP P P P Sbjct: 124 PPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPP 163 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPPXXP 906 P P P PP P PP P P P P PPP P Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANP 114 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPX-PXPPPXX------PPPXXP 906 P P P PPP P PP P P PP P PPP PP P Sbjct: 137 PITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLP 184 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 PP P P P P P P P P PP PPP P Sbjct: 63 PPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLP 105 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P P PP P Sbjct: 127 PPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNP 166 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPP 897 T PP P P P P P PP PP PP P P Sbjct: 145 TNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSP 186 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P+ PP PP P PPP PP+ PP Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPP 134 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 P P P P P P PP P PPP PP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-----PPXXPPP 897 T PP P PPP PP P P P PP PPP Sbjct: 106 TEAPPPA-NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPP 149 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPPXXP 906 P P PPP P P PP P PP P P P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P PP P PP P P P P Sbjct: 101 PPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSP 141 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIP-RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P R PPP P PP P P PP P Sbjct: 221 PPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPP 261 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPP--XXPPXPPXPXPPPXXPPP 897 PP RP PP P P PP PP PP P P Sbjct: 233 PPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSP 272 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P+ P PP P PPPP P PP Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP-XPPSXXPP 896 P PPP PP PPP PPS PP Sbjct: 143 PPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPP 180 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P RP PP P PP P P P P PP Sbjct: 246 PSDSKRPVHPSPPSPPEETLPPPKPSPDPLPSNSSSPP 283 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPP 897 PP P P P PP P PP P PP P P Sbjct: 162 PPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSP 201 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP----XXPPXPPXPXPPPXXPPPXXP 906 PP I P PPP PP P PP P PPP PP P Sbjct: 115 PPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTP 158 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX--PPXXPPXP-PXPXPPPXXPPPXXP 906 PP P P PP P PP PP P P P PP PP P Sbjct: 120 PPLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP---PXPXXPPXXPPXPPX---PXPPPXXPPPXXP 906 T PP P PP P P PP P PP P PPP PP P Sbjct: 76 TSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P P P PP P PP PP PPP Sbjct: 90 PKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP 126 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P PPP PP PP P P P PP PP P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP P PPP PP P Sbjct: 256 PSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSP 291 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP---PXPXXPPXXPPXPPXPXPPPXXPP 894 T PP P PP P P PP P PP PP PP Sbjct: 130 TPPPPLATTPPALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP I P P PP PP P PP PP PP P Sbjct: 107 PPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLP 148 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + PP P PP PP P PPP PP P Sbjct: 132 PPPLATTPPALPPKPLPPPLSPP-QTTPPPPPAITPPLSP 170 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPP 897 PP P PPP PP P PP PPP PP Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPP 132 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPP-XXPPPXXP 906 PP P P PPP P PP PP P PPP PP P Sbjct: 104 PP--PPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALP 143 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = +3 Query: 723 PXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P ++ P L PA PPP P P PPP PP PPPP Sbjct: 106 PPPAITPPPPPAITPPLSPPPPAITPPPPLATTP----PALPPKPLPPPLSPPQTTPPPP 161 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-PPXPPSXXPPPP 902 P PP PP P PP P PP+ PPPP Sbjct: 95 PPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP P PP PP PPP Sbjct: 45 PPPQPDPQPPTPPTFQPAPPANDQPP--PPP 73 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 P P P P PP PP P PP PP P Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPP 73 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P PP P P P P PP PP Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPP 79 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 T PP +P PPP PP P P PP Sbjct: 259 TISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P PPP PP PP PP PPP P Sbjct: 63 PPANDQPP--PPPQSTSPPPVATTPPA-LPPKPLPPPLSP 99 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX------PPXPXPPPXXPPP 897 PP + P PPP P P PP PP P P PPP Sbjct: 94 PPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITP--PPP 134 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PP PP PPP Sbjct: 42 PGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPP 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 IP+ P P P PP PP P PPP PP P Sbjct: 247 IPQGFSCPGPSPTISPPPLPPQTLKP-PPPQTTPPPPP 283 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PP PP P PP PP PPP Sbjct: 63 PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPP 96 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P+ PP P PP P PP PP PPP Sbjct: 69 PPPPPQSTSPPPVATTPPALPPK--PLPPPLSPPQTTPPP 106 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP PP PP P Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLP 94 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 PPP PP P PP P PP PP Sbjct: 71 PPPQSTSPPPVATT---PPALPPKPLPPPLSPP 100 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX-PPSXXPPPP 902 P PPP PP PPPP P PPPP Sbjct: 90 PKPLPPPLS--PPQTTPPPPPAITPPPPPAITPPLSPPPP 127 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GG GGG G GG GG GG G GGG G G G Sbjct: 581 GSGRGGYGGGGGGYGG-GGGYGGGGGYGGGGGYGGGYGG 618 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G GG GG GG G G G Sbjct: 593 GYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG GG G GG Sbjct: 590 GGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GGG GGA G Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGGY-GGASSGG 623 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGGXXR--GGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG R G G G G G GGG GG G G Sbjct: 567 GRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGYGGGGGYG 607 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PP + P PPP P P PP PP P PP PPP P Sbjct: 576 PPPVASP---PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P P P P P PPP Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPP 620 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PPP P P PP P PPP PP Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPP 560 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP P PPPP Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP 621 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP------PSXXPPPP 902 P PPP PP P PPPP P PS PPPP Sbjct: 584 PPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPP 628 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPP 897 P P PPP PP PP P P PPP PP Sbjct: 567 PPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPP 603 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXX----PPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P PP P PP P PP PPP Sbjct: 553 PPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPP 596 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP PP PP P PPP P P Sbjct: 561 PPVYSSP---PPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP P PP PPP P Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSP 587 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPP--XXXXPPXXXXXXXXPXXXPPPPXPPS--XXPPPP 902 P PPP PP P PPPP PP PPPP Sbjct: 555 PVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P PP PP P P PP P Sbjct: 568 PPPHVYSPPPPVASPP-PPSPPPPVHSPPPPPVFSP 602 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P PPP PP Sbjct: 597 PPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPP 633 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P PPP PP Sbjct: 604 PPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPP 640 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P+P P P P P PP P PPP P P Sbjct: 531 TRVPP--PQPPM-PSPSPPSPIYSPPPPVHSPPPPVYSSPPPP 570 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP PP PPPP Sbjct: 598 PVFSPPPPVFSPPPPSPVYSPPPPSHSPP-PPVYSPPPP 635 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPX---XPPXXPPXPP--XPXPPPXXPPP 897 PP + P PPP P PP P PP P PP PPP Sbjct: 603 PPPVFSP---PPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPP 641 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXP---XPPPXXPPP 897 PP + P PPP PP P PP P PPP PP Sbjct: 588 PPPVHSPP--PPPVFSPPPPVFSPPPPSPVYSPPPPSHSPP 626 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PP P + PPP Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPP 585 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG GG GG GG GGG G G G Sbjct: 165 GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGG 203 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G G GG GG G GGG G G G Sbjct: 150 GGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGG 184 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG---XGGGXXXGRGIXGGXXV 777 G GG G G G G GG GG G GGG G GI GG + Sbjct: 133 GFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVII 178 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GG G GG GG GG GGG G GG Sbjct: 153 GGGGPGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGG 192 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG G GG G G GG Sbjct: 162 GGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G G GG G GGG G I GG Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGG 181 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/39 (46%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGI 795 G G G GGG G GG GG GG G G G G G+ Sbjct: 108 GGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGL 146 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG G G G GGG G G GG Sbjct: 105 GGYGGGGPGYGGGG---YGPGGGGGGVVIGGGFGGG 137 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -2 Query: 893 GGXXGGGXGXGGXG--GXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G G G GG G G G G G GG Sbjct: 131 GGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGG 168 Score = 32.3 bits (70), Expect = 0.45 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G GG G G GGG G G GG Sbjct: 123 GGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGG-GPGYGSGGG 164 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGX--GGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G GG GG GG G G G G G GG Sbjct: 115 GGGGYGPGGGGGGVVIGGGFGGGAGYGSG--GGLGWDGG 151 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG-XXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG G GGG G GG Sbjct: 115 GGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGG 155 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG GG G G GG GG G Sbjct: 122 GGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYG 160 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GG GG G Sbjct: 170 GGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKG 208 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPP 894 P +P PPP P PP PP PP P P P PP Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP PP P P PP PP P Sbjct: 265 PP--PPPAAAPPPQP--PPPPPPKPQPPPPPKIARPPPAP 300 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P PP P PPP P P Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 5/40 (12%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXX-PPXPPXPXPPP----XXPPPXXP 906 R PPP PP PP PP P PPP PPP P Sbjct: 262 RSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P P P PPP PP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQP 287 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PP PP P PPPP P PPP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPPP P PPPP Sbjct: 255 PLKLPPGRSAPPPPPAAAP--PPQPPPPPPPKPQPPPPP 291 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP PP PPP P P P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPP 288 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P P PP PP PPP Sbjct: 266 PPPPAAAPPPQPPPPPPPK--PQPPPPPKIARPPP 298 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPP----PPXPPSXXPPPP 902 P PP P PP PP PP PPPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP-PPPXPPSXXPP 896 PA PPP PP P PPP PP P Sbjct: 269 PAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPPKGAAP 306 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/58 (36%), Positives = 22/58 (37%), Gaps = 4/58 (6%) Frame = +1 Query: 736 YXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 Y P + T PP P P PP PP PP PP P PP PPP Sbjct: 63 YSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 120 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 4/67 (5%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPX 885 P Y P T PP P P PP PP PP PP P PP Sbjct: 461 PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPI 520 Query: 886 XPPPXXP 906 PPP P Sbjct: 521 KPPPVKP 527 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 94 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPP 137 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 111 TYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPP 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 128 TYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPP 171 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 162 TYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPP 204 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 314 TYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 498 TYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 4/64 (6%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPX 885 P Y P T PP P P PP PP PP PP P PP Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPI 570 Query: 886 XPPP 897 PPP Sbjct: 571 KPPP 574 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPPXXP 906 PP P P PP PP PP PP P PP PPP P Sbjct: 434 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKP 477 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 548 TYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 591 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 565 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 608 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 582 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 625 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 599 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 642 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 616 TYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPP 659 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 633 TYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPP 676 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 650 TYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPP 693 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 667 TYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPP 710 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 684 TYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPP 727 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 451 PPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 229 TYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPPVKPPP 272 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPP-PXXPPPXXP 906 T PP I P PPP P PP PP PP P PP P Sbjct: 56 TTPPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYP 101 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 215 PPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPP 255 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPPXXP 906 T PP P PP PP PP PP P PP PPP P Sbjct: 297 TYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKP 343 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 198 PPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPP 238 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 249 PPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKPPP 289 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 350 PPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 390 Score = 34.7 bits (76), Expect = 0.085 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP PP PP P PP PPP Sbjct: 367 PPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPP 407 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP PP P P P PP P Sbjct: 148 PPVKPPPVQMPPTPTYSPPIKPP-PVHKPPTPTYSPPIKP 186 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPP--XXPPXPPXP-XPPPXXPPP 897 T PP P P PP PP P PP P PP PPP Sbjct: 398 TYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PP PP PP P P PP Sbjct: 701 TYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSPP 740 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP PP P P PP P Sbjct: 384 PPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLP 423 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP PP P P PP P Sbjct: 266 PPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSP 305 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P P P PP PP PP P PP PPP Sbjct: 331 TYSPPIKPPPVKPPTPI-YSPPVKPPPVHKPPTPIYSPPVKPPP 373 Score = 32.3 bits (70), Expect = 0.45 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 T PP P P PP PP PP PP P PP PPP Sbjct: 179 TYSPPIKP-PVHKPPTPIYSPPIKPPPVHKPPTPIYSPPIKPPP 221 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 PP P P PP PP P PP P PP PPP Sbjct: 283 PPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPP 323 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP---XPPXP-XPPPXXPPP 897 P I P PP PP PP PP P PP PPP Sbjct: 418 PPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPP 457 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP + P P PP P PP PP P P PPP PP Sbjct: 321 PPPVQKPPTPTYSPPIKP--PPVKPPTPIYSPPVKPPPVHKPP 361 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP + P P PP P PP PP P P PPP PP Sbjct: 455 PPPVHKPPTPTYSPPIKP--PPVKPPTPTYSPPVQPPPVQKPP 495 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP I P P PP P P P P P PPP PP Sbjct: 555 PPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 596 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP PP PP PP PPP Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPPP 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP I P P PP P P P P P PPP PP Sbjct: 135 PPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPP 176 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +1 Query: 799 PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPP 894 P P PP P P P P P PPP PP Sbjct: 311 PTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPP 344 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 P I P PPP P P PP PP P P PP P Sbjct: 445 PTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQP 488 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 538 PPPVHKPPTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPP 579 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 572 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 613 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 589 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 606 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 647 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 623 PPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPP 664 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 640 PPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPP 681 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 674 PPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPP 715 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 209 PTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKP 253 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP P PP P PP P P PPP PP Sbjct: 339 PPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 378 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP P PP P PP P P PPP PP Sbjct: 423 PPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 462 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 657 PPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPP 698 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXI---PRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP P P P P P PPP PP Sbjct: 691 PPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKPPPVQVPP 732 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP I P PPP PP PP P PP PP P Sbjct: 45 PPPIYGAPPSYTTPPPPIYSPPIYPP--PIQKPPTYSPPIYPP 85 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPP--XPPXPXPP-PXXPPPXXP 906 P I P PPP P P PP PP PP P PP P Sbjct: 277 PTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP 321 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P P PP P P PP P P P P PP P Sbjct: 330 PTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 371 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P P PP P P PP P P P P PP P Sbjct: 414 PTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 455 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 192 PTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKP 236 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 243 PTPIYSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPPVKP 287 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKP 388 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 361 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP 405 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXP---XPPPXXPPPXXP 906 P I P PPP P P PP P P P P PP P Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKP 472 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPP--XPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I P PPP P P PP P P P P P Sbjct: 378 PTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPP 419 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.5 bits (88), Expect = 0.003 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXX-----PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P PPP P PP PP PP P PPP P Sbjct: 9 PPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 PP PPP PP PP P P PPP PPP Sbjct: 14 PPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPP 53 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 802 RPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPP 897 RP P P P PP PP PPP PPP Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PPP PPP P Sbjct: 47 PPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVP 86 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P P P PP P Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQP 42 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPPP 902 P PP P P PPPP P S PPPP Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPP 50 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 PP P P PP P PP P PPP P P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYP 46 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 789 AXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 A Y PP P P PP PP PPP Sbjct: 2 ASYRPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPP 38 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG GG G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG GG G G G G G G Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G G G G GGG Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG G G G G G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G G G G G G Sbjct: 97 GGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXV 777 GGG G G GG G G G G G G G G V Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDV 185 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G G G G G G G G Sbjct: 95 GGGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSG 130 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G G G G G G Sbjct: 194 GGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G GGG G G G G G G G G Sbjct: 147 GGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASG 182 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G G G G Sbjct: 145 GGGGSGEGSGGGGGGDGSSGSGSGSGSGSGSG 176 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = -1 Query: 879 GGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GG G GG G G G G G+G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +P P PPP PP PP P P PPP P Sbjct: 366 VPPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP PP P PP P PPP PPP Sbjct: 367 PPPRRSPPPLQTP-PPPPPPPPLAPPP 392 Score = 35.9 bits (79), Expect = 0.037 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P P PPP P PP PP PP P Sbjct: 369 PRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P PPP PP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP P PP P PP P PP P Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GGG GRG GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGG 55 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GGG G GG G GG G G G GRG GG Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGG 64 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG RG G GG G G G G G GD Sbjct: 51 GGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGD 87 Score = 32.7 bits (71), Expect = 0.34 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG----GGXXXGRGIXGG 786 G GGG GG G G GG G G G GG GRG GG Sbjct: 40 GASGGGSYGGRGGY-GGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 GGG G G GG G G GG GG G R Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNR 62 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 906 GXXGGGXXRGGX--GXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G GG G GG G G GGG GD G S G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G GG GG GGG GRG GG Sbjct: 19 GGDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGG 55 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGG--GXXXGRGIXGG 786 G GGG GGG G GG G GG G G G GRG GG Sbjct: 22 GYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRGG 64 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG RG G GG G G G G G GD Sbjct: 51 GGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGGRDGD 87 Score = 32.7 bits (71), Expect = 0.34 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG----GGXXXGRGIXGG 786 G GGG GG G G GG G G G GG GRG GG Sbjct: 40 GASGGGSYGGRGGY-GGGGGRGNRGGGGGGYQGGDRGGRGSGGG 82 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 GGG G G GG G G GG GG G R Sbjct: 26 GGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNR 62 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 383 GGGRGGGGGGYGGGGG 398 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -1 Query: 906 GXXGGGXXRGGX--GXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G G GG G GG G G GGG GD G S G Sbjct: 35 GYGGRGASGGGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP PP PPP PP P Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPP--PPTPAP 93 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 P +PPP PP P PPPP P P PPPP Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP PP PP P P P P P P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSP 70 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P PP P P P PPP Sbjct: 45 PPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 PP P PP P P PP P P P P PPP PP P Sbjct: 46 PPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PPP P PP PP PP PP PP P Sbjct: 21 PSPVPPPPSHISPPPPPFSPPHHPP-PPHFSPPHQPPPSPYP 61 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPP 897 PP P P PP P P P PP P P P PPP Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPP 79 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPX-PPXPXPPPXXPPPXXP 906 P P PPP P PP PP PPP PP P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQP 55 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P P PP P P P PPP Sbjct: 33 PPPPPFSPPHHPPPPHFSPPHQP-PPSPYPHPHPPPP 68 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPP 897 PP P PPP P PP P P PPP P P Sbjct: 35 PPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYP 72 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPP P PPPP Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P P PPP P PPPP Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 P P P P P PP PP P PP PPP Sbjct: 9 PYYSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPP 46 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +3 Query: 795 YPPPXXXXP-PXXXXXXXXPXXXPPPPXPPSXXPPPP 902 Y PP P P PPPP P PPPP Sbjct: 11 YSPPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPP 47 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX--PPSXXPPPP 902 PPP PP P PPPP PP PP P Sbjct: 26 PPPSHISPPPPPFS---PPHHPPPPHFSPPHQPPPSP 59 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P P PP P PP PP Sbjct: 120 PPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVPP 156 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPPPXXP 906 PP + P P P P PP P P PP P PP P Sbjct: 115 PPPLGPPQTPGPEFPVPPSPSPPMPDTPNPPTPKTPPDVVP 155 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P PP PP P Sbjct: 134 PSPPMPDTPNPPTPKTPPDVVPPIWEPPRPPDIFPPESPP 173 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPP 894 P P P PP P P P P PP PP PP Sbjct: 126 PEFPVPPSPSPPMPDTPNPPTPKTPPDVVPPIWEPP 161 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP + P PP P P P P PPP P Sbjct: 150 PPDVVPPIWEPPRPPDIFPPESPPPGIDPPPPLGP 184 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPR--PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P PP P PP P P P P P P Sbjct: 94 PNIPEISPSETPPEVTTVPSDPPPLGPPQTPGPEFPVPPSP 134 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPPXXP 906 T PP P PP PP P P PPP PPP P Sbjct: 141 TPNPPTPKTPPDVVPPI-WEPPRPPDIFPPESPPPGIDPPPPLGP 184 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G G G GG G GGG G G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGG 125 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 39.1 bits (87), Expect = 0.004 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPXPPPXXPPPXXP 906 PP P P P P PP PP PP P P PPP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP---PXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P PP PP P PPP P Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPP 426 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P PP PP P PPP P Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP--PSXXPPPP 902 P PPP PP P PPPP P PPPP Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+ PP P P PP P P PP P Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP P P Sbjct: 395 PPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKP 435 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPX-PPXPXPPPXXPPPXXP 906 PPP P PP PP P P PP PPP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPP 441 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP--XXPPXPPXPXPPPXXP---PPXXP 906 PP + P PP P PP PP PP PPP P PP P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PP PPPP Sbjct: 414 PPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP PP P PPP P PPPP Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PP P P P Sbjct: 436 PPPSP-PVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 823 PXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 P P PP PP P PPP PP P Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPPPSP 431 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 11/51 (21%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXPPXPPX---PXPPP-----XXPPPXXP 906 PP + P PP P P P PP PP PPP PPP P Sbjct: 421 PPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPPXXP 906 PP P P PPP P P P PP P PPP P P P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P PPP P PP P PPP PP Sbjct: 81 PSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P PP P P P PPP Sbjct: 61 PLPPPPQTPPPPPP--PQSLPPPSPSPEPEHYPPPP 94 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 6/49 (12%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXP------PXPXPPPXXPPPXXP 906 T PP P+ P P P P PP P P P PP PPP P Sbjct: 68 TPPPPPPPQSLPPPSPSP-EPEHYPPPPYHHYITPSPPPPRPLPPPPPP 115 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P PPP PP P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSP 83 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP------XXPPPXXP 906 PP P PPP PP P P PPP PPP P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP 108 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P PP P PP PP PP PPP P Sbjct: 52 PSPEPEDYLPLPPPPQTPP--PPPPPQSLPPPSPSP 85 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 Y P P P PPPP PP PPP Sbjct: 47 YNSPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPP 81 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P P PP PPPP Sbjct: 75 PQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPP---PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P PP PP PP P P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSP 85 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ P P PP P PP P PP PPPP Sbjct: 81 PSPSPEPEHYPPPPYHHYIT-PSPPPPRPLPP--PPPPP 116 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP PP P PPP Sbjct: 92 PPPSPPPPSPPPPSQACPP--PPLPPSPPKKSYCPPP 126 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP PP PP PP P PPP Sbjct: 93 PPSPPPPSPPPPSQACPPPPLPPSPPKKSYCP--PPP 127 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P P PPP P Sbjct: 81 PIKCTPCLQNIPPPSPPPPSPPPPSQACPPPPLP 114 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PP P S PPPP Sbjct: 92 PPPSPPPPSPPPPSQACP---PPPLPPSPPKKSYCPPPP 127 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP----XXPPXPPXPXPPPXXPPP 897 P + P PPP P PP PP P P P P PPP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXPP----XXPPXPPXPXPPPXXPPP 897 PP P P PPP P PP PP P P P P PPP Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P PP PP P P PPP P Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSP 118 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPR--PXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPP 897 T P P+ P P P PP PP P PPP PPP Sbjct: 78 TPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPP 120 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPPXXPPP 897 PP P+ P PP PP P P P P PPP Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPP-XPXPPPXXPPP 897 P P PPP P P PP P P P P PPP Sbjct: 104 PPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPP 141 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 P P PPP P PP P PP P P PP Sbjct: 129 PASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPP 166 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P PP P P Sbjct: 125 PPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP P P P P PPP Sbjct: 93 PATPPPQPPQSPPASAPTVSPP-PVSPPPAPTSPPP 127 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP P PP P P Sbjct: 136 PASPPPAPASPPPAPVSPPPVQAPSPISLPPAPAPAP 172 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPX-PPXPXPPPXXP--PPXXP 906 P PP P PP P P P PP P PP P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTP 129 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPPP 902 P PP PP P PP P PP+ PPP Sbjct: 115 PVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPP 155 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXP-PPXPXXPPXXPPXPP-XPXPPPXXPPPXXP 906 T P +P P P P P PP P P P PPP P Sbjct: 57 TTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPP 101 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP--XPPSXXPPPP 902 P PPP PP P PP P PP+ PPP Sbjct: 109 PTVSPPP-VSPPPAPTSPPPTPASPPPAPASPPPAPASPPP 148 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPP P S P P Sbjct: 114 PPVSPPPAPTSPPPTPASPP-PAPASPPPAPASPPPAP 150 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP P P PPP P S P P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTP 129 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 38.7 bits (86), Expect = 0.005 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP P P PP PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP PP PPP Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P PP PPP P Sbjct: 48 PIKCSPSCIQNPPPPSPPPPSPPPPACPPPPALP 81 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P I P PP P PP P PP PPP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPP 84 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 60 PPPSPPPPSPPPPACPPPPALP--PPPPKKVSSYCPPPP 96 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P PPP PP P PPP Sbjct: 66 PPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXX-GGXXGXGGGXXXGRGIXGG 786 GG G G G GG GG G G GGG G G+ GG Sbjct: 170 GGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHGVVGG 206 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXX-GGXXGXGGGXXXGRGIXG 789 GG GG G GG GG GG G GGG GI G Sbjct: 133 GGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGG 168 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG--GXXXGRGIXGGXXV 777 G G G GGG G G G GG G GG G G G GG V Sbjct: 149 GLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGV 193 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG G GG G GG G GG G G GG Sbjct: 120 GGVGGG-VGGLGGVGGGVGGLGGVGGLGGAGLGGVGGVGG 158 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 38.3 bits (85), Expect = 0.007 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +1 Query: 778 TXXPPXIPR-PXXXPPPXPXXPPXXPPXPPX-PXPPPXXPP 894 T PP P P P P PP PP PP P PPP PP Sbjct: 155 TDLPPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 5/35 (14%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPP-----XPXPPPXXPPPXXP 906 PPP P PP P PP P PP PPP P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXP---PPXXP 906 PP + P P PPP P PP P PP P PP P PP P Sbjct: 51 PPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMP 95 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 +P P P P PP PP P PP P PP P Sbjct: 49 VPPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPR-PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P P P P P P P P P Sbjct: 76 PPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMP 116 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP P PPP PPP P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPP-PPPQLP 37 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P RP PPP P P PP P PPP P Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +1 Query: 799 PRPXXXPPPX----PXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P PP PP PP P P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 PP PR PP P PP P P P P Sbjct: 13 PPPPPRLLVLPPLPPPPPPPPPQLPFGPKLP 43 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP + PPP P PP P P P P Sbjct: 16 PPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 38.3 bits (85), Expect = 0.007 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRGIXG 789 G GGG GG G G GG GG G G GG GRG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGG 128 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG G G GG GG G G G Sbjct: 101 GFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G GG G G GG GRG GG Sbjct: 94 GSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGD 796 G GGG RGG G GG G GG GG GD Sbjct: 100 GGFGGGGGRGG-GRGGGSYGGGYGGRGSGGRGGGGGD 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GG G GG G GG G GGG Sbjct: 154 GGGGYSGG-GGGGRYGSGGGGGGGGGG 179 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GG GG GGGG G GG G G G Sbjct: 93 GGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGG 131 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GG GG G G GGG G Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGGGGG 179 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG G G G GG GG Sbjct: 160 GGGGGGRYGSGGGGGGGGG 178 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G GGG G G GG GG G GGG G G Sbjct: 336 GGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGG 373 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG GG G G GGG G GG Sbjct: 363 GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGG 403 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG GG G G GGG G G Sbjct: 372 GGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGG 404 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXG-GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G G GG G G GGG G G GG Sbjct: 355 GGYGGGMGGAGGGGYRGGGGYDMG--GVGGGGAGGYGAGGG 393 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G GG G GG G GGG RG Sbjct: 255 GGYGGGRSGGYGGYGGEFGGYGGG-GYGGGVGPYRG 289 Score = 33.1 bits (72), Expect = 0.26 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG-GAGDXGR 787 G GGG GG G GG G G GGG G G G GR Sbjct: 378 GGVGGG-GAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGR 417 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G G GG GG GGG GRG GG Sbjct: 378 GGVGGGGAGGYGAGGGGNGGGSFYGGG--GGRGGYGG 412 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G G GGG G G G GG G GGG Sbjct: 384 GAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G G G G GG G GG G G Sbjct: 381 GGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSG 416 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGGG GG GGG G Sbjct: 371 GGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGG 409 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG--GAGDXGRXXSXXXG 766 G GGG RGG GG G G GG G G G G S G Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGG 348 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 G GG GG G GG G GG GGG Sbjct: 379 GVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = -1 Query: 906 GXXGGG-XXRGGXGXGG-XGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G GG G G GG GG G G Sbjct: 368 GYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRG 408 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GG G GG GG GG G GG G+G Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDGSDGKG 109 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GG G GG G GG G G Sbjct: 83 GSGGLGGSGGGGGGSGGGGGDGSDGKG 109 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GG G GG G GG G GGG G G+ G Sbjct: 79 GGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGG 113 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G GG G GG GG GG G GGG G Sbjct: 123 GIGGLGGAGGLGGIGG-VGGLGGIGGGSDCG 152 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G G G GG G G G G G GG Sbjct: 94 GLGGLGGLGGGSGLGHGVGGIGGDPGIGSG-IGGLGGAGG 132 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXG---GXXGXGG-GXXXGRGIXGG 786 GG G G G GG GG G G G GG G G G GG Sbjct: 102 GGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGGVGG 141 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 GG G GG GG G G GG G+ Sbjct: 47 GGAAGIGGAGGVGAGLGGVAGGVGGVAGV 75 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP PP P P PPP PPP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP P PP PPP P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPXPPPXXPPPXXP 906 PP P+ PPP P PP PP PP P PPP P Sbjct: 303 PP--PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPS 884 P PPP PP P PPPP P S Sbjct: 313 PPPPPPPLLQQPPPPPSVSKAPPPPPPPPPPKS 345 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P P P PP PP P PP P Sbjct: 16 PSTKKTKDMPSPLPLPPPPPPPLKPPSSGSATTKPPINP 54 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P P PPPP PP PPPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP PP PP P PPP PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPP--PPP 42 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 IP P PP PP P P PPP PPP Sbjct: 7 IPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPP 40 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP PR P P PP PP P PPP P Sbjct: 11 PPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P P PPP PPP P Sbjct: 10 PPPLPPRLELRRQRAPPPQPPPPPPPPPPP 39 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P PPP P P P PPP Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG GG GGG RG G Sbjct: 73 GGGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGG 111 Score = 32.7 bits (71), Expect = 0.34 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG---XXGGXXGXGGGXXXGRG 798 G GGG GGG GG G GG GGG RG Sbjct: 78 GRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRG 116 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG RGG G GG G G G G + G S G Sbjct: 74 GGGGGRGGGGFGGGGRSFGGGGSSSRGGGGSSSRGGGGSSSRGG 117 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP PP P PPP PP Sbjct: 77 PP--PPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPP 111 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P PPP PP P P PP PPP P Sbjct: 52 PSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSP 90 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPX--PPPXXPPP 897 PP + P PPP PP P P P PPP PPP Sbjct: 62 PPTVSSPP--PPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP P PP P PP PPP P Sbjct: 55 PPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Score = 34.7 bits (76), Expect = 0.085 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXP-XXPPXXPPXPP----XPXPPP 882 PT+ P L PP P P PPP P PP PP P PP Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPE 122 Query: 883 XXPPPXXP 906 PP P Sbjct: 123 VFEPPPPP 130 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PP PP P PPP P P Sbjct: 38 PPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPP 80 Score = 32.3 bits (70), Expect = 0.45 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P +PPP PP P PPP P PP Sbjct: 100 PIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPP 138 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/63 (25%), Positives = 21/63 (33%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P + + P + + PP + P P PP PP P PPP P Sbjct: 97 PPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPP--PEQLPPPASSPQ 154 Query: 898 XXP 906 P Sbjct: 155 GGP 157 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 PP P PP PP P PP PPP P P Sbjct: 31 PPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPP 71 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P PPPP S PPPP Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPP 81 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P PP P P P P Sbjct: 126 PPPPPADEDESPPAPPPPEQLPPPASSPQGGPKKPKKHHP 165 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P P P P PP Sbjct: 137 PPAPPPPEQLPPPASS-PQGGPKKPKKHHPGPATSPP 172 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 1/27 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPP-PXXPP 894 PPP PP PP P P P PP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPP 56 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PPP PPP P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSP 540 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPPXXP 906 P PPP P PP PP PP P PPP P P P Sbjct: 522 PSVRAYPPPPPLSPP--PPSPPPPYIYSSPPPPSPSPPPP 559 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 YPPP PP PPPP P PPPP Sbjct: 527 YPPPPPLSPPPPSPPPPYIYSSPPPPSP---SPPPP 559 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPP 897 PP P P PPP P PP P P PP PPP Sbjct: 531 PPLSPPPPSPPPPYIYSSP--PPPSPSPPPPYIYSSPPP 567 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPPP S PP Sbjct: 531 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP P PP P P P Sbjct: 487 PPPSSKMSPSVKAYPPPPPPPEYEPSPPPP 516 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/68 (29%), Positives = 22/68 (32%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 V + P YY P + PP P PPP P P PP P P Sbjct: 700 VTQSPPPPPVYYLP-VTQSPPPPSPVYYPPVAKSP---PPPSPVYYPPVTQSPPPPSTPV 755 Query: 883 XXPPPXXP 906 PP P Sbjct: 756 EYHPPASP 763 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP---XPPSXXPPPP 902 P YPP PP PPPP P + PPPP Sbjct: 637 PVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPP 678 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPP PP P P PP PPP Sbjct: 738 PVYYPPVTQSPPPPSTPVEYHPPASPNQSPPPEYQSPPP 776 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP PP PP PP PP P Sbjct: 618 PPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPP 651 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P YPP PP PPPP P PP Sbjct: 723 PVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPP 760 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP P P PP PP PPP Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP 538 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRP----XXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PPP P P PP P PPP P Sbjct: 615 TQSPPPPPPPTYYAVQSPPPPP--PVYYPPVTASPPPPPVYYTP 656 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP P P P PP Sbjct: 664 PPVYYSPVTQSPPPPP-PVYYPPVTQSPPPSPVYYPP 699 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 V + P YY P + PP P P P PP P P Sbjct: 657 VIQSPPPPPVYYSP-VTQSPPPPPPVYYPPVTQSPPPSPVYYPPVTQSPPPPPVYYLPVT 715 Query: 883 XXPPPXXP 906 PPP P Sbjct: 716 QSPPPPSP 723 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 3/60 (5%) Frame = +1 Query: 736 YXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPPXXP 906 Y P + PP P P PPP P P P PP P P PP P P P Sbjct: 604 YYPQVTPSPPPPSPLYYPPVTPSP---PPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPP 660 Score = 35.5 bits (78), Expect = 0.049 Identities = 22/71 (30%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-- 876 V P Y P + P P P PPP P P P PP P P Sbjct: 578 VTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSP---PPPSPLYYPPVTPSPPPPSPVY 634 Query: 877 -PPXXPPPXXP 906 PP P P P Sbjct: 635 YPPVTPSPPPP 645 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PP PP PP PP P P PPP Sbjct: 505 PPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 35.1 bits (77), Expect = 0.065 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 3/71 (4%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-- 876 V + P Y P + PP P PPP P P P PP P P Sbjct: 563 VTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSP---PPPSPVYYPQVTPSPPPPSPLY 619 Query: 877 -PPXXPPPXXP 906 PP P P P Sbjct: 620 YPPVTPSPPPP 630 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P PP P PP P P P P P P Sbjct: 624 TPSPPP-PSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PP P PPP PP P PPP PPP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCP 534 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 736 YXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 Y P + PP P P PPP P P P PP P P Sbjct: 619 YYPPVTPSPPPPSPVYYPPVTPSP---PPPSPVYYPPVTPSPPPPSP 662 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP P P P PPP Sbjct: 443 PPPYSKMSPSVRAYPPPPPPSPSPPPP 469 Score = 31.5 bits (68), Expect = 0.79 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 5/65 (7%) Frame = +3 Query: 723 PXXXLSSYXXPXXVXXLXXXXPAXY---PPPXXXXPPXXXXXXXXPXXXPPPPXP--PSX 887 P SS P V P Y PPP P P PP P P P Sbjct: 477 PPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPES 536 Query: 888 XPPPP 902 PPPP Sbjct: 537 SPPPP 541 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 Y PP PP PPPP PPS PPPP Sbjct: 439 YSPP----PPPYSKMSPSVRAYPPPP-PPSPSPPPP 469 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 P YPP PP PPPP P P P PP Sbjct: 587 PVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPP 628 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/66 (27%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +1 Query: 709 RXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP-- 882 + +P++ Y P PP P PPP P P P PPP Sbjct: 431 KMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYV 490 Query: 883 -XXPPP 897 PPP Sbjct: 491 YSSPPP 496 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP----PSXXPPPP 902 P YPP PP PPPP P P PPP Sbjct: 557 PVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPP 599 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +1 Query: 736 YXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXPPP 897 Y P + PP P P PPP P P PP P P PPP Sbjct: 634 YYPPVTPSPPPPSPVYYPPVTPSP---PPPSPVYYPSETQSPPPPTEYYYSPSQSPPP 688 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP---SXXPPPP 902 P PP PP P PP PP S PPPP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +3 Query: 717 SYPXXXLSSYXXPXXVXXLXXXXPAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 S P + S P V P PPP P P PPP P PP Sbjct: 503 SPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPP 562 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXP---PP--XXPPPXXP 906 PP + P PPP P P PP P P PP PPP P Sbjct: 540 PPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSP 587 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PP--XXPPPXXP 906 PP P PPP P P PP P P PP PPP P Sbjct: 561 PPVTQSP---PPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSP 602 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 7/46 (15%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXP-------PSXXPPPP 902 P YPP PP PPPP P PS PP P Sbjct: 617 PLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/71 (28%), Positives = 22/71 (30%), Gaps = 3/71 (4%) Frame = +1 Query: 703 VXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXP-- 876 V + P Y P + PP P PPP P P PP P P Sbjct: 548 VTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSP---PPPSPVYYPPVTYSPPPPSPVY 604 Query: 877 -PPXXPPPXXP 906 P P P P Sbjct: 605 YPQVTPSPPPP 615 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 5/41 (12%) Frame = +1 Query: 787 PPXIPRPXXXPP-----PXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P PP P P PP PP P PP Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG G GG G G G GRGI GG Sbjct: 36 GGSGSGGRANGRGNGGRGSGRGG--GRGDGRGDGRGIGGG 73 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXG 789 G GG GG G GG G G G G GG GRG G Sbjct: 12 GSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGG 51 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG--GXXGXGGGXXXGRG 798 G G G G G G G GG G G G G GRG Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRG 61 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGG--XGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G GG GG G G GG G G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGG 42 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G G G G G G GG G G GG GR Sbjct: 9 GSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGR 43 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 8/44 (18%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG--------GXXGGXXGXGGGXXXGRG 798 G GG GG G GG G G G G GGG GRG Sbjct: 22 GSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRG 65 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG-GXXGXGGGXXXGRGIXGGXXV 777 G GG GG G GG G G G G G G G G + Sbjct: 27 GSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGI 70 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G G G G GG G G G GGG GRG Sbjct: 48 GNGGRGSGRG-GGRGDGRGDGRGIGGG-GRGRG 78 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP PP PP PPP PP P Sbjct: 1122 PAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAP 1155 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P PP PP P P PPP Sbjct: 1127 PLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXP 891 P P+P PPP P PP P PP PPP P Sbjct: 1134 PSPPPQPPSSPPP-PSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P PP P PP P P Sbjct: 1122 PAGSPPLPHESPPSP--PPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 P P PP P P P P P P PPP P Sbjct: 1134 PSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG G GG G GG G G G G G G Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 168 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GG G G G GG G GGG G G G Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 34.7 bits (76), Expect = 0.085 Identities = 20/41 (48%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG-GGXXXGRGIXGG 786 G GGG GGG GG GG G G GG GRG GG Sbjct: 108 GYSGGG--GGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGG 146 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 7/47 (14%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-------GXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG GG GGG G G GG Sbjct: 111 GGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGG 157 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG GG GGG G GG GGG Sbjct: 104 GGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGG 138 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG GG GGG G GG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG G GGG G GG Sbjct: 131 GYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GGG G G GG G GGG G G GR G Sbjct: 112 GGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYG 155 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -2 Query: 905 GXXGGGXXGGGX---GXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG G GG G GG GGG R G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGG 131 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -1 Query: 906 GXXGGGXXR--GGXGXGGXG---XXXGXXXXXGGGXXGGAG 799 G GGG R GG G GG G G GGG GG G Sbjct: 119 GGGGGGYERRSGGYGSGGGGGGRGYGGGGRREGGGYGGGDG 159 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 37.5 bits (83), Expect = 0.012 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P P PPP PP Sbjct: 72 PPPKPPEPPK-PPEPEKPKPPPAPEPP 97 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP PP PP P P PP P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAP 94 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P P P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P P P PP P P PP Sbjct: 73 PPKPPEPPKPPEPEKPKPPPAPEPPKHVCKPP 104 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/36 (52%), Positives = 19/36 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GG G GGG G G Sbjct: 108 GHYGGG--GGGHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/37 (51%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -2 Query: 896 GGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG GG GG G GG G G G Sbjct: 85 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGG 121 Score = 36.7 bits (81), Expect = 0.021 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGG---XXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G GG Sbjct: 99 GGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGG 139 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG GGG G GG G GG G GGG G G G Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGG 129 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG GG GG GG G GG G Sbjct: 113 GGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/38 (50%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GG G GG Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 115 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G GG G G GGG GG G G Sbjct: 101 GHYGGGGGHYGGGGGGHG-GGGHYGGGGGGYGGGGGHHG 138 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRG 798 G G G GG G G G G GG G GGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GGGG G GG GGG Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG---GXXGXGGGXXXGRG 798 G GG GGG G GG G G G GGG G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG G G GG G G G Sbjct: 116 GHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +G GGGG G GG GGG G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGG 105 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG G G G G G GG GG G G Sbjct: 80 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHG 118 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = -3 Query: 901 GGGGXXEGGXG---GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG G GGG G GG GGG G Sbjct: 84 GGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGG 125 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGG 805 G GGG G G G G G GGG GG Sbjct: 87 GHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGG 120 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXG 808 G GGG GG GG G G GGG G Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GG GG G G Sbjct: 74 GYGGGGGHYGGGG-GHYGGGGGHYGGGGGHYGGGGGHYG 111 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 3/58 (5%) Frame = -1 Query: 906 GXXGGGXXR---GGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXGXXXXVEXR 742 G GGG GG GG G G GGG G G G G V+ + Sbjct: 94 GHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHGLNEPVQTK 151 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG GG GGG G GG GGG G Sbjct: 76 GGGGGHYGG--GGGHYGGGGGHYGGGGGHYGGGGGHYGG 112 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG G G GGG G G+ GG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGG 431 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG GG G G G Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGGEQGTGVG 429 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G GG G G GG G G G Sbjct: 296 GAEGGGRGSTGEGVTDGGGRTGNKGGNGGSIKIGVGTNG 334 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GGG G G GG G GGG G G G Sbjct: 452 GGGGEQGVTGSDGGGGRGRGGGKVAGGGKKG 482 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 G GG GG GGGG G G GGG Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGG-----XXGGAGDXGRXXSXXXG 766 G GGG G G GG G GGG GG G+ G S G Sbjct: 415 GIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGVTGSDGGG 466 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G G G G+G+ GG Sbjct: 71 GGGWIGGSVGGFG-GGIGGGFGGGGFGGGAGKGVDGG 106 Score = 37.5 bits (83), Expect = 0.012 Identities = 19/42 (45%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G G GG GG G G G+G+ GG Sbjct: 73 GWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGG 114 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG GG G GG G G GG Sbjct: 58 GGGGISGGGGFGAGGGWIGGSVGGFGGGIGG-GFGGG 93 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 896 GGGXXGG---GXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG GG G GG G G GG Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGGG 98 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG---GXXXGRGIXGG 786 G GGG GGG G G GG G G G G+G GG Sbjct: 88 GGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGG 130 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG GG G G G G G+G+ GG Sbjct: 87 GGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGG 122 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G GGG G G GG G GG G GI GG Sbjct: 54 GDLGGGGGISGGGGFGAGGGWIGGSVGGFGGGIGGG 89 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 48 PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 59 PTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P+P P P P P P P PP P P P PP Sbjct: 70 PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 P P+P P P P P P P PP P P P P P Sbjct: 81 PTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P+P PP P P P P P P P P P P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 92 PTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKPAPKPAP 130 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P P PP P P P P P P P P P Sbjct: 83 PPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKP 122 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P P P P P P P P P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKP 66 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P P P P P P P P P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKP 77 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP P P P P P P P P P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKP 99 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P PP P PP P P P P P P P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKP 110 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P+P PP P P P P P P P P P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAPKPKP 124 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 817 PPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P P P P P PP P P P PP Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPP 51 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P PP P PP P P P P P P P Sbjct: 24 PAPKPPKPKPAPAPTPPKPKPTPAPTPPKPKP 55 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P Sbjct: 33 PAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P Sbjct: 44 PTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPP 95 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P+P P PP P P P P P P P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPP 62 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 P P P P PP P P P P P P P P Sbjct: 66 PAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PP IP P PP PP P P PP P P PPP P Sbjct: 578 PPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPP 897 P P PPP P PP PP P PPP PP Sbjct: 715 PPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPP 752 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 10/50 (20%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-----PXXPP-----XPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP PP P P PPP P Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P P P PP P P Sbjct: 439 PPTTPSPGGSPPS-PSIVPSPPSTTPSPGSPPTSPTTPTP 477 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PP P P PP P Sbjct: 543 PGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIP 582 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPP 894 P +P P P P P P P PP P P PP Sbjct: 433 PITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPP 469 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PP P P P P P P Sbjct: 523 PSISPSPPITVPSPPSTPTSPGSPPSPSSPTPSSPIPSPPTP 564 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P P P P P PP P Sbjct: 472 PTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSP 511 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P PP PP P PP PP P Sbjct: 567 PPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPP 601 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P P P PP P PP P PP Sbjct: 413 PPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPP 450 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 8/45 (17%) Frame = +1 Query: 787 PPXIP----RPXXXPPPXPXXPPXXPP----XPPXPXPPPXXPPP 897 PP P P PPP PP P PP P P PPP Sbjct: 703 PPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPP 747 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP---XPXPP 879 PP P PPP P PP PP P PP Sbjct: 791 PPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 824 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXP-PXXPPXPP--XPXPPPXXP-PPXXP 906 P P P PP P P P P P P PP P PP P Sbjct: 498 PTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTP 540 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPPXXP 906 PP P PP P PP PP P PPP P P Sbjct: 780 PPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPPIYEGPLPP 824 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP PP P PPP Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPP 737 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP P P PP P PPP Sbjct: 724 PPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPP 760 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 9/46 (19%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP------XPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPP 803 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PP P PP PP P PP Sbjct: 770 PPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPP 805 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP P PPPP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP P PPPP Sbjct: 716 PVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPSXXPPPP 902 P PPP PP P PPP P PP PPPP Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 730 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P PP PPP P Sbjct: 707 PPPVHSPPPPVHSPPPPVHSPP--PPVQSPPPPPVFSPPPPAP 747 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P P P P PPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPP 777 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P PPP PP P PPPP P PPP Sbjct: 777 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P PPP PP P Sbjct: 782 PPPVHSPPPPVHSPPPPVHSPP--PPSPIYSPPPPVFSPPPKP 822 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 P P P PPP PP PP P PPP PP P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P PPP PP P PP PP PP PPPP Sbjct: 652 PVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP-----PPXPPSXXPPPP 902 P PPP PP P PP PP PP PPPP Sbjct: 702 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPP 745 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P P PP PP PPP P P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPP 784 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 PP P PP PP P PP P PP PPP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP + P P PPP P P P P PP PPP P P Sbjct: 671 PPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 716 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P PPP PP P Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PP P P PP P P P PP P Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXP--PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P P P P PP PP PPP P P Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP 769 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPX---PXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P PP P PP PPP P P Sbjct: 751 PP--PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 791 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP + P P PPP P P P P PP PPP P P Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP PP PPP P P Sbjct: 657 PPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPPP S PP P Sbjct: 709 PVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP PP PPPP Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 P + P PP PP P PP PPP PPP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPP 679 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PP PPP P P Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P P PP P Sbjct: 700 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSP 742 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPP 897 PP + P P PPP P P PP P P PPP PP Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPP-PPAPIYSPPPPPVHSPP 760 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPS--XXPPPP 902 P PPP PP P PPP P PPS PPPP Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPP 897 PP P PP PP P PP P PP PPP Sbjct: 648 PPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPP 686 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP PP P P PP P Sbjct: 650 PPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSP 692 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPP 897 PP + P P PPP PP PP P PPP PP Sbjct: 686 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPP 728 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 P P PPP P P PP PP P P PP P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSP 774 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P PPP P P P P P P PP P Sbjct: 796 PPPVHSP---PPPSPIYSPPPPVFSPPPKPVTPLPPATSP 832 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PP P PPP PP Sbjct: 642 PPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPP 678 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP + P PPP PP P P PP PPP P P Sbjct: 789 PPPVHSP---PPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPP 897 P P P PPP PP P P PP P P P Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTP 839 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 673 PVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHS--PPPP 709 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 755 PVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHS--PPPP 791 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP S PPPP Sbjct: 666 PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHS--PPPP 702 Score = 29.9 bits (64), Expect = 2.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 PPP PP P PPP P + PP Sbjct: 796 PPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP Sbjct: 642 PPVHSPPPPPPVHSPPPP 659 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPPXXPPP 897 P P P PP P PP P PPP PP Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPP 664 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP S PPPP Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVH-S--PPPP 716 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPPP S PPPP Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVH-S--PPPP 798 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX----PPSXXPPPP 902 P PPP PP P PPPP PP PPP Sbjct: 730 PVQSPPP----PPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPP 768 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPPP PPP Sbjct: 753 PPPVHSPPPPVHSPPPPPVHSPPPPV--HSPPPP 784 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG GG GG GGG RG GG Sbjct: 108 GGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 146 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GG G G G GG G GG G G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGG 123 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G GG GR GG Sbjct: 121 GGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 157 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/39 (48%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGG-XXGGGXGXGGXGGXXGGXXG--XGGGXXXGRG 798 G GGG GGG G G GG GG G GGG G G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGG 135 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 896 GGGXXGGG--XGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG G GG Sbjct: 144 GGGSYGGGRREGGGGYGGGEGGGYGGSGG 172 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = -2 Query: 896 GGGXXGGGXGX---GGXGGXXGGXX--GXGGGXXXGRGIXGG 786 GGG GGG G GG GG GG G GGG G G G Sbjct: 92 GGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSG 133 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGG 819 G GGG GG G GG GG GG G GG Sbjct: 146 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = -2 Query: 896 GGGXXGGGXGX----GGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G GG GGG G G Sbjct: 128 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 164 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG G G GGG G G GG Sbjct: 88 GSGGGGGHRGGGGG--GYRSGGGGGYSGGGGSYGG 120 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G GGG GG G G Sbjct: 133 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 171 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GGG GG G G G G GGG GG G Sbjct: 107 GGGGYSGGGGSYGGG---GGRREGGGGYSGGGG 136 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRG 798 G G GG G G G GG GG G GG G G Sbjct: 137 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 175 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 36.7 bits (81), Expect = 0.021 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P P PP PPP P Sbjct: 396 PAPSPTSPPLSTPPPARPCPPVYSPPPPPP 425 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P PP PPP PPP Sbjct: 393 PLAPAPSPTSPPLSTPPPAR-PCPPVYSPPP--PPP 425 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP PPP P P Sbjct: 383 PPSQISPSSQPLAPAPSPTSPPLSTPPPARPCP 415 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GG G G GG GG G GGG G Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G GG G GG G GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G GG GG G G GGG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G GG GG G GGG G G GG Sbjct: 59 GGGDGG-GDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG GG GGG GI GG Sbjct: 39 GGGEGGGGEGTSGEGGGGGGDGTKGGGD----GISGG 71 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G GGG G G GG Sbjct: 29 GGGGEGKKKNGGGEGGGGEGTSGEGGG-GGGDGTKGG 64 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G G GG G G GG G G GG Sbjct: 53 GGGGGGDGTKGGGDGISGGGHGDGLGCSGG--GGDGTKGG 90 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 36.7 bits (81), Expect = 0.021 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG + G GG G G GGG GG GD G Sbjct: 56 GGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGG 94 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/41 (46%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G GG GG G GGG G GG Sbjct: 47 GEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 GG GG G GG G G GG GG+G R S G Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGG 86 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGG 800 GGGG GG GGGG G GG GG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG GG GG GGG Sbjct: 70 GGGGSGGGQRSSSGGGGGGGEGDGGGG 96 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G G G G GGG G G GG Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGG 61 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -3 Query: 898 GGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGG GG GGG G GG GGG Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGG 77 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG G G G GG G G GGG G G Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGG 62 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP P P P PP P P Sbjct: 33 PPATPPPVATPPPVATPPPAATPAPATP-PPAATPAP 68 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP PP P PP P P PPP Sbjct: 28 PTATPPPATPPPVATPPPVATP-PPAATPAPATPPP 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPP-XXPPPXXP 906 P P P P PP PP PPP P P P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T P P P PPP P P PP P P PP Sbjct: 36 TPPPVATPPPVATPPPAATPAPATP--PPAATPAPATTPP 73 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P P PP P PP P P Sbjct: 43 PPPVATPPPAATPAPATPPPAATPAPATTPPSVAPSP 79 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPR--PXXXPPPXPXXPPXXPPXPPXP-----XPPPXXPPP 897 PP + R P PPP P PP PP P PPP PPP Sbjct: 20 PPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPP 897 PP + R PPP P PP PP P P P PP Sbjct: 35 PPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP + R PPP P P PP P P P Sbjct: 34 PPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP PP PP P PPP P Sbjct: 13 VPLPPP-PPPLMRRRAPLPPPPPPPLMRRRAPPPPPP 48 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G GG GG G G GGG G+ GG Sbjct: 294 GGGHPQDGKNGGGGGGPNAGKKGNGGGGPMAGGVSGG 330 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G GGG G G Sbjct: 264 GGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGG 296 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG G G GGG G GG Sbjct: 266 GGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGG 305 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 896 GGGXXGGGXGX-GGXGGXXGGXXGXGGGXXXGRG 798 GG GG G GG GG G GGG G G Sbjct: 250 GGPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPG 283 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG G G GGG G+ GG Sbjct: 280 GGPGNQNQGGGKNGGGGHPQDGKNGGGGGGPNAGKKGNGG 319 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P P PP PPP P Sbjct: 40 PPVDPSPSSVHRPYPPPPPL-PDFAPQPLLPPPSPPPPPP 78 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP----XXPPXPPXPXPPPXXPP 894 PP P PPP P P PP PP P PPP P Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXX--PPXPPXPXPPPXXPPPXXP 906 P P P P PP PP PP PP PPP P Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPP 97 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P PP PP P PP PP PP P Sbjct: 62 PATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP-------XPXPPPXXPPP 897 PP P P PPP P P P P P P P PPP Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPP 125 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP PP P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPP 87 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPPXXP 906 T PP P PP PP P P PPP P P P Sbjct: 58 TSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPP 102 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PP PP P PP PPS PPP Sbjct: 61 PPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPP 94 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP P P PP P P PP PP P Sbjct: 40 TTQPPATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTP 82 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPP 897 P P P P P P P P P PP PPP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP PP P P P P P Sbjct: 78 PP--PTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSP 112 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P P P PP PP P P PP P P Sbjct: 279 PSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLP 317 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 P P P PP P PP P P PP P P P P P Sbjct: 337 PVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P I P PPP P P PP P P PP P P Sbjct: 341 PVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIP 380 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPP-PXPXXPPXXPPXPPXPXPP-PXXPP-PXXP 906 P IP P PP P PP P P P PP P PP P P Sbjct: 290 PLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIP 331 Score = 32.7 bits (71), Expect = 0.34 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXP--PPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 T P +P P PP P PP PP P PPP P P P Sbjct: 318 TPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPP 363 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP----PXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P P PP P P PP P P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIP 305 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P PP P P P PP P P P P P Sbjct: 331 PTLP-PLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLP 368 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXP-PPXPXXP--PXXPPXPPXP-XPPPXXPPP 897 P +P P PP P P P P PP P PP PPP Sbjct: 314 PLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPP 353 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXXP----PPXPXXPPXXPPXPPXP-XPPPXXPPPXXP 906 P +P P P PP P P P PP P P P P P P Sbjct: 178 PLLPDPSFPPPLQDPPNPSPLPNLPIVPPLPNLPVPKLPVPDLP 221 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPR-PXXXPPPXPXXPPXX-----PPXPPXPXPPPXXPPPXXP 906 PP +P P PP P PP PP P P P PP P Sbjct: 307 PPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPP 352 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXX-PPPXPXXP--PXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P P P P P PP P P PP P P Sbjct: 347 PPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIP 389 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P P P P PP P P P P P Sbjct: 302 PLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPLPVLP 340 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-----PXXPPXPPXPXPPPXXP 891 PP P P P P P P PP P P PP P Sbjct: 354 PPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPPLSP 393 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP---XPPP----XXPPP 897 PP P P PPP P P P PP P PPP PPP Sbjct: 45 PPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHSPPPLSQSLSPPP 88 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P P PP P PPP PP PPP Sbjct: 45 PPSKPSPSMSPPPSPSL----PLSSSPPPPPPHKHSPPP 79 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G GG G GG G G G G G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGG 104 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 905 GXXGGGXXGGG-XGXGGXGGXXGGXXGXGGG 816 G G G GGG GG GG GG G GGG Sbjct: 73 GGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G G GG G GGG G GG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP PP P P P PP PP P Sbjct: 223 PP--PVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVP 260 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPP 897 PP + +P PPP P PP P P P P P PP Sbjct: 369 PPIVKKPC--PPPVPIYKPPVVIPKKPCPPPVPVYKPP 404 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP P PP P Sbjct: 212 PVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPPKP 250 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P PP P P P PP Sbjct: 183 PPKYSPPVEVPPPVPVYEP--PPKKEIPPPVPVYDPP 217 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP P P PPP PP P P P PPP P P Sbjct: 208 PP--PVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKPCPP 248 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P P PP PP PPP Sbjct: 165 PFPLPPPLELPPFLKKPCPPKYSPPVEVPPP 195 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP IP+ P P P PP P PP PP P Sbjct: 238 PPPIPKKPCPPKPPKIEHP--PPVPVYKPPPKIEKPPPVP 275 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP-PXXPP-PXXP 906 PP + PPP P P P P PP P PP P P Sbjct: 385 PPVVIPKKPCPPPVPVYKPPVVVIPKKPCPPLPQLPPLPKFP 426 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPP---XXPPP 897 PP P P PPP PP P P P PPP PPP Sbjct: 193 PP--PVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPP 233 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPP P PP Sbjct: 197 PVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPP 233 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPR----PXXXPPPXPXXPPXXP--PXPPXPXPPPXXPPPXXP 906 PP I + P PPP PP P P P PP PP P Sbjct: 265 PPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKPCPPKKVDPPPVP 310 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PP P PPP P P P Sbjct: 260 PVYKPPPKIEKPPPVPVYKPPPKIEHPPPVPVHKLPKKP 298 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P PP P PP PP P P Sbjct: 300 PPKKVDPPPVPVHKPPTKKPCPPKKVDPPPVPVHKPP 336 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P + Y P PP P+ PPP P P PP P P P PP Sbjct: 224 PPVPVYKPPPKVELPPPIPKKPCPPKPPK-IEHPPPVPVYKP--PPKIEKPPPVPVYKPP 280 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPP 882 PP P P PPP PP PP P PPP Sbjct: 349 PP--PVPVYKPPPKIEHPPIYIPPIVKKPCPPP 379 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP I P P P PP P PPP PPP Sbjct: 250 PPKIEHPPPVPVYKPPPKIEKPPPVPVYKPPPKIEHPPP 288 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PPP P P PP P P P P P P Sbjct: 217 PPKKEVPPPVPVYKP--PPKVELPPPIPKKPCPPKP 250 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP PP P P PP PP P Sbjct: 256 PP--PVPVYKPPPKIEKPPPVPVYKP---PPKIEHPPPVP 290 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G GG G GG GGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGGIFFFGGG 53 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 35.9 bits (79), Expect = 0.037 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 GGG GGG G GG GG GG GG R + Sbjct: 212 GGGGLGGGNGSGGGGGGGGGGGRISGGSSPRRHV 245 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG G GG G GG G GGG G Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GG GGG G GG GG G Sbjct: 215 GLGGGNGSGGGGGGGGGGGRISG 237 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG GG G GG GG Sbjct: 214 GGLGGGNGSGGGGGGGGGG 232 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/37 (51%), Positives = 19/37 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG G G GG G G GGG G G GG Sbjct: 78 GGGHYGGGGGHYGGGG--GHYGGGGGGYGGGGGHHGG 112 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 896 GGGXXGGGXGX--GGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG GGG Sbjct: 85 GGGHYGGGGGHYGGGGGGYGGGGGHHGGG 113 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG GG G G G G GGG GG G G Sbjct: 74 GYGGGGGHYGGGG-GHYGGGGGHYGGGGGGYGGGGGHHG 111 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG-GXXGGXXGXGGGXXXGRG 798 G G G GG G G G G GG G GGG G G Sbjct: 57 GGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGG 93 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GGGG G GG GGG Sbjct: 66 GGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGG 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXG---GXXGXGGGXXXGRG 798 G GG GGG G GG G G G GGG G G Sbjct: 48 GGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGG 86 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -2 Query: 896 GGGXXGGGXG--XGGXGGXXGGXXGXGGGXXXG 804 GGG GG G GG GG GG G GG G Sbjct: 84 GGGGHYGGGGGHYGGGGGGYGGGGGHHGGGGHG 116 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGG +G GGGG G GG GGG G Sbjct: 67 GGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGG 105 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GGG G GG Sbjct: 63 GHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGG 102 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G G GGG G GG GG G G GGG G G Sbjct: 73 GLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 34.7 bits (76), Expect = 0.085 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GGG G G GG GG G GG Sbjct: 77 GGGGGGLGGGGGGLLGGGGFGGGAGGGLGG 106 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 9/46 (19%) Frame = -2 Query: 896 GGGXXGGGXGXG---------GXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G G GG GG G GGG G G GG Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGG 99 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G GG G G G G G G+ G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLG 77 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G G G GG G GG Sbjct: 90 GSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG GG GG G G G G GG Sbjct: 78 GSGSGSGTGYGYGSGG-GGARGGGYGYGSGNGRSGGGGGG 116 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGRXXSXXXG 766 G G GG G G G G GG GG G G + G Sbjct: 86 GYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGGFNGEVAALSHG 129 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P PP PP PP P PPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPP--PPAPPPGSGGPKPPPPPGP 408 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P P P P PP PP P P PPP Sbjct: 141 KPGSSPSPSPSRPPKRSRGPPRPPTRPKSPPP 172 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P P PP P P PPP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPP 882 PP P P PPP P P PP P P PPP Sbjct: 385 PPRPPPP--APPPGSGGPKPPPPPGPKGPRPPP 415 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PPP PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPP----XPPSXXPPPP 902 P P P PP P P PPP PPS PPPP Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P PP P PP P Sbjct: 389 PPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P P PP PP PPP Sbjct: 150 PSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P PPPP P PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPPP 416 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PRP PP P PP P P P PPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRP--PPP 416 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP +P P P PP PP PP P PPP P Sbjct: 371 PPPVPAPQMPSSAGPPRPP--PPAPPPGSGGPKPPPPPGP 408 Score = 33.5 bits (73), Expect = 0.20 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 +P P P P PP PP P P PPP Sbjct: 141 KPGSSPSPSPSRPPKRSRGPPRPPTRPKSPPP 172 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P P PP P P PPP Sbjct: 380 PSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPP 882 PP P P PPP P P PP P P PPP Sbjct: 385 PPRPPPP--APPPGSGGPKPPPPPGPKGPRPPP 415 Score = 31.9 bits (69), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P PPP PPP Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPP 395 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 6/45 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXP--PPP----XPPSXXPPPP 902 P P P PP P P PPP PPS PPPP Sbjct: 142 PGSSPSPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPP 186 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P P P PP P PP P Sbjct: 389 PPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P P PP PP PPP Sbjct: 150 PSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPP 185 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 804 PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PP P PPPP P PPPP Sbjct: 385 PPRPPPPAPPPGSGGPKP-PPPPGPKGPRPPPP 416 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PRP PP P PP P P P PPP Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRP--PPP 416 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +1 Query: 742 PXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P L T PP +P P P PP PP P P PPP Sbjct: 8 PILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXX----PPXPPXPXPPPXXPPPXXP 906 P P P PP P PP PP P PPP PP P Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P PP P P P P P Sbjct: 125 PPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP P P PPP PP PPP Sbjct: 44 PPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPP 82 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P P P P PP P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 T PP P+P PP PP P PP P P P Sbjct: 130 TTNPP--PKPSPSPPGETPSPPGETPSPPKPSPSTPTP 165 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/69 (27%), Positives = 23/69 (33%) Frame = +1 Query: 700 IVXRXTPTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP 879 ++ PT+ P + P P PPP P P PP P PP Sbjct: 76 VITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASP-SPPAPTTTNPP 134 Query: 880 PXXPPPXXP 906 P P P P Sbjct: 135 P-KPSPSPP 142 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXPPPXXP 906 PP P P PP P PP P PP P P P Sbjct: 117 PPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKP 158 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P P P P P PP P P PP P P Sbjct: 112 TVSPP--PPPDASPSP-PAPTTTNPPPKPSPSPPGETPSP 148 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP + PPPP Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP 91 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP----XPPPXXP---PPXXP 906 PP P PP PP PP P PPP P PP P Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPP 110 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P PP P Sbjct: 135 PKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP P P PP PPP P P Sbjct: 12 PPSSNSSTTAPPPLQTQPTT-PSAPPPVTPPPSPPQSPPP 50 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPPPXXPP 894 PP P P PPP P P PP PP PP Sbjct: 40 PP--PSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPP 75 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 14/39 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ PP PP P P P + PPPP Sbjct: 137 PSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG G G GG GG G GGG G+G G Sbjct: 313 GGGGGGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGG 351 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GGG G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G GG GG G G G G GG Sbjct: 378 GGPNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGG 417 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G G G GGG G G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GGG G G Sbjct: 383 GKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGGGG 418 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -3 Query: 901 GGGGXXEGGXGGGGXXXGXXXXXXXXGGXXXXGGG 797 GGGG G GGGG GG GGG Sbjct: 360 GGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGG 394 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGG--GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG G GGG G GG GG G GGG G G G Sbjct: 360 GGGGGPNGNKGGG-GVQMNGGPNGGKKGGGGGGGGGGGPMSG 400 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG G G GG G GG GG G G Sbjct: 361 GGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGG 396 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 123 GGGGGGGGGGGGGGGG 138 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 124 GGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG-XGGXXGGXXG--XGGGXXXGRGIXGG 786 G GG GGG G GG GG G GGG G GG Sbjct: 341 GGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGG 383 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G G GG GG G GGG Sbjct: 116 GGLGGGGLPGGLGGLGGGGLPGGLGGLGGG 145 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG GGG GG GG GG G G G Sbjct: 111 GKPGGGGLGGGGLPGGLGGLGGGGLPGGLGGLGG 144 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G GG GGG G G GG Sbjct: 101 GGGRRFGGRFGKPGGGGLGGGGLPGGLGGLGG 132 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PPP P PP PP P PPP PP Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPP--PP 44 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP PP PPP PPP P Sbjct: 4 PKYAYPYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPP 42 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP 870 P P P PP PP PP PP P Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P PPP P P PP P P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLP 191 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXP---PXPPXPXPPPXXPPPXXP 906 PP P P PP P P P P P P P P P PP P Sbjct: 167 PPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSP 210 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PPP P P P P P P P P P Sbjct: 165 PPPPPYPSPLPPP-PSPSPTPGPDSPLPSPGPDSPLP 200 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P P P P P P Sbjct: 161 PPLPPPPPPYPSPLP--PPPSPSPTPGPDSPLPSPGPDSP 198 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP P P P PPP P P Sbjct: 223 PDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P P P P P P P Sbjct: 195 PDSPLPLPGPPPSPSPTPG--PDSPLPSPGPDSPLP 228 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PPP P P P P P P P P P Sbjct: 242 PDSPLPSPGPPPSPSPTPG--PDSPLPSPGPDSPLP 275 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP-XXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P P P P P P P P P P P PP P Sbjct: 198 PLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSP 238 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P P PP P P P P Sbjct: 232 PPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSP 264 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PS PPPP Sbjct: 161 PPLPPPPPPYPSPLPPPP 178 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPP 897 +P P P P P P P P P P P P PP Sbjct: 246 LPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P P P P P PP P P Sbjct: 251 PPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PP P P P P P P P P P PPP P P Sbjct: 176 PPPSPSP--TPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGP 214 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPPXXP 906 PP P P P P P P P P P PPP P P Sbjct: 204 PPPSPSP--TPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGP 242 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXPPP 897 P P P P P P P P P P P P P P P Sbjct: 247 PSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLP 284 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 P P P P P P P P P P PP P P Sbjct: 221 PGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSP 257 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P PP P P P P P P Sbjct: 184 PGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLP 219 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGG 816 GG GGG GG GG GG G GGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GG GGG G G GG GG G GG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GGG G GG GG GG G G Sbjct: 13 GAGGGGGHGGGAG-GGFGGGAGGGGGHG 39 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG G GG GG GG G G G G G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/36 (50%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXG--XGGGXXXGRGI 795 GGG GGG G GG GG GG G GG RG+ Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRGGLDNVRGL 94 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG--XXGGXXGXGGGXXXGRGIXGG 786 G GGG GG GG GG GG GGG RG GG Sbjct: 88 GSGGGGGHRGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGG 129 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GG G G GG G GG GR GG Sbjct: 104 GGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGG 140 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -2 Query: 896 GGGXXGGG--XGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG G GG Sbjct: 127 GGGSYGGGRREGGGGYGGGEGGGYGGSGG 155 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 905 GXXGGGXXGGGXG-XGGXGGXXGGXXGXGG 819 G GGG GG G GG GG GG G GG Sbjct: 129 GSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = -2 Query: 896 GGGXXGGGXGX----GGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G GG GGG G G Sbjct: 111 GGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEG 147 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG RGG G G GGG GG G G Sbjct: 116 GGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 154 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG---GXGGXXGGXXGXGGGXXXGRG 798 G G GG G G G GG GG G GG G G Sbjct: 120 GYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSGGGGG 158 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXY 762 G GG G G GG GG GGG G G GG + Y Sbjct: 43 GGHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHGGRHGY 85 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G G GG G G GG GG GGG G Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNGGGYNGGGGYNGG 77 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG GG G GG G GG G G Sbjct: 49 GGYNGGGGYNGGGGHNGGGYNGGGGYNGGGHG 80 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGR 801 G GGG GG G G GG GG G GG GR Sbjct: 50 GYNGGGGYNGGGGHNG-GGYNGG-GGYNGGGHGGR 82 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 GGG GGG GG GG G G G G Sbjct: 54 GGGYNGGGGHNGGGYNGGGGYNGGGHGGRHG 84 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP PP P PP PP P P P Sbjct: 39 PPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGP 78 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPX--PPSXXPPPP 902 P YPPP P P PPPP PP+ PPPP Sbjct: 26 PGAYPPPPQGAYPPPGGYP--PQGYPPPPHGYPPAAYPPPP 64 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP PP P PP PP PPP Sbjct: 31 PPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPP 63 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P PP PP P Sbjct: 38 PPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYP 73 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 35.1 bits (77), Expect = 0.065 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP 876 IPRP PPP P P PP PP P P Sbjct: 377 IPRPPYGPPPGP-PPMMRPPLPPGPPP 402 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP PP P PPP P S PPPP Sbjct: 219 PPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/50 (36%), Positives = 19/50 (38%), Gaps = 10/50 (20%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX----------PPXPPXPXPPPXXPPPXXP 906 PP + R PPP PP PP P P PPP PP P Sbjct: 349 PPGMLRFPPPPPPLDMHPPHPGMFVGHLIPRPPYGPPPGPPPMMRPPLPP 398 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP PP PP PPP P Sbjct: 203 PPLPPTTGLTLPHSPFPPPPPGPPPKEQDFVRPPLPPPPQLP 244 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 3/28 (10%) Frame = +1 Query: 820 PPXPXXPPXXP---PXPPXPXPPPXXPP 894 PP P PP P P P PPP PP Sbjct: 200 PPLPPLPPTTGLTLPHSPFPPPPPGPPP 227 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPP 897 P P P P P P PP PP P P PP Sbjct: 214 PHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPP 250 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 817 PPPXPXXPPXXPPX--PPXPXPPPXXPPPXXP 906 PPP P PP PP P PPP P P Sbjct: 219 PPPPPGPPPKEQDFVRPPLP-PPPQLPQSSQP 249 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GGG GGG G GG G GGG G G Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GGG G G G G GGG G G GG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGG 137 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 123 GGGGGGGGGGGGGGGG 138 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGG 849 GGG GGG G GG GG Sbjct: 124 GGGGGGGGGGGGGGGG 139 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 T PP P P PP P PP PP P P PPP Sbjct: 177 TTTPPVQP-PTYNPPTTPVKPPTAPPVKP-PTPPP 209 Score = 34.7 bits (76), Expect = 0.085 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP + P PP PP P P PP PP P Sbjct: 113 TVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPP 155 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP PP P PP PP P Sbjct: 127 PTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSP 163 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP-XXPPXPPXPXPPPXXPPPXXP 906 P + P PP P PP PP P PP PP P Sbjct: 150 PPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNP 189 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP PP P PP PP P Sbjct: 154 PPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTP 193 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P PP PP P Sbjct: 145 PPVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQP 184 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T P +P PP P P P P PP PP P Sbjct: 67 TPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKP 109 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 7/47 (14%) Frame = +1 Query: 787 PPXIPRPXXXPP---PXPXXPPXXPP--XPPXP--XPPPXXPPPXXP 906 PP IP PP P PP PP PP P PP PP P Sbjct: 80 PPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPTVKPPSVQPPTYKP 126 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +1 Query: 778 TXXPPXIP--RPXXXPP--PXPXXPPXXPPX---PPXPXPPPXXPPPXXP 906 T PP P P PP P PP PP P P PP PP P Sbjct: 156 TYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P P P P PP P P PP PP Sbjct: 175 PPTTTPPVQPPTYNPPTTPVKPPTAP-PVKPPTPPP 209 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPP--PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP P PP P P PP P Sbjct: 141 PPTTP-PVQSPPVQPPTYKPPTSPVKPPTTTP-PVKPPTTTP 180 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P Y PP P P PP PP+ PP Sbjct: 154 PPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPP 190 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPP 897 T PP P P P P P P PP P PPP Sbjct: 168 TTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAPPVKPPTPPP 209 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPP----XXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P P PP PP P Sbjct: 41 PSPATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKP 80 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P PP P P P PP PP P Sbjct: 112 PTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSP 150 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 7/44 (15%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX--PPXPPXPXPP-----PXXPPP 897 PP R PPP P PP P PP P PP P PPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPP-----XPXPPPXXPPP 897 P P P PPP P PP PP P PPP PPP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPP--PPP 60 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 6/42 (14%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPX------PXPPPXXPPPXXP 906 P P PPP P PP PP P PPP PPP P Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPP--PPPPLP 78 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP PP P PPP P Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP + PPPP Sbjct: 24 PPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 8/48 (16%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP--XXPPXPPXPXPP------PXXPPPXXP 906 PP P P P P PP P PP P P P PPP P Sbjct: 29 PPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPP 76 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 35.1 bits (77), Expect = 0.065 Identities = 20/40 (50%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G GGG G GG GG G G GGG G GI G Sbjct: 67 GYGGFGGAGGGLG-GGLGGGAGS--GLGGGLGGGSGIGAG 103 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GGG G G+ GG Sbjct: 49 GLPFGGVGGGVSGPGGNLGY-GGFGGAGGG--LGGGLGGG 85 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 7/50 (14%) Frame = -2 Query: 905 GXXGGGXXG--GGXGXGGXGGXXGGXXGX-----GGGXXXGRGIXGGXXV 777 G GGG G G G GG GG GG G G G G G+ GG + Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGL--GGGLGGGSGI 100 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -1 Query: 894 GGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GG G G G G G GGG GGAG Sbjct: 56 GGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAG 87 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GG GG G G G G G G GG G Sbjct: 63 GGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLG 95 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G G G G G G G G GGG GG+G Sbjct: 64 GNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSG 99 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 35.1 bits (77), Expect = 0.065 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 14/50 (28%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP--------------PXPPXPXPPPXXPPP 897 P P P PPP P PP P PP P PPP PPP Sbjct: 68 PPSPSPPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP P PPP Sbjct: 105 PPPPPPPPPPPPPSSTWDFWDPFIPPP 131 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPP 899 P PPPP PP PPP Sbjct: 69 PSPSPPPPPPPRPPPPP 85 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPP PP PPPP Sbjct: 68 PPSPSPPPPPPPRPPPPP 85 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 853 PXPPXPXPPPXXPPPXXP 906 P PP P PP PPP P Sbjct: 71 PSPPPPPPPRPPPPPLSP 88 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P PPP PPP PP PPPP Sbjct: 79 PRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P P PP PP P P P PP P Sbjct: 131 PPSTPSTPSSPPSTPSTPSS-PPSPPSP-PSPSLPPSSLP 168 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP P P P PP P P P Sbjct: 125 PSTPSSPPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLP 163 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP PP PP P PP PP Sbjct: 135 PSTPSSPPSTPSTPSSPP-SPPSPPSPSLPPSSLPP 169 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PP P P P PP PP PP Sbjct: 141 PPSTPSTPSSPPSPPSPPS--PSLPPSSLPPSASPP 174 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 34.7 bits (76), Expect = 0.085 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP P P PPP PPP Sbjct: 8 PTYDPWNSPYSPHLHPPSAPLPPPPPLPPPP 38 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PP P PP P PPP PPP Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLPPP--PPP 40 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P PP PP P P PPP P P Sbjct: 19 PHLHPPSAPLPPP--PPLP--PPPPPRQSHPESP 48 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G GGG GGG G GG G GG GRG G Sbjct: 32 GGRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGPAG 70 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG GG G G GG GG G GG GRG Sbjct: 11 GFSGGRGRGGYSGGRGDGGFSGGRGG--GGRGGGRG 44 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GG G GG G G GG GRG Sbjct: 9 GGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRG 40 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG--GGXXXGRG 798 G GG GG G GG GG G GG GRG Sbjct: 19 GGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRG 56 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPP 897 P P P PPP PP P P P P P PPP Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPP 93 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 YPPP PP PPPP PPP Sbjct: 90 YPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPP 125 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXX--PPXPPXPXPPPXXPPP 897 P PPP P P PP P PP PPP Sbjct: 65 PPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPX--PPSXXPPPP 902 Y PP PP P PPP PP PPP Sbjct: 62 YSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXP-PXPXPPPXX-PPPXXP 906 P+ P P P PP P P PPP PPP P Sbjct: 38 PQHSPLPSPVYSSPADLPPPPTPVYSPPPADLPPPPTP 75 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG GG GG G G GGG G G GG Sbjct: 179 GRQGSRYGGGGGSFGGGGGGGAGSYG-GGGAGAGSGGGGG 217 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 PP P PPP PP P PP PP PPP Sbjct: 53 PPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPP 90 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP I P P PPP PP PP PPP P P Sbjct: 56 PPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPHPP 98 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 4/42 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP----PXPPSXXPPP 899 P YPPP PP P PPP P PP PPP Sbjct: 65 PVQYPPPIKKYPP--PPYEHPPVKYPPPIKTYPHPPVKYPPP 104 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 P PPP PP PP PPP PPP Sbjct: 98 PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPP 130 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 YPPP PP PP PP PPP Sbjct: 75 YPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPP 110 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPP 897 PP I P P PPP PP PP PPP PP Sbjct: 108 PPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPP 148 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPPXXP 906 PP I P P PPP PP PP PPP P P Sbjct: 186 PPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPP 229 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 3/42 (7%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPPPXXP 906 P P PPP PP PP P PP PP P Sbjct: 47 PKFPYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYP 88 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPPP PP PP PP PP Sbjct: 117 PEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPP 155 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P YPPP PP PP PP PP Sbjct: 156 PEHYPPPIKKYPPQEQYPPPIKKYPPPEKYPPPIKKYPP 194 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX---PPXPPXPXPPPXXPPP 897 PP I + PPP PP PP P PP PPP Sbjct: 199 PPPIKK---YPPPIKKYPPPEEYPPPIKTYPHPPVKYPPP 235 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXI---PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP I P P PP P PP P P PPP Sbjct: 219 PPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPP 258 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P PP PPP Sbjct: 42 PFKWGPKFPYSPPKPPPIEKYP-PPVQYPPP 71 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPP---XPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P P PP P P PPP Sbjct: 78 PPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPP 117 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 4/42 (9%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP----XPPSXXPPP 899 P YPPP PP P PPP PP PPP Sbjct: 182 PEKYPPPIKKYPP--PEQYPPPIKKYPPPIKKYPPPEEYPPP 221 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 5/41 (12%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPP-----PXPPSXXPPPP 902 YPPP PP P PPP P PP PPP Sbjct: 212 YPPPEEYPPPIKTYPHP-PVKYPPPPYKTYPHPPIKTYPPP 251 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXP-XXXPPPP----XPPSXXPPPP 902 P YPPP P P P PP PP PPPP Sbjct: 215 PEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPP 258 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 5/44 (11%) Frame = +3 Query: 786 PAXYPP-PXXXXPPXXXXXXXXPXXXPPP----PXPPSXXPPPP 902 P YPP P P P PPP P PP PPP Sbjct: 229 PVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPPKKKYPPP 272 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP---XXPPXPPXPXPPPXXPP 894 P P P PPP PP PP P P PP Sbjct: 98 PVKYPPPEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPP 136 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 1/40 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP-XPPSXXPPPP 902 P YPPP PP PP PP PPP Sbjct: 104 PEQYPPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPP 143 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 795 YPPPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 YPPP PP P PPP PP PPP Sbjct: 140 YPPPEQYPPP--IKKYPPPEHYPPPIKKYPPQEQYPPP 175 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 33.9 bits (74), Expect = 0.15 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PPP P P P PP P PPP Sbjct: 37 PPPPPVYSPPISPPPPPPPPPP 58 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P PPP PPP Sbjct: 37 PPPP--PVYSPPISPPPPPPP--PPP 58 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 10/47 (21%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPP----------XXPPXPPXPXPPPXXPPP 897 PP + P PPP P PP PP PP PPP Sbjct: 39 PPPVYSPPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/41 (34%), Positives = 14/41 (34%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPP--SXXPPPP 902 P PPP PP PPPP PPPP Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPP 85 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P PPP P PP PPP PP P Sbjct: 21 VPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP--XPPPXXPPP 897 PP R PPP P P PP PPP PPP Sbjct: 15 PPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 PP + R PPP P PP PP P Sbjct: 28 PPPMRRSAPSPPPMSGRVPPPPPPPPMFDP 57 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP P PPPP Sbjct: 148 PLPPPPPPMPRRSPPPPP 165 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXP-----XPPPXXPPP 897 PP PR P P P P PP P PPP PPP Sbjct: 618 PP--PRLVCGPYPLPRLVRVGSPSPPPPSMSGGAPPPPPPPP 657 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 841 PXXPPXPPXPXPPPXXPPP 897 P PP PP P P PPP Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G GGG G GG GG GG GGG Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G G GG G G GGG Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG GG GG G G GGG GG GD G Sbjct: 122 GGG---GGYSYGGGGGGYGG----GGGGYGGGGDGG 150 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 GGG G G GG G G GGG GG G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGY---GGGGDGGGG 152 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPP 897 PP P+ PP P P P P P P P PPP Sbjct: 100 PPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPP 137 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPX----PXPPPXXPPPXXP 906 P P+ PPP P PP P P P P P PP P Sbjct: 118 PHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPP 161 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP-PPXXPPP 897 P +P P P P P PP P P P PPP Sbjct: 115 PFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPP 151 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP---XXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P+ PPP P PP P P P P PP P Sbjct: 91 PPPAPKKSP-PPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTP 132 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P P PPP P P P P PP P Sbjct: 82 PSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTP 115 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 IP P P P P PP PP P P PP P Sbjct: 81 IPSTPSTPSPPPPAPKKSPP-PPTPKKSP-SPPSLTP 115 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GG GGG G GG GG G GGG GRG Sbjct: 10 GGRRGGGHSSGRRGGRGGGGRGGGGG---GRG 38 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G G GG G GGG G Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGGSRDSDG 47 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG---XXGXGGGXXXGRGIXGG 786 G GG G G G GG G GG G G G G GG Sbjct: 19 GGGGGSGDGSGSGDGGGSGDGGGSRDSDGSGDSSGGGSGDSGG 61 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G GG G GG G G G G G G Sbjct: 11 GSGDGGGSGGGGGSGDGSGSGDGGGSGDGGG 41 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP-PXPPSXXPP 896 P YPPP PP P PPP PP PP Sbjct: 109 PVVYPPPIVRPPPITRPPIIIPPIQPPPVTTPPGLLPP 146 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P PPP PP P PP PP PP P Sbjct: 95 PPVVVRPPPIIRPPPVVYPPPIVRP-PPITRPPIIIPPIQPP 135 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP + P P PP PP PP PPP PP Sbjct: 89 PPVVRPPPVVVRPPPIIRPPPVVYPPPIVRPPPITRPP 126 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +1 Query: 787 PPXI-PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP I P P PPP PP PP PP PP P Sbjct: 102 PPIIRPPPVVYPPPIVRPPPIT--RPPIIIPPIQPPPVTTP 140 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 P I P PPP P PP PP PP PP P Sbjct: 125 PPIIIPPIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLP 165 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP + P PP P PP PP PP PP P Sbjct: 134 PPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLP 175 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPR-PXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPPXXP 906 PP I R P PP P P PP PP PP PP P Sbjct: 119 PPPITRPPIIIPPIQP-PPVTTPPGLLPPITTPPGLLPPVTTP 160 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/35 (48%), Positives = 18/35 (51%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG GGG G GG G GG G G G G G+ G Sbjct: 70 GGCGGGGDG-GGCDGDAGGGDGGGCGGCGGCGVCG 103 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG GG GG G GG Sbjct: 70 GGCGGGGDGGGCDGDAGGGDGGGCGGCGG 98 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 3/37 (8%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPP---XPXPPPXXPPP 897 + R PPP P PP PP P P P PPP Sbjct: 292 VQRETSTPPPIETKTPPLPPPPPTLTQPHPKPLTPPP 328 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P P P PP PP P P PP PP P Sbjct: 86 PPVKPPVYPPTKAPVKPPTKPPVKP-PVSPPAKPPVKPP 123 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P P P PP PP P P PP PP P Sbjct: 158 PPVKPPVYPPTKAPVKPPTKPPVKP-PVSPPAKPPVKPP 195 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP PP P P PP PP P Sbjct: 94 PPTKAPVKPPTKPPVKPPVSPPAKP-PVKPPVYPPTKAP 131 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P PP PP P P PP PP P Sbjct: 166 PPTKAPVKPPTKPPVKPPVSPPAKP-PVKPPVYPPTKAP 203 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 P + P P P PP PP P PP P PP P Sbjct: 118 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKP 158 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 P + P P P PP PP P PP P PP P Sbjct: 138 PPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKP 178 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P + P P P PP PP P P PP PP Sbjct: 190 PPVKPPVYPPTKAPVKPPVSPPTKP-PVTPPVYPP 223 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXP--PPXXPPPXXP 906 PP P P P P PP PP PP P PP PP P Sbjct: 122 PPVYP-PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXP--PPXXPPPXXP 906 PP P P P P PP PP PP P PP PP P Sbjct: 142 PPVYP-PTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXP--PPXXPPPXXP 906 PP P P P P PP PP PP P PP PP P Sbjct: 174 PPTKP-PVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 P P P P PP PP P PP P PP P Sbjct: 66 PPAKSPVKPPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKP 106 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + P P P PP PP P PP PP P Sbjct: 74 PPVKAPVSPPAKPPVKPPVYPP-TKAPVKPPTKPPVKPP 111 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPX-PPXPXP--PPXXPPPXXP 906 PP P P P P PP PP PP P PP PP P Sbjct: 102 PPTKP-PVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP 143 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P P P PP PP P Sbjct: 60 PHPHPHPPAKSPVKPPVKAPVSP-PAKPPVKPPVYPP 95 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP PP P Sbjct: 82 PPAKP-PVKPPVYPPTKAPVKPPTKP-PVKPPVSPPAKPP 119 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 802 RPXXXPP-PXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 +P PP P PP PP P PP P PP P Sbjct: 101 KPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKP 138 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP PP P Sbjct: 114 PPAKP-PVKPPVYPPTKAPVKPPTKP-PVKPPVYPPTKAP 151 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP PP P Sbjct: 134 PPTKP-PVKPPVYPPTKAPVKPPTKP-PVKPPVYPPTKAP 171 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP PP P Sbjct: 154 PPTKP-PVKPPVYPPTKAPVKPPTKP-PVKPPVSPPAKPP 191 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +1 Query: 802 RPXXXPP-PXPXXPPXXPPXPPXPXPPPXXP--PPXXP 906 +P PP P PP PP P PP P PP P Sbjct: 173 KPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPVSP 210 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P PP P P PP PP P Sbjct: 186 PPAKP-PVKPPVYPPTKAPVKPPVSP-PTKPPVTPPVYPP 223 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P PP PP P Sbjct: 52 PPHHHHPHPHPHPHPPAKSPVKPPVKAPVSPPAKPPVKPP 91 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 33.1 bits (72), Expect = 0.26 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 I +P P P PP P PP P PPP Sbjct: 13 ITKPFKKPKNRPPSPPPPLPLPPSPSPPP 41 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P PP PP P PP PPP Sbjct: 16 PFKKPKNRPPSPP-PPLPLPPSPSPPP 41 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPPXPXPPPXXPP 894 P P+P P P P P P P P P P P PP Sbjct: 40 PSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPP 76 Score = 31.5 bits (68), Expect = 0.79 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXP 891 P +P P P P P P P P P P PP P Sbjct: 44 PKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPPRTP 79 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 +P P P P P P P P P P P P P Sbjct: 39 VPSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTP 75 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P Sbjct: 32 PSPKHKPVPSP-KPKPVPSPKPKPVPSPSVPSPSVP 66 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 T PP P P PPP P P P P P P P P P Sbjct: 52 TSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTP 96 Score = 32.3 bits (70), Expect = 0.45 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXP 870 PPP P PP PP PP P Sbjct: 217 PPPKPPSPPRKPPPPPPP 234 Score = 31.9 bits (69), Expect = 0.60 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPP 894 PP PP PP PPP PP Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P +P+P P P P P P P P PP P Sbjct: 75 PPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPPNTP 113 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 787 PPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPP-XXPPPXXP 906 PP PPP P P PP PP PP P P P Sbjct: 44 PPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP 85 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP--PXPPXPXPP--PXXPP 894 PP P P PP P P P P PP P P P PP Sbjct: 65 PPPSP-PGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPP 103 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPP--PXPPSXXPPPP 902 PA PP P PPP P PPS PP P Sbjct: 29 PAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP 69 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP PP P PP PPP P Sbjct: 34 PPPTTTPSSPPPSPSTNSTSPPPSSPL---PPSLPPPSPP 70 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 4/40 (10%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXP----PXPPXPXPPPXXPPPXXP 906 P P P P P PP P P PPP P P Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPP 44 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 3/39 (7%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPP--XPXPPPXXP-PPXXP 906 P P PP P PP P PPP P PP P Sbjct: 27 PPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLP 65 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/18 (61%), Positives = 11/18 (61%), Gaps = 2/18 (11%) Frame = +1 Query: 850 PPXPPXP--XPPPXXPPP 897 PP PP P PPP PPP Sbjct: 218 PPKPPSPPRKPPPPPPPP 235 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 GG G G GG GG G GGG G G G Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 896 GGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXG 804 GGG G G G G G GG G G GGG G Sbjct: 144 GGGSHGHGCGGGGGGGGGGLGGGGCGGGGCGG 175 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG GGG G GG GG Sbjct: 157 GGGGGGLGGGGCGGGGCGG 175 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 896 GGGXXGGGXG-XGGXGGXXGGXXGXGGG 816 GGG GGG G GG GG GG G GG Sbjct: 21 GGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 893 GGXXGGGXG--XGGXG--GXXGGXXGXGGGXXXG 804 GG GGG G GG G G GG G GGG G Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGGGRFGG 48 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -1 Query: 897 GGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 GG RGG GG G G GGG G GR Sbjct: 9 GGFRGRGGRDGGGGGRFGGGGGRFGGGGGRFGGGGGR 45 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAG 799 G GGG RGG G GG G G G GG G Sbjct: 4 GGCGGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPG 39 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G G G G GGG G G G Sbjct: 77 GPRPGG--GGGPGPGPWSGPRGPRPGGGGGPGSGCGSGTG 114 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P P PP PPS P P Sbjct: 103 PPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRP 137 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 6/42 (14%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP------XPPXPXPPPXXPP 894 P IP P P P PP PP P P PPP PP Sbjct: 32 PSLIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPP 896 P PPP PP P PPP PP+ P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Frame = +1 Query: 805 PXXXPPPXPXXPPXX------PPXPPXPXPPPXXPPP 897 P PPP P PP PP PP P PP P Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPPTSVTP 78 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P P P P P P P P P P P PP Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P P P P P P P P P P P P P PP Sbjct: 297 PAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPP 334 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPPXXPPPXXP 906 P P P P P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PPP PP P P PPP P P Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSP 907 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 PP P PPP PP PP PPP P Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +1 Query: 787 PPXI--PRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPP 894 PP + P P PPP P PP PP P P P PP Sbjct: 873 PPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLPP 911 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP P P PP P PP PPPP Sbjct: 848 PPPLGHSLPSVLQPPLQPQSQPPEP-PPEMMPPPP 881 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXP---PPXXPPP 897 PP P+ PP PP PP P P PP PPP Sbjct: 861 PPLQPQSQPPEPPPEMMPPPPQALPP-PLPHSHPPLVPPP 899 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = +1 Query: 790 PXIPRPXXXP---PPXPXXPPXXPPXPPXPXPP--PXXPPPXXP 906 P + +P P PP P PP P PP PP P PP P Sbjct: 856 PSVLQPPLQPQSQPPEP--PPEMMPPPPQALPPPLPHSHPPLVP 897 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPP------PXXPPP 897 P P PPP P P PP P PP P PPP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 5/36 (13%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXP-----XPPPXXPPP 897 P PPP P PP PP P P P PPP Sbjct: 244 PPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 823 PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP PP P PPP P Sbjct: 239 PDPTPPP--PPPPPIPVKQSATPPPPPP 264 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP IP PP P P P P PPP Sbjct: 248 PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 7/42 (16%) Frame = +1 Query: 802 RPXXXPPPXPXXP-PXXPPXPPXPXPPP------XXPPPXXP 906 +P PPP P P P P P PPP PPP P Sbjct: 238 KPDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +3 Query: 801 PPXXXXPPXXXXXXXXPXXXPPPPXP---PSXXPPPP 902 PP PP P PPP PS PPPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP PP P P PPP PPP P Sbjct: 262 PPNRPPPPSSP-PPPPPPPPTPP 283 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPP 882 PP PP PP PP P P P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTP 282 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PP P P PP PP P PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPP 894 P P P PP P PPP PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP 852 PP P P PPP P PP P Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXG 828 G GGG GGG GG GG GG G Sbjct: 124 GTIGGGGQGGGGQGGGGGGAEGGTTG 149 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP P PPPP Sbjct: 61 PYGNPPPPSPQYSPPPPP 78 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P + R P P P PP PP PP P P Sbjct: 54 PRLQRYSPYGNPPPPSPQYSPPPPPSQSSPPRSRCPPVP 92 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 32.7 bits (71), Expect = 0.34 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXP-XXPPXXPPXPPXPXPPPXXPP 894 P P+P P P P PP P P P P P PP Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPP 68 Score = 32.7 bits (71), Expect = 0.34 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P P PP P P P P P Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTP 67 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/36 (36%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXP-PXXPPXPPXPXPPPXXP 891 P +P P P P P P P P P PP P Sbjct: 36 PKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG GGG G GG GG GG Sbjct: 196 GGGFGGGGSGFGGGGGGGGG 215 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 10/50 (20%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP------XPXPP----PXXPPPXXP 906 P I P PP P PP P PP P PP P PPP P Sbjct: 102 PAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAP 151 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP + PPP P PP P PP PP Sbjct: 126 PPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPP 161 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P PP P P PPP PP Sbjct: 101 PPAPIVNPNPPP-PSTPNPPPEFSPP 125 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPP--XPPXPXPPPXXPPP 897 T P P P P P P P PP PP P PP Sbjct: 95 TSISPNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPP 136 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 9/49 (18%) Frame = +1 Query: 787 PPXIPRPXXX--PPPXPXXPPXXPPXP----PXPXPPP---XXPPPXXP 906 PP P P PPP PP P P P PPP PP P Sbjct: 112 PPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTP 160 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 32.7 bits (71), Expect = 0.34 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PPS PPPP Sbjct: 107 PPPPPPPSPSPPPP 120 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP I RP PP P P PP PP PP Sbjct: 151 PPQIIRPPGQMPPQPPFAGQGGPPPPYGMRPPYPGPP 187 >At5g17830.1 68418.m02090 hypothetical protein contains Pfam domain, PF04515: Protein of unknown function, DUF580 Length = 474 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -2 Query: 476 YSCLYVCDTIVDISAVFXSWRLSSIPVSLFLSLVSQSHP 360 ++C +VC+ + A F L +I V LFL L+ +S+P Sbjct: 109 WNCFFVCNIRATVKATFWFTPLFTISVGLFLILLDKSNP 147 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 32.3 bits (70), Expect = 0.45 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPX-PPPXXPPPXXP 906 P P PP PP PP P PP PPP P Sbjct: 296 PYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQP 335 Score = 31.9 bits (69), Expect = 0.60 Identities = 21/68 (30%), Positives = 23/68 (33%), Gaps = 5/68 (7%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXPXXP----PXXPPXPPXPXPP-P 882 PT+ Y P PP P+ PPP P P PP P PP P Sbjct: 308 PTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHPSGYNPEEPPYPQQSYPPNP 367 Query: 883 XXPPPXXP 906 PP P Sbjct: 368 PRQPPSHP 375 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/61 (31%), Positives = 21/61 (34%), Gaps = 2/61 (3%) Frame = +1 Query: 718 PTLXXYYXPXLXXXXXXXXXTXXPPXIPRPXXXPPPXP--XXPPXXPPXPPXPXPPPXXP 891 P L + P + PP I P PPP PP PP P P P P Sbjct: 284 PQLPNQFSPQQEPYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPP-PQQPQYPQQPP 342 Query: 892 P 894 P Sbjct: 343 P 343 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPPP 897 PP +P PPP P PP P P P P PPP Sbjct: 306 PPPTIQPPYQPPP-PTQSLHQPPYQPPPQQPQYPQQPPP 343 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P +P P P PP PP PP PPP Sbjct: 284 PQLPNQFS-PQQEPYFPPSGQSQPPPTIQPPYQPPP 318 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP + P P P P P P PP PP P Sbjct: 342 PPQLQHPSGYNPEEPPYPQQSYPPNPPRQPPSHPPPGSAP 381 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GGG G G GG GG G G G GG Sbjct: 141 GDKPGGASGGGPG-GASGGASGGASGGASGGASGGASGGG 179 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG GG GG G G G G GG Sbjct: 165 GGASGGASGGASG-GGPGGASGGGPGGASGGGPG-GASGG 202 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXG--GGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG G GG G GG GG G G G GG Sbjct: 146 GASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGG 187 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G G GG GG G G G GG Sbjct: 157 GGASGGASGGASG-GASGGASGGGPGGASGGGPGGASGGG 195 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG GG G GG GG GG G G G G GG Sbjct: 140 GGDKPGGASG-GGPGGASGGASGGASGGASG-GASGG 174 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 5/42 (11%) Frame = +1 Query: 787 PPXIP--RPXXXPPPXPXX-PPXXPPXPPXPXPP--PXXPPP 897 PP P +P PP P PP PP P PP P PPP Sbjct: 31 PPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPP 72 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIP--RPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P +P PP P PP PP PP P P P P P Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTPP-PSQSPSQPSPLPP 84 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIP--RPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 PP P +P PP P PP PP P P PP PP P Sbjct: 35 PPIQPSSQPPTQPPSQPPTQPPTQPPSHP-PTQPPTPPPSQSP 76 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 RP PP P P P P PP PP P Sbjct: 26 RPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP 60 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +1 Query: 802 RPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 +P PP P PP PP P P PP PP P Sbjct: 30 QPPSHPPIQPSSQPPTQPPSQP-PTQPPTQPPSHPP 64 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP P P P PP PP P Sbjct: 24 PTRPPSQPPSHPPIQPSSQP-PTQPPSQPPTQPP 56 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 32.3 bits (70), Expect = 0.45 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P P PPP P P Sbjct: 104 PKRPPPPPPKPQPPPPPPRSQKPMQP 129 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 802 RPXXXPPPXPX-XPPXXPPXPPXPXPPP 882 +P PPP P PP PP P PP Sbjct: 103 KPKRPPPPPPKPQPPPPPPRSQKPMQPP 130 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G G GG G G GGG G G GG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GG G G GG G G GGG R I Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGGDSQRSI 56 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G G G G G G GG G GGG G Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGGSGGGGGGG 49 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 32.3 bits (70), Expect = 0.45 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP PP P P PPP P Sbjct: 230 PPPPP--PPPHQAQPPPPPPSGLFPPPPPP 257 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPP 882 P PPP PP PP P PPP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPP 256 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXG-GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G GGG G G GG G GGG G + GG Sbjct: 136 GPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGG 176 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 893 GGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G GG G G G GGG G + GG Sbjct: 164 GGGAGAGSALGGGGAGAGPALG-GGGAGAGPALGGG 198 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 901 GGGGXXEG-GXGGGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG G GGGG G G GGG AG Sbjct: 174 GGGGAGAGPALGGGGAGAGPALGGGVAGSGSALGGGASAG 213 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GGG +GG G GG G G GG GG G G Sbjct: 45 GDNGGGRYQGGGGHGGHG--GGGYQGGGGRYQGGGGRQG 81 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G G G GGG GG G GG GGG Sbjct: 54 GGGGHGGHGGGGYQGGGGRYQGGGGRQGGG 83 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXGR 787 G GG GG G GG G GGG GG G R Sbjct: 50 GRYQGGGGHGGHGGGGY-QGGGGRYQGGGGRQGGGGSYCR 88 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 GGG G G G G GG G G G G GRG GG Sbjct: 487 GGGGFGRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGG 524 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G G G G GG G G G GRG G Sbjct: 494 GNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRGRFG 529 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 905 GXXGG-GXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G G G G G GG G G GGG RG Sbjct: 505 GRDGGRGRFGSGGGRGRDGGR--GRFGSGGGRGSDRG 539 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP--XXPPPXXP 906 PP P PPP P PP P P PPP PPP P Sbjct: 130 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPP 174 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 122 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 90 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 142 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 150 PPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPP 192 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 160 PPPPPYVYSPPPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 180 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 232 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 200 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 252 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 220 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 272 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 240 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 250 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 292 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 260 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPP 322 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 290 PPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPP 332 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 300 PPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPP 342 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPP 897 PP P PPP P PP P PP PPP Sbjct: 330 PPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPPYVYKPPP 369 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P PP PPP Sbjct: 310 PPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPP--PPP 344 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 4/64 (6%) Frame = +3 Query: 723 PXXXLSSYXXPXXVXXLXXXXPAXY----PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXX 890 P SS P V P Y PPP PP PPPP S Sbjct: 133 PPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSP--PPPPYVYSSP 190 Query: 891 PPPP 902 PPPP Sbjct: 191 PPPP 194 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP------PXPXPPPXXPPP 897 PP P PPP P PP P P P P PPP Sbjct: 320 PPPPPYVYTSPPPPPYVYKSPPPPPYVDSYSPPPAPYVYKPPP 362 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PPP P PP PP P PP Sbjct: 170 PPPPPYVYQSPPPPPYVYSSPPP-PPYVYKSPPPPP 204 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPX-PXPPPXXPPPXXP 906 IPRP PP PP P P PPP PP P Sbjct: 637 IPRPYGQLPPSAMGMMQPPPMPGMAPPPPPEEAPPPLP 674 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXP-PXPP-----XPXPPPXXPPPXXP 906 P P P PPP P P P P PP P PPP P P Sbjct: 536 PNSFPGPAALPPPRPGVPIVRPLPPPPNLALNLPRPPPSAQYPGAP 581 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 32.3 bits (70), Expect = 0.45 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPP------XPXPPPXXPPPXXP 906 P P P PPP P P P PP P PPP P P Sbjct: 524 PNSFPGPAAFPPPRPGVPTVRPLPPPQNLALNLPRPPPSVQYPGAP 569 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P P PP P PP PP PPP Sbjct: 625 PQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPP 659 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 +P+P PP PP P PPP PPP Sbjct: 624 VPQPYGQLPPLSMGMMQPPPMAEMPPPPPPGEAPPP 659 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG G G G G GG G G G G G G+ G Sbjct: 41 GGGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLG 77 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = -1 Query: 897 GGGXXRGGXGXG-GXGXXXGXXXXXGGGXXGGAG 799 GGG GG G G G G G GGG GGAG Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLG-GGGFGGGAG 86 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXG-GGXXGGAGDXGRXXSXXXG 766 G GGG RGG GG G G G G G +G GR G Sbjct: 7 GGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRG 54 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPP 82 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP 100 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPP 118 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPP 109 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP 127 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPP 136 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPP 145 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP 154 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PPP P PP P PP PP P Sbjct: 134 PPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPPP 173 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP--XXPPP 897 PP P PPP P PP P PPP PPP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP P P PP PP P Sbjct: 45 PPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP P P PP PP P Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 93 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP P P PP PP P Sbjct: 63 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP P P PP PP P Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPP 111 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP PPP PP P P PP PP P Sbjct: 99 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP---XXPPPXXP 906 PP P PPP P PP P PPP PPP P Sbjct: 143 PPPPPVLLSPPPPPVLFSP-PPPTVTRPPPPPTITRSPPPPRP 184 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 799 PRPXXXPPPXPXX-PPXXPPXPPXPXPPPXXPPPXXP 906 P P PPP P PP P P PPP P P Sbjct: 559 PPPTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQEP 595 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPPP P PP Sbjct: 566 PPPPLAKPPHVVERLPLP---PPPPIAPEEQEPP 596 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P PP P PPP P P Sbjct: 357 PIQFPASPPSQFPLPPPPPPPPPSPSTSSP 386 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P PP PP P P PP Sbjct: 357 PIQFPASPPSQFPLPPPPPPPPPSPSTSSPP 387 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GGG GG G G G GG G GG Sbjct: 528 GRSGGGSYGGYGGSSGRSGGGGGSYGGSGG 557 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG GGG GG G G G GG G Sbjct: 503 GARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYG 536 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG G G GG G G GR GG Sbjct: 508 GSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGG 549 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P P P P P P PP PP P PP P Sbjct: 96 PWPAPSPSPFPNGGPIESPAYPPAPPRPIPPHLRRP 131 Score = 25.4 bits (53), Expect(2) = 4.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPP 882 P P P PP P PPP Sbjct: 418 PINVPNSQPRPPPPPPPP 435 Score = 21.8 bits (44), Expect(2) = 4.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 Query: 817 PPPXPXXPPXXP 852 PPP P PP P Sbjct: 368 PPPPPPPPPPLP 379 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG G G G GGG Sbjct: 12 GGG--GGGCGGGGSSGGGGSSGGGGGG 36 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGG 819 GGG GGG GG G GG G G Sbjct: 14 GGGGCGGGGSSGGGGSSGGGGGGPCG 39 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG G GG G GG G GG G G Sbjct: 3 GGGNTITAVGGGGGGCGGGGSSGGGGSSGGGGG 35 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -2 Query: 905 GXXGGGXXGGG--XGXGGXGGXXGGXXG 828 G GGG GGG G G GG GG G Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGGPCG 39 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 31.9 bits (69), Expect = 0.60 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPX-PXPPP 882 PPP P P PP PP P PPP Sbjct: 80 PPPPPHLLPLSPPLPPLLPLPPP 102 >At1g32360.1 68414.m03989 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 384 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 G GGG GGG GG G GGG G GI Sbjct: 217 GSGGGGGSGGGSVGGGGSSSNVVVLGGGGGSGSGSGI 253 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 G GG G G G G GG GGG G G Sbjct: 215 GYGSGGGGGSGGGSVGGGGSSSNVVVLGGGGGSGSG 250 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP 876 IP P PPP P PP PP P P Sbjct: 97 IPPPQPPPPPQPLNLFSPPPPPPPPDP 123 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 4/24 (16%) Frame = +1 Query: 838 PPXXPPXPPXP----XPPPXXPPP 897 PP PP PP P PPP PPP Sbjct: 98 PPPQPPPPPQPLNLFSPPPPPPPP 121 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP P P PPP P P Sbjct: 98 PPPQPPPPPQ-PLNLFSPPPPPPPPDP 123 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 31.5 bits (68), Expect = 0.79 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 RP P P PP PP P PPP P Sbjct: 153 RPSSPDLPPPHFPPEFPPETPTTPPPPPPRP 183 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP 870 P +P P P P P PP PP P Sbjct: 157 PDLPPPHFPPEFPPETPTTPPPPPPRP 183 >At4g34150.1 68417.m04846 C2 domain-containing protein similar to calcium-dependent protein kinase [Dunaliella tertiolecta] GI:6644464; contains Pfam profile PF00168: C2 domain Length = 247 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = +1 Query: 799 PRPXXXPPP----XPXXPPXXPPXPPXPXPPPXXPPP 897 P+P PPP P P PP PP PP PP Sbjct: 192 PQPSAYPPPSTSGYPPIPSAYPPPPPSSAYPPQPYPP 228 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P IP PPP PP P PP P P P P Sbjct: 206 PPIPSAYPPPPPSSAYPP--QPYPPQPSYYPQGPYP 239 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 7/46 (15%) Frame = +3 Query: 786 PAXYPP-------PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 P+ YPP P PP P PPPP P S PP P Sbjct: 181 PSGYPPASGYPPQPSAYPPPSTSGYPPIPSAYPPPP-PSSAYPPQP 225 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-PXPXPPP 882 PP P P P P P P P P PPP Sbjct: 213 PPPPPSSAYPPQPYPPQPSYYPQGPYPGQYPPP 245 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 13/50 (26%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-------------PPXPPXPXPPPXXPPP 897 PP P P PPP PP PP PP P PPP PP Sbjct: 120 PP--PPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 13/47 (27%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPX-------------PPXPXPPPXXPPPXXP 906 P PPP P P PP PP P PPP PP P Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITP 166 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXP 893 P PPP PP PPPP P + P Sbjct: 155 PPPPPPPPTITPPVTTTTTGHHHHRPPPPPPATTTP 190 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP +PRP PP PP P P P PPP Sbjct: 96 PPVLPRPMM--PPQGYMPPPGVPQMMAPPGAPLPPPP 130 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G G GG G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 GGG GGG G GG GG G G G+ Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGV 607 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G GG G G G GGG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGX-GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G G G GGG GG Sbjct: 63 GGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG G G GGG G G Sbjct: 62 GGGGASGG-GYRNDGGRTGYGYGAGGGGGGGGG 93 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G G GG G G Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGGYGGAPSGGYG 604 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGI 795 GGG GGG G GG GG G G G+ Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAGV 607 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GGG G GG G G G GGG G Sbjct: 567 GSYSRGGGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = -2 Query: 896 GGGXXGGGX-GXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GGG GGG GG G G G GGG GG Sbjct: 63 GGGASGGGYRNDGGRTGYGYGAGGGGGGGGGWNNRSGG 100 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GG G GG G G GGG G G Sbjct: 62 GGGGASGG-GYRNDGGRTGYGYGAGGGGGGGGG 93 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PPP P PP PP P PP Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYKSPPPPP 100 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 PP P PPP P PP PP P PP Sbjct: 55 PPPSPYLYSSPPPPPYVYNSPPPPPPYIYNSPPRPP 90 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 790 PXIPRPXXX--PPPXPXXPPXXPPXPPXPXPPPXXPP 894 P +P P PPP P PP P PP PP Sbjct: 44 PPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPP 80 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 6/44 (13%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPPPP------XPPSXXPPP 899 PA YPPP PP P PPP P PPP Sbjct: 508 PAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPPP 551 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPPXXXXXXXXPXXXPP--PPXPPSXXPPPP 902 PA YPPP P P PP P PPPP Sbjct: 529 PAGYPPPQQGYGQGYPAQGYPPPQYPQGHPPQYPYQGPPPP 569 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 P P P PPP P P P P P PPP Sbjct: 27 PSPEPPPSPEPPPSPEKPTS-PEQPSSPEPPP 57 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP--PXXPP 894 PP P P PPP P PP P P P P P PP Sbjct: 22 PPEKP-PSPEPPPSPEPPPS-PEKPTSPEQPSSPEPPP 57 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 802 RPXXXPP-PXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 RP PP P P P PP P P P P P Sbjct: 21 RPPEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P P P P P P P P P P PPP Sbjct: 23 PEKPPSPEPPPSPEPPPSPEKPTSPEQPSSP--EPPP 57 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP 876 P + P PPP P P P PP P P Sbjct: 115 PQLYNPTICPPPPPPYPRQVHPQPPAPPP 143 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 73 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP 89 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 95 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 129 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 127 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPPP Sbjct: 71 PPPVYKSPPPPVKYYSPPPVYKSPPPPVYKSPPPP 105 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 73 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 55 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKYYSPPP 89 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 95 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 129 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 111 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 145 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PP P PPP Sbjct: 127 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPP 161 >At1g30780.1 68414.m03763 F-box family protein Length = 482 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXP-XPPPXXP 891 P PPP P P PP P P PPP P Sbjct: 63 PSFQEAVAPPPPPPDLPLLAPPLPDVPLLPPPAFP 97 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGG 816 GGG GGG G GG G GG GGG Sbjct: 65 GGG--GGGGGRGGGGARSGGRSRGGGG 89 >At5g66400.1 68418.m08374 dehydrin (RAB18) nearly identical to SP|P30185 Dehydrin Rab18 {Arabidopsis thaliana} Length = 186 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G G GGG GG G GG GG G G G Sbjct: 32 GGGGYGTGGGGGATGGQGYGTGGQGYGSGGQGYGTGGQG 70 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP PP P P PP P P Sbjct: 24 PAPSPTTTVTPPPVATPPPAATPAPTTTPPPAVSPAP 60 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP P P PP P P PP Sbjct: 34 PPPVATPPPAATPAPTTTP-PPAVSPAPTSSPP 65 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 829 PXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP PP P P PPP PP P Sbjct: 241 PSSPPQQPPATPPPPPPP--PPVEVP 264 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 838 PPXXPPXPPXPXPPP 882 PP PP PP P PPP Sbjct: 381 PPPSPPPPPPPPPPP 395 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP PPP P Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP PP PPP P P Sbjct: 241 PSSPPQQPPATPPPPP---PPPPVEVPQKP 267 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPPXPXP 876 + +P P P PP PP PP P Sbjct: 238 VVKPSSPPQQPPATPPPPPPPPPVEVP 264 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP P PP PP PP P P PP Sbjct: 296 PPPSP--PP--PPPPPPPQPLIAATPP 318 Score = 27.9 bits (59), Expect = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 864 PPPXPPSXXPPPP 902 PPP PP PPPP Sbjct: 296 PPPSPPPPPPPPP 308 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPP 897 PP PP PP P PP PP Sbjct: 561 PPIAPPGPPAPQPPTQGYPP 580 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 838 PPXXPPXPPXPXPPPXXPPP 897 PP PP PP P PP PP Sbjct: 561 PPIAPPGPPAPQPPTQGYPP 580 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 805 PXXXPPPXPXXP--PXXPPXPPXPXPPPXXPP 894 P PPP P PP P P PPP PP Sbjct: 407 PTLPPPPVIEITRDPSPPPSPVQPPPPPSPPP 438 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXP 870 PPP P PP P PP P Sbjct: 423 PPPSPVQPPPPPSPPPQP 440 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXP 891 P +P P PP P PP P PP P Sbjct: 407 PTLPPPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXP-PPXXP 906 PPP P PP P PP P PP P Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPPPQP 440 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PPP PP PP P P PPP Sbjct: 377 PPPYTYSPPPYAYSPPPPCPDVYKPPP 403 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/55 (29%), Positives = 17/55 (30%), Gaps = 1/55 (1%) Frame = +3 Query: 741 SYXXPXXVXXLXXXXPAXY-PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 +Y P P Y PPP P P PP P PPPP Sbjct: 381 TYSPPPYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPPSPSYSYSSPPPP 435 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXP--XXPPXXPPXPPXP---XPPPXXPPP 897 T PP P PPP P PP P P PPP PPP Sbjct: 381 TYSPP--PYAYSPPPPCPDVYKPPPYVYSSPPPYVYNPPPSSPPP 423 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 427 PPPPPPPPPPPPPP 440 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP P PPP PPP Sbjct: 427 PPPPPPPPPPP--PPP 440 >At3g59640.1 68416.m06654 glycine-rich protein Length = 246 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXG 822 G GGG GG G GG G GG G Sbjct: 127 GGGGGGRNGGNNGSGGSSGEDGGLASFG 154 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 44 PPPPPPPRPPPPPP 57 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP P PPP PPP Sbjct: 44 PPPPPPPRPPP--PPP 57 >At2g41420.1 68415.m05111 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 98 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 3/41 (7%) Frame = +3 Query: 786 PAXYPP---PXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 P YPP P PP P PPP P PPP Sbjct: 29 PQGYPPQGYPQQGYPPQGYPQQGYPQQGYPPPYAPQYPPPP 69 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPP 882 PP P P PP P PP PP P P Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXP-PXPXPPPXXPPP 897 P PPP P P P P P PP P P Sbjct: 194 PPPPPPPTPRPPRLLSSQPAPPPTPPVSLPSP 225 >At1g74720.1 68414.m08658 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1081 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGG 837 G GGG GGG G GG GG G Sbjct: 609 GEGGGGGGGGGPGGGGGGGPYCG 631 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 247 PPPPPPPPPPPPPP 260 Score = 30.7 bits (66), Expect = 1.4 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 248 PPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 838 PPXXPPXPPXPXPPP 882 PP PP PP P PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 850 PPXPPXPXPPPXXPP 894 PP PP P PPP PP Sbjct: 247 PPPPPPPPPPPPPPP 261 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 853 PXPPXPXPPPXXPPP 897 P PP P PPP PPP Sbjct: 247 PPPPPPPPPPPPPPP 261 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P PP P PP P P P P PP P Sbjct: 26 PRAAPPARPTTPPPARPTTPPPVWPTTPPPAGAP 59 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPP 879 RP PPP PP PP PP P P Sbjct: 20 RPPPAPPPESSSPP-TPPEPPDPPDP 44 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPP 882 PPP P PP PP P PP Sbjct: 21 PPPAPPPESSSPPTPPEPPDPP 42 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP 861 PP P P PP P PP PP P Sbjct: 21 PPPAPPPESSSPPTPPEPP-DPPDP 44 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPX-PXXPPXXPPXPPXPXPPPXXP-PPXXP 906 T PP P PPP P P PP P P P PP P Sbjct: 164 TNSPPASPLDPTNPPPIQPSGPATSPPANPNAPPSPFPTVPPKTP 208 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPP---PXXPPP 897 T PP P PP PP PP PP P PPP Sbjct: 19 TAPPPETPSENSALPPVDSSPP-SPPADSSSTPPLSEPSTPPP 60 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/38 (34%), Positives = 14/38 (36%), Gaps = 2/38 (5%) Frame = +1 Query: 790 PXIPRPXXXPPPX--PXXPPXXPPXPPXPXPPPXXPPP 897 P + P PP P P PP P PP PP Sbjct: 50 PPLSEPSTPPPDSQLPPLPSILPPLTDSPPPPSDSSPP 87 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P PP P P P P PP P Sbjct: 134 PPSSPSPNVGPT-NPESPPLQSP-PAPPASDPTNSPPASP 171 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPR--PXXXPPPXPXXP--PXXPPXPPXPXPPPXXPPP 897 T P +PR P PP P P P P P P PP PP Sbjct: 261 THRAPPVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPPLVWSPP 304 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PPP P P PP PP P P Sbjct: 249 PP--PPPVVDPPPATHRAPPVPRIPPVSGVPPAPFAPFAP 286 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG GGG GG GG GG Sbjct: 8 GGGGGGGGGSGGGIGGGGGG 27 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG G G G GG GG Sbjct: 8 GGGGGGGGGSGGGIGGGGG 26 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXG 852 G GGG GGG G GG G Sbjct: 10 GGGGGGGSGGGIGGGGGG 27 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +3 Query: 786 PAXYPPPXXXXPP--XXXXXXXXPXXXPPPPXPPSXXPPPP 902 PA YPPP P P PP PP PP P Sbjct: 18 PAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAP 58 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 4/38 (10%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXP----PXPPXPXPPPXXPPPXXP 906 P PPP P P P PP PP PP P Sbjct: 18 PAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYP 55 >At5g25425.1 68418.m03017 glycine-rich protein Length = 113 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGG 849 G GGG GGG G GG GG Sbjct: 37 GGRGGGGRGGGKGRGGRGG 55 >At5g13760.1 68418.m01604 expressed protein similar to unknown protein (gb AAF63775.1) Length = 569 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 778 TXXPPXIPRPXXX----PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP + +P PPP P P P P P PPP Sbjct: 71 TPPPPNLAQPLRSSSRQPPPPPPRPQTPPTFVPEETQPQTPPPP 114 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXG 804 G GG GGG G GG G G GGG G Sbjct: 720 GGCGGCGGGGGCGGGGRCGGMTKIEGCGGGSCTG 753 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 G GGG GGG GG G G G G G GG Sbjct: 724 GCGGGGGCGGGGRCGGMTKIEGCGGGSCTGGSTGCGNCGG 763 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 817 PPPXPXXPPXXP-PXPPXPXPPPXXPPP 897 P P P PP P P PP P PPP Sbjct: 43 PNPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +1 Query: 790 PXIPRPXXXPPP-XPXXPPXXPPXPPXPXPP 879 P P P PPP P PP P P PP Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPP 70 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 +P PPP P P PP P PP PP Sbjct: 42 QPNPSPPPPPSNPSPPPPSPTTTACPP--PP 70 >At3g49300.1 68416.m05388 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 86 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PP PPPP Sbjct: 70 PPPPPPPLSPPPPP 83 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P P P P PPP PP P Sbjct: 54 PGPDPKHDPTKPGYGFPPPPPPPLSPPPPP 83 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 838 PPXXPPXPPXPXPPP 882 PP PP PP P PPP Sbjct: 201 PPQPPPHPPPPPPPP 215 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP PP P PPP PPP Sbjct: 201 PPQPP-PHPPPPPPPP 215 >At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam profile PF00397: WW domain Length = 863 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 T PP P PPP P PP PP P PPP Sbjct: 505 TDVPPP-PGEEWIPPP-PSESEDVPPPPPDSYSEPIPPPP 542 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 62 PPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 46 PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPP 80 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPP 112 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 94 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 128 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 110 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 144 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 126 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 160 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 142 PPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPP 176 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PPP PP P PPP PPPP Sbjct: 158 PPPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPP 192 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPXPPSXXPPPP 902 PP PP P PPPP PPPP Sbjct: 175 PPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPP 209 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 47 PPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPP 87 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 63 PPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPP 103 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 79 PPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPP 119 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 95 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 135 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 111 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 151 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 127 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 167 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 143 PPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPP 183 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 6/41 (14%) Frame = +3 Query: 798 PPPXXXXPPXXXXXXXXPXXXPPPPX------PPSXXPPPP 902 PP PP P PPPP PP PPPP Sbjct: 159 PPVKSPPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPP 199 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 P P PPP PP PP PPP PP Sbjct: 36 PPPPYEYKSPPPPVKSPP--PPYEYKSPPPPVKSPP 69 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Frame = +1 Query: 799 PRPXXXPPPX----PXXPPXXPPXPP----XPXPPPXXPPP 897 P P PPP PP P PP P PP PPP Sbjct: 46 PPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPP 86 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 798 PPPXXX--XPPXXXXXXXXPXXXPPPPXPPSXXPPP 899 PPP PP P PPPP S PPP Sbjct: 61 PPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPP 96 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Frame = +1 Query: 799 PRPXXXPPPX----PXXPPXXPPXPP----XPXPPPXXPPP 897 P P PPP PP P PP P PP PPP Sbjct: 78 PPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPP 118 >At2g27660.1 68415.m03352 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 718 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG GG G GG GG GG Sbjct: 695 GGGDANGGAGDGGGGGFFGG 714 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPP-XPPXPXPPPXXPPP 897 P IP P PPP P PP P P PPP Sbjct: 248 PVPIPAPRQPPPPPPQVYQTQPPSWPSQPQQHSMVPPP 285 >At1g77030.1 68414.m08970 glycine-rich protein Length = 349 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGG-XXGGAGDXG 790 G G G RGG G G G G GGG G + D G Sbjct: 206 GRGGRGGARGGRGGGARGGRGGSRDFGGGGRDFGSSSDRG 245 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -2 Query: 863 GGXGGXXGGXXGXGGGXXXGRG 798 GG GG G G GGG GRG Sbjct: 205 GGRGGRGGARGGRGGGARGGRG 226 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -1 Query: 906 GXXGGGXXRGGXGXGGXGXXXGXXXXXGGGXXGGAGDXG 790 G GG GG G GG G G GG GGAG G Sbjct: 113 GSGFGGRGFGGPG-GGYGASDGGYGAPAGGYGGGAGGYG 150 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGG---XGGXXGGXXGXGGGXXXGRGIXGG 786 G GG GG G GG G GG G GG G G GG Sbjct: 136 GAPAGGYGGGAGGYGGNSSYSGNAGGGGGYGGNSSYG-GNAGG 177 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGGXXVXKXXYXXXXXIG 741 GGG GG GG G GG G G G G Y +G Sbjct: 161 GGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVG 212 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -2 Query: 890 GXXGGGXGXGGXGGXXGGXXGXGGG-XXXGRGIXGG 786 G GGG G GG G G GG G + GG Sbjct: 157 GNAGGGGGYGGNSSYGGNAGGYGGNPPYSGNAVGGG 192 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 778 TXXPPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 T PP +P PP P PP PP P P PP P Sbjct: 165 TLSPPVYTKPTLPPPVYKKSPSYSPP-PPF-APKPTYTPPTKP 205 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP P P PPP PP P Sbjct: 25 PVTPVNTVRPPPSQPPPAPPPLPPPTYRP 53 >At3g46270.1 68416.m05008 receptor protein kinase-related contains weak similarity to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 470 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G G GG GGG G + GG Sbjct: 360 GGSGGKSGGGDNGGGGGQSGGGNNGGTNLKGG 391 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG 819 G GGG GGG G G GG GG GG Sbjct: 364 GKSGGGDNGGGGGQSG-GGNNGGTNLKGG 391 >At3g46240.1 68416.m05005 protein kinase-related similar to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 441 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXGG 786 GG G G G G G GG G G G GG Sbjct: 307 GGNETGSGSGSGSGGSGGGGSGSSGSGSGSGGTSKGG 343 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGGG 816 G GG GGG G G G GG G G Sbjct: 316 GSGSGGSGGGGSGSSGSGSGSGGTSKGGTG 345 >At3g24250.1 68416.m03044 glycine-rich protein Length = 137 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 881 GGGXGXGGXGGXXGGXXGXGGGXXXG 804 GG G GG GG G G GGG G Sbjct: 102 GGAGGLGGLGGAMGFPGGLGGGPSGG 127 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P P PP PP P P P PP P Sbjct: 285 PYCPPPSHPQPPPSNPPPYQAPQTQTPHQPSYQSPPQQP 323 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P P P P P PPP PPP Sbjct: 266 PPSSQLPPQLPTQFSSQQEPYCPPPSHPQPPPSNPPP 302 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPX--PXPPPXXPPPXXP 906 P +P P P P P P P P PP PPP P Sbjct: 155 PVMPPPQVPVMPPPQVPVKPHPKVPVISPDPPATLPPPKVP 195 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIP-RPXXXPPPXPXXPPXXPPXPPXPX----PPPXXPPPXXP 906 PP +P +P P PP P P P PP PPP P Sbjct: 167 PPQVPVKPHPKVPVISPDPPATLPPPKVPVISPDPPTTLPPPLVP 211 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -3 Query: 901 GGGGXXEGGXG----GGGXXXGXXXXXXXXGGXXXXGGG*XAG 785 GGGG +GG G GGG G GG GGG G Sbjct: 66 GGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGG 108 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = -1 Query: 897 GGGXXRGGXGX--GGXGXXXGXXXXXGGGXXGGA 802 GGG +GG G GG G G GGG GG+ Sbjct: 81 GGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGGS 114 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -1 Query: 897 GGGXXRGGXGX----GGXGXXXGXXXXXGGGXXGGAGDXG 790 GGG +GG G GG G GGG GG G G Sbjct: 74 GGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGG 113 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P PP P PP PP P P Sbjct: 226 PPPSPSAPPPRSP-PPKSSPPSSLPQTPSP 254 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 787 PPXIPRPXXXP---PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P IP P P PP P P P P PP PP P Sbjct: 23 PISIPNPNPNPSLTPPPPQQHSQPPVAPLVPPGPPYAPPAQIP 65 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXP----PPXXPPP 897 P P+ PP P PP P PP P P PPP Sbjct: 37 PPPPQQHSQPPVAPLVPPGPPYAPPAQIPSSLLPTNLPPP 76 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 360 PPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 402 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 70 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 90 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 130 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 182 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 150 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 202 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 170 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 222 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 190 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 242 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 210 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 262 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 230 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 282 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 250 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 302 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 270 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 322 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 290 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 342 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 350 PPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 392 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 370 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 422 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 420 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 102 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPP 122 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPP 142 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P PP PPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP--PPP 144 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 162 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P PP PPP Sbjct: 310 PPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPP--PPP 344 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 6/43 (13%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP---PXPXPPP---XXPPP 897 PP P PPP P PP P P PPP PPP Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPP 362 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PPP P PP P PP PPP Sbjct: 410 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPP--PPP 444 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXP-----PXPXPPPXXPPPXXP 906 PP P PPP P PP P P P P PP P Sbjct: 330 PPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPP 374 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +1 Query: 802 RPXXXPPPXPXXPPXXPPXPP-XPXPPPXXPPPXXP 906 R P P P P P P P P P PPP P Sbjct: 248 RDIEFPAPAPSIAPIVEPLPAIVPSPSPSSPPPPPP 283 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 799 PRPXXXPPPXPXXPPXXPPXPPXPXP 876 P P P P P PP PP PP P Sbjct: 265 PLPAIVPSPSPSSPP-PPPPPPVAAP 289 >At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 241 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRG 798 GGG GGG G GG G GGG +G Sbjct: 192 GGGGGGGGRVLIGGGGMTAASGGGGGGGVVMKG 224 >At5g62440.1 68418.m07837 expressed protein Length = 202 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGG 837 GGG GGG GG GG GG Sbjct: 179 GGGRGGGGGRRGGRGGGRGG 198 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 805 PXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P PP P PP P P PPP PP Sbjct: 45 PVQSSPPPPSPPP--PSTPTTACPPPPSPP 72 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P PP P PPP PP P Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPPPLQQP 82 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP PP PP P PPP P Sbjct: 56 PPACAITLKDSPPPPPPPPPPPPLQQP 82 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 790 PXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPP 894 P IP P P P P P P P P P PP Sbjct: 52 PSIPSPSVPTPSVPT-PSVPTPSVPSPNPTPVTPP 85 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +1 Query: 778 TXXPPXIPRPXXXPP--PXPXXPPXXPPXPPXPXP--PPXXPPPXXP 906 T P +P P P P P P P P P P P P P P Sbjct: 38 TVPSPKVPSPKYPSPSIPSPSVPTPSVPTPSVPTPSVPSPNPTPVTP 84 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P PP P PP PPP P Sbjct: 143 PPPPASTAIWSPSPPSPQHPP--PPPPQP 169 >At3g15400.1 68416.m01954 anther development protein, putative similar to anther development protein ATA20 GB:AAC50042 GI:2708813 from [Arabidopsis thaliana] Length = 416 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG G G G G G G GG G G GI G Sbjct: 249 GSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGIGIGEGIGSG 289 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGGXXV 777 G GG G G G G G G GG G G G GG + Sbjct: 237 GSSGGNGFGEGIGSSGGSGFGEGIGSSGGSGFGEGIGSGGGTGI 280 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = -2 Query: 905 GXXGGGXXGGGXGXGGXGGXXGGXXGXGG-GXXXGRGIXGG 786 G GG G G G G G G GG G G G GG Sbjct: 225 GSSGGSGFGEGIGSSGGNGFGEGIGSSGGSGFGEGIGSSGG 265 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 1/35 (2%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXX-GGXXGXGGGXXXGRGI 795 GG G G G G GG G G GG G GI Sbjct: 214 GGSGVGYGVGIGSSGGSGFGEGIGSSGGNGFGEGI 248 >At3g09770.2 68416.m01158 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 341 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP P S PPPP Sbjct: 25 PPPPPPSSSLPPPP 38 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PPS PPP Sbjct: 24 PPPPPPPSSSLPPP 37 >At3g09770.1 68416.m01157 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 388 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP P S PPPP Sbjct: 25 PPPPPPSSSLPPPP 38 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPPP PPS PPP Sbjct: 24 PPPPPPPSSSLPPP 37 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PP P P P P P P P PPP P P Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPPASLPTFP 127 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 6/33 (18%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXP------PPXXPPP 897 PPP P PP P P P PP PPP Sbjct: 87 PPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPP 119 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXP---PXPPXPXPPPXXPPP 897 + P PP P P P P PPP PPP Sbjct: 84 VANPPPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPP 120 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPPPXPPSXXPPPP 902 PPP PPS PPPP Sbjct: 78 PPPTLPPSPPPPPP 91 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 820 PPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 P P PP PP P P PPP P P Sbjct: 73 PLPPSPPPTLPPSP--PPPPPFSPDLRNP 99 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 796 IPRPXXXPPPXPXXPPXXPPXPP 864 +P P PP P PP PP P Sbjct: 72 LPLPPSPPPTLPPSPPPPPPFSP 94 >At1g36675.1 68414.m04563 glycine-rich protein Length = 268 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 860 GXGGXXGGXXGXGGGXXXGRGIXGG 786 G G G G GGG GRGI GG Sbjct: 197 GNGRGGGSRDGRGGGSGDGRGIGGG 221 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G G G G GGG GRG G Sbjct: 49 GHGRGGGGDRGRGYSGRGDGR-GRGGGGDRGRGYSG 83 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 896 GGGXXGGGXGXGGXGGXXGGXXGXGGGXXXGRGIXG 789 G G GGG G G G G GGG GRG G Sbjct: 68 GRGRGGGGDRGRGYSGRGDGH-GRGGGGDRGRGYSG 102 >At1g28240.1 68414.m03466 expressed protein Length = 581 Score = 29.5 bits (63), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 850 PPXPPXPXPPPXXPPP 897 PP P P PPP PPP Sbjct: 520 PPVPNFPPPPPSPPPP 535 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 849 PXXXPPPPXPPSXXPPPP 902 P PPPP PP P PP Sbjct: 26 PPKSPPPPPPPPALPKPP 43 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXX-PPXPPXPXPPP 882 PP + P P P PP P P P PPP Sbjct: 335 PPQLVEPSRVQSPSPPPPPPVIQPELPQPQPPP 367 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 817 PPPXPXXPPXXPPXPPXPXPPPXXPPPXXP 906 PPP P P PPP PPP P Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPPPPPRSP 147 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 787 PPXIPRPXXXPPPXPXXPPXXPPXPPXPXPPPXXPPP 897 PP P PP PP PP P PPP Sbjct: 118 PPPPSTAVEYQPHHRHHPPPPPPPPPPRSPNSASPPP 154 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,678,214 Number of Sequences: 28952 Number of extensions: 401418 Number of successful extensions: 20887 Number of sequences better than 10.0: 318 Number of HSP's better than 10.0 without gapping: 1580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9275 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2139598560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -