BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O20 (963 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 50 2e-06 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 34 7e-04 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 41 0.001 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 39 0.007 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 30 0.012 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.020 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 37 0.021 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.021 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.065 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.086 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 35 0.11 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 34 0.15 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 34 0.20 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 34 0.20 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.35 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 33 0.35 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 33 0.35 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 33 0.35 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 33 0.46 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 33 0.46 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 33 0.46 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.46 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 30 0.47 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 32 0.60 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 32 0.60 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.60 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.80 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.94 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.1 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 31 1.1 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 31 1.1 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.4 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.4 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 31 1.8 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 31 1.8 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 25 2.1 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.4 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 30 2.4 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 30 2.4 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 3.2 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 30 3.2 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 30 3.2 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 3.2 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 30 3.2 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 30 3.2 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 4.2 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 29 4.2 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 5.6 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 29 5.6 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 29 5.6 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 5.6 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 29 7.4 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 29 7.4 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 28 9.8 SB_19502| Best HMM Match : UPF0181 (HMM E-Value=1.2) 28 9.8 SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_51968| Best HMM Match : PT (HMM E-Value=0.54) 28 9.8 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.8 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 28 9.8 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 28 9.8 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 50.4 bits (115), Expect = 2e-06 Identities = 32/93 (34%), Positives = 33/93 (35%), Gaps = 1/93 (1%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXW-XXSXXGXGG 786 G G G GG GGG GGG G G GG G + G GG Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Query: 785 XEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GG G GG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 47.2 bits (107), Expect = 2e-05 Identities = 31/95 (32%), Positives = 32/95 (33%), Gaps = 3/95 (3%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GGG GGG G G G G G GG Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 782 EXXXXFFXXGG---XGEGGGGXXGXGGWXXGXXGG 687 F GG G+GGGG G GG G GG Sbjct: 830 YGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGG 864 Score = 46.8 bits (106), Expect = 3e-05 Identities = 30/92 (32%), Positives = 31/92 (33%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG GGG GGG G G G G G GG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG-GGGGGGGGDGGGYGDGGG 835 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 + G G GGGG G GG G GG Sbjct: 836 FGDGGGYADGDGGGGGGGGGGGGGGGGGGGGG 867 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/90 (28%), Positives = 27/90 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 + G GGG G G G G GGG Sbjct: 841 GYADGDGGGGGGGGGGGGGGGGGGGGGGGG 870 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/90 (28%), Positives = 27/90 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG G GG G GG G G G G G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 + G GGG G G G G GGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/90 (28%), Positives = 27/90 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G +G G G Sbjct: 785 GGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYAD 844 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG G G G G GGG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 35.9 bits (79), Expect = 0.049 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G G G G Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGD-GGGFGDGGGYADGD 846 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG G G G G GGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 35.1 bits (77), Expect = 0.086 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 G GG GG G GG G G G G G G G Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGF 836 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG G G G G GGG Sbjct: 837 GDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G G GG GGG GGG G G GG Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 851 GGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 29.1 bits (62), Expect = 5.6 Identities = 26/91 (28%), Positives = 26/91 (28%) Frame = -3 Query: 937 GGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXXFFFX 758 GG GG G GG G G G G G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGG--------- 819 Query: 757 XXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGG G GDG GGG G Sbjct: 820 ---GGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 GG GGG GGG G G GG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P P P P P + PP P P P P P P PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 935 PPXXPPXP 958 PP PP P Sbjct: 425 PPPPPPPP 432 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P PP P P PPP PPP PP P P P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +2 Query: 740 LXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXX 919 + P P P P P P PP P P P P P P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Query: 920 PPXXPPPXXP 949 PP PPP P Sbjct: 423 PPPPPPPPPP 432 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 838 MXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 M P PP P P P P PPP PP P P P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/90 (32%), Positives = 29/90 (32%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P PSP P PPP PS P P P P Sbjct: 368 PPPPPPPPPSPPPPPPPPP--PS------------PPPPPQPPP------------PPPP 401 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P PP PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P P PP P P P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP PPP PP P P P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PPP PPP PP P P P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PPP PPP PP P P P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP P P P P Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P P PP P P P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PP PP P P P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P P P P PPP PPP P P P P Sbjct: 388 SPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP PP PP P P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PPP PPP PP P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P PPP P PSP P PPP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXP 815 P PPP P P P P PPP P AP P P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P P+ P PPP P P+P P PPP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 31.1 bits (67), Expect = 1.4 Identities = 25/91 (27%), Positives = 26/91 (28%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P P +PPP P P P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPP---------------PPQPPPPPPP---------- 401 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P PP P PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P P + P PPP P P P P PPP P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 834 LNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 +N P P P P PP P PP P PP Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P P + P PPP P P P P PPP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP 740 P P P PPP P P P P PPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 43.2 bits (97), Expect = 3e-04 Identities = 30/109 (27%), Positives = 31/109 (28%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P P PPP P PSP PPP P P P + Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP-NPPYPPPLYPPPPNPPPPNAP 173 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P PP P PP PP PP Sbjct: 174 YPPPPYP-------PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Score = 39.9 bits (89), Expect = 0.003 Identities = 30/111 (27%), Positives = 30/111 (27%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P P P P P P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYP--PSPNAP 147 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PP P P P P P P PP PPP PP P Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPP-PNAPYPPPPYPPPPNPP-YPPPPNPPYP 196 Score = 36.7 bits (81), Expect = 0.028 Identities = 30/117 (25%), Positives = 30/117 (25%), Gaps = 2/117 (1%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P PP PP P P P P P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP---YPPSPNAPYPPPPNPPY 156 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP--XXPPPXXPPXP 958 P P PP P P P P P PP PPP PP P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYP-PPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYP 212 Score = 35.9 bits (79), Expect = 0.049 Identities = 28/112 (25%), Positives = 28/112 (25%), Gaps = 1/112 (0%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKX-PXXLXPXPXX 802 P P P PP PP P P P P P P Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPN 171 Query: 803 XXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PP P P P P P PP PPP P P Sbjct: 172 APYPPPPYPPPPNPPYPPPPNPPYPPPPNAPN--PPPPNPPYPPPPNAPNPP 221 Score = 35.1 bits (77), Expect = 0.086 Identities = 26/111 (23%), Positives = 26/111 (23%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P P P P P P Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPP-NPPPPNAPYPPPPYPPPPNPP 186 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP P P PP P Sbjct: 187 YPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P PP P P PPP PP PP P P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPP 164 Score = 33.9 bits (74), Expect = 0.20 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P N P PP P PPP PP PP P P P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 880 GXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 G P P PP PPP PP P P P Sbjct: 82 GHPPTNFSPNPPYPPPPYPPYPPPPPYP 109 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PP PPP PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYP 117 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 2/61 (3%) Frame = +1 Query: 787 PPSPXXLXXQXXNXX--NXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPX 960 PP P L N N P PP P PPP P PP P P Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Query: 961 P 963 P Sbjct: 214 P 214 Score = 31.1 bits (67), Expect = 1.4 Identities = 26/116 (22%), Positives = 29/116 (25%), Gaps = 3/116 (2%) Frame = +1 Query: 625 PXSPXLPXGQ-GNXXPXXXGXXPPXXPXXHXXXXXXXXXXXXXXXXQKKXXXXSXPPSPX 801 P +P L + G P PP P + PP P Sbjct: 70 PDAPCLVSAKCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN 129 Query: 802 XLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXP--XPPPXPPPXPPXXXPXPXP 963 N P PP P P PPP P PP P P P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P P PPP PP P P Sbjct: 182 PPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P PP P P Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/42 (33%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTP-PPFXP 749 P P P PPP P P P P P PP+ P Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPP 235 Score = 29.1 bits (62), Expect = 5.6 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P N N P PP P P PPP P PP P P P Sbjct: 188 PPPPNPPYPPPPNAPNPPPPNPPYPPP------PNAPNPPYPPPPNAPNPPYP-PPPNP 239 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 33.9 bits (74), Expect(2) = 7e-04 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGG 99 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G GG G Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGG 98 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G GG G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDG 102 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G G GGG GGG G G GG G Sbjct: 78 GGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -2 Query: 797 GXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G GG GG G+GGGG G G G GG Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 27.5 bits (58), Expect(2) = 7e-04 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 755 GGXGEGGGGXXGXGG 711 GG G+GGGG G GG Sbjct: 97 GGGGDGGGGGGGGGG 111 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 41.1 bits (92), Expect = 0.001 Identities = 32/111 (28%), Positives = 34/111 (30%), Gaps = 8/111 (7%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXX-----GGXXGXXXX---IXXSXXXXWXXSX 801 G G GG GGG GGG G G GG G Sbjct: 124 GGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGG 183 Query: 800 XGXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXP 648 G GG + GG G GG G G GG+ G GG G P Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGGYEVSYP 234 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.5 bits (88), Expect = 0.004 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GG GGG G G GG G GG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG--- 298 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG GGGG G GG G GG Sbjct: 299 ------GGGATGGGGGATGVGGGATGGGGG 322 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/82 (30%), Positives = 26/82 (31%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GG GGG G G GG G + G G Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGV----------GATGGGGGATGG 340 Query: 776 XXXFFXXGGXGEGGGGXXGXGG 711 GG GGGG G GG Sbjct: 341 GGGVTGGGGGATGGGGGPGSGG 362 Score = 32.7 bits (71), Expect = 0.46 Identities = 25/95 (26%), Positives = 25/95 (26%) Frame = -3 Query: 949 GXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXX 770 G G GG GG G G G G G G GA Sbjct: 255 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGG 314 Query: 769 FFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGGV G G GGG G Sbjct: 315 GATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 29.1 bits (62), Expect = 5.6 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 1/89 (1%) Frame = -3 Query: 949 GXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXX 770 G G GG GG G G G G G G GA Sbjct: 262 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGG 321 Query: 769 FFFXXXXGXKGGGVXX-GXGDGXXGXXGG 686 G GGG G G G G GG Sbjct: 322 GATGGGVGATGGGGGATGGGGGVTGGGGG 350 Score = 28.7 bits (61), Expect = 7.4 Identities = 27/109 (24%), Positives = 27/109 (24%), Gaps = 1/109 (0%) Frame = -3 Query: 949 GXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXX 770 G G GG GG G G G G G G GA Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 307 Query: 769 FFFXXXXGXKGGGVXX-GXGDGXXGXXGGGXRXXXGXXXPXRXVXSGXG 626 G GGG G G G G GG G G G Sbjct: 308 GATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGG 356 Score = 28.3 bits (60), Expect = 9.8 Identities = 26/104 (25%), Positives = 26/104 (25%), Gaps = 1/104 (0%) Frame = -3 Query: 934 GXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXXFFFXX 755 G GG GG G G G G G G GA Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 754 XXGXKGGGVXX-GXGDGXXGXXGGGXRXXXGXXXPXRXVXSGXG 626 G GGG G G G G GG G G G Sbjct: 299 GGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGG 342 Score = 28.3 bits (60), Expect = 9.8 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GG GGG G G P G G Sbjct: 333 GGGGATGGGGGVTGGGGGATGGGGGPGSGGCGEDG 367 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GG GGG G G GG G GG Sbjct: 71 GGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGG 130 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GG G GG G GG Sbjct: 131 ATG--GHGGATGGHGGATGGGGGATGGGGG 158 Score = 34.7 bits (76), Expect = 0.11 Identities = 29/90 (32%), Positives = 30/90 (33%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GG GGG G G GG G + G GG Sbjct: 38 GHGGATGGHGGATGGGGG--ATGGGATGGGGGATGGGGGATGGH----GGATGGGGGATG 91 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG GGGG G GG G GG Sbjct: 92 -----DGGGATGGGGGATGGGGGATGGHGG 116 Score = 34.3 bits (75), Expect = 0.15 Identities = 28/94 (29%), Positives = 29/94 (30%), Gaps = 2/94 (2%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GG GGG G G GG G + G GG Sbjct: 55 GATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGG----GGATGGGGGA 110 Query: 782 EXXXXFFXXGGXGE--GGGGXXGXGGWXXGXXGG 687 GG G G GG G G G GG Sbjct: 111 TGGHGGATGGGVGATGGHGGATGGHGGATGGHGG 144 Score = 31.9 bits (69), Expect = 0.80 Identities = 27/93 (29%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = -2 Query: 962 GXGXGXXXGGXGGGX-GGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGG 786 G G G GGG GGG G G GG G G GG Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGD-----GGGATGGGG 101 Query: 785 XEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GG G G G GG Sbjct: 102 GATGGGGGATGGHGGATGGGVGATGGHGGATGG 134 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GG GGG G G GG G Sbjct: 134 GHGGATGGHGGATGGGGGATGGGGGATGGGGGATG 168 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P P PP P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP PP PP P Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPP 89 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP PP PPP PP P P P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP P P PP P P P Sbjct: 86 PPPPPLPAPPPPPAQPAPQP 105 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 781 SXPPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPX 960 S PP P + P PP P P P P PPP P P P Sbjct: 48 SSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPA-APPAAPPPPPPLPAPPPPPAQPAPQPP 106 Query: 961 P 963 P Sbjct: 107 P 107 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP P P PP P P Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PPSP + P PP P P P P PPP P P P P Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPP--PPAAPPAAPPPPP-PLPAPPPPPAQPAPQPPPAP 109 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXP 749 PP P P+P P PP F P Sbjct: 94 PPPPPAQPAPQPPPAPPHFLP 114 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 37.9 bits (84), Expect = 0.012 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 1/89 (1%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 G GG GGG GGG G G GG G GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGG--GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGG 1814 Query: 770 XFFXXGGXGEG-GGGXXGXGGWXXGXXGG 687 GG G G GG G GG G GG Sbjct: 1815 GGMGGGGEGMGAAGGGMGAGGEGGGAGGG 1843 Score = 35.5 bits (78), Expect = 0.065 Identities = 27/88 (30%), Positives = 29/88 (32%), Gaps = 3/88 (3%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGG---XGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGX 792 G G G G GGG GGG G G GG G + G Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG------GGGMGG 1819 Query: 791 GGXEXXXXFFXXGGXGEGGGGXXGXGGW 708 GG G GEGGG G GG+ Sbjct: 1820 GGEGMGAAGGGMGAGGEGGGAGGGGGGY 1847 Score = 31.5 bits (68), Expect = 1.1 Identities = 26/92 (28%), Positives = 28/92 (30%), Gaps = 2/92 (2%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXX--GXXXXXSXHXXXFGXXVXXGXGAKX 779 GG GG GG G GG G G G G G + G G Sbjct: 1759 GGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMG 1818 Query: 778 XXXFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG+ G G G GGG Sbjct: 1819 GGG----EGMGAAGGGMGAGGEGGGAGGGGGG 1846 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFG 120 Score = 29.9 bits (64), Expect(2) = 0.012 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 764 FXXGGXGEGGGGXXGXGGWXXGXXGG 687 F GG G GGG G GG+ G GG Sbjct: 101 FGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G G GG GGG GGG G G GG Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 89 GGGGFGGGGGGGFGGGGGGGFGGG 112 Score = 27.1 bits (57), Expect(2) = 0.012 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGG 861 GG GGG GGG G G GG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGG 106 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P P P PPP PPP PP P P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPPP 119 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P P Sbjct: 97 PACCAPPPPPPPPPPPPPPPPPPP 120 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 102 PPPPPPPPPPPPPPPPPP 119 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 103 PPPPPPPPPPPPPPPPPP 120 Score = 31.9 bits (69), Expect(2) = 0.020 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXP 936 S P PP P P PPP PPP P Sbjct: 90 SCAPACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPP 740 PPP P P P P PPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 24.2 bits (50), Expect(2) = 0.020 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 910 PPPXPPPXPPXXXP 951 PPP PPP P P Sbjct: 139 PPPPPPPPAPCMPP 152 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPP--PPTP 496 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFP 489 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.5 bits (78), Expect = 0.065 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXP 749 PPP P P P P PPPF P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPP 490 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP P P P P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPS 752 P PPP P P P P PPP P+ Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P PPP P P P P PPP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXP 749 PPP P P P P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP 485 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXP 749 PPP P P P P PPP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPP 486 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXP 749 PPP P P P P PPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPP 487 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXP-PXXPPPXXPPXP 958 PP P P P P P P P P PPP PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSP 224 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P P PPP PP P Sbjct: 204 PPPPPPRPP-PSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP P P P P P P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSP 237 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +3 Query: 666 PXXXRXPP--PXXPXXPSPXPXXTPPPFXPS 752 P R PP P P PSP P PPP PS Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPS 236 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PP PPP P P P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP 231 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXP 815 PP P P P P PPP PS P P + P Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLP 246 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/56 (26%), Positives = 16/56 (28%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPP 940 P P P P + PP P P P P PP PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXP 815 P PPP P P P PPP P K P T P Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPP 260 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PP PP PP Sbjct: 367 PPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PP PP PP Sbjct: 377 PPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 32.7 bits (71), Expect = 0.46 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PP PP PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PP PP PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPP 940 PP P P P P P P PP PP Sbjct: 387 PPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP G P PP PPP P P P Sbjct: 374 PPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P P PPP P P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 28.3 bits (60), Expect = 9.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +3 Query: 621 VXPLPEXTXRXGXXXPXXXRXPPPXXPXX---PSPXPXXTPPPFXP 749 V P P T P PPP P P P P PPP P Sbjct: 344 VNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 6/43 (13%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXP------PPXPPXXXPXPXP 963 P PP P PPP P PP PP P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 28.3 bits (60), Expect = 9.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 6/43 (13%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXP------PPXPPXXXPXPXP 963 P PP P PPP P PP PP P P P Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PP PPP PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPP-PPPPSTPP 715 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQP 703 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPP 700 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPP 708 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP P P P P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP P P P P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PP PPP PP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPP-PXXPPXP 958 P P P P P P PP PP P PP P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPS 752 P PPP P P P TPPP PS Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P P PPP P P Sbjct: 683 PPPPPPPPPPPPPP---PPPPPQPSTPPPPPPSTP 714 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPP 740 P PPP P P P P PPP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 852 PXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P PP P PP PP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP P PP P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 618 RVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 ++ P+P T P PPP P P P PPP P Sbjct: 672 QILPIPIQTM-VPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPP 737 P PPP P P P P TPP Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPS 752 PP P P P P PPP PS Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPS 704 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 812 PKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P T PP P P P P P PP PP PP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PP PPP PP P P P Sbjct: 555 PPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.3 bits (75), Expect = 0.15 Identities = 26/85 (30%), Positives = 26/85 (30%), Gaps = 1/85 (1%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG GGG G G G G GG G GG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNG-GGGAGNGGGGGGAGNGGA 87 Query: 782 EXXXXFFXXGGXGEGG-GGXXGXGG 711 G G GG GG G GG Sbjct: 88 AGAAGAGAGGNVGGGGSGGVGGNGG 112 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 34.3 bits (75), Expect = 0.15 Identities = 27/90 (30%), Positives = 28/90 (31%), Gaps = 6/90 (6%) Frame = -2 Query: 938 GGXGG--GXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXF 765 GG GG G GGG G G P GG G S G GG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADNSWS 246 Query: 764 ----FXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GG G + G GG Sbjct: 247 GGYGSYDGGYGNGGDYSNGYSSYGGGYGGG 276 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.3 bits (75), Expect = 0.15 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 Query: 812 PKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P+ + T PP P P P P PP PPP PP Sbjct: 278 PEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 31.9 bits (69), Expect = 0.80 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P Sbjct: 308 PPPGGAPPPPPPPPPPPPGDGGAPPP 333 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P PP G P PP PP PP P P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP G P P PPP PPP P P P Sbjct: 306 PPPPPGGAPPP---PPPPPPPPPGDGGAPPPPPP 336 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PPP PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 149 GGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 670 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 678 GGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 695 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 G G+GGGG G GG G GG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXP 951 PP P P PPP PPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP PP P Sbjct: 1157 PPPP---PPPPPPPPSSPSPPPPP--PPPPPPPTP 1186 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPS 752 P PPP P PSP P PPP P+ Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPT 1185 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 1158 PPPPPPPPPPPSSPSPPP 1175 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPP 1176 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP P P P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPP 1177 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP P P P P Sbjct: 1160 PPPPPPPPPSSPSPPPPPPP 1179 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +1 Query: 886 PXXXXXPXPPPX---PPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP P PP P P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 867 PPPPPPPPPPPPPPPPPP 884 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 868 PPPPPPPPPPPPPPPPPP 885 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P P Sbjct: 864 PRRPPPPPPPPPPPPPPPPP 883 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPP 740 R PPP P P P P PPP Sbjct: 865 RRPPPPPPPPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 863 PXXXPXXPXXPXXXPXPXXPPXXPPP 940 P P P P P P PP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPP 737 P R PPP P P P P PP Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.1 bits (72), Expect = 0.35 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 823 NXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 N + M P PP G P P PPP P PP P Sbjct: 186 NKPSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPPALNGGP 230 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP P P P P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPP 215 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +2 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PK T PP P P P P PP PP P P Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPP 76 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 33.1 bits (72), Expect = 0.35 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLP 1327 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P Sbjct: 1311 PPPPPPPPPPPPPPPLPPTP 1330 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PP PPP PP P P P Sbjct: 1307 PPESPPPPPPPPPPPPPP 1324 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPS 752 PP P P P P PPP P+ Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPT 1329 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 764 FXXGGXGEGGGGXXGXGGWXXGXXGG 687 F GG G GGGG G GG G GG Sbjct: 334 FPRGGSGRGGGGGGGGGGGGGGGGGG 359 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGG 363 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 340 GRGGGGGGGGGGGGGGGGGGRGGGGG 365 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXX--PXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P P PP P Sbjct: 309 PPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAP 345 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXX--PXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P P PP P Sbjct: 318 PPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPAP 354 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 863 PXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP P P P P Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPSPPIPTAP 203 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/62 (29%), Positives = 18/62 (29%), Gaps = 5/62 (8%) Frame = +2 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXX-----PXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P T PP P P P P P P PP P P P Sbjct: 154 PEPTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPL 213 Query: 953 XP 958 P Sbjct: 214 PP 215 Score = 28.7 bits (61), Expect = 7.4 Identities = 26/107 (24%), Positives = 27/107 (25%), Gaps = 2/107 (1%) Frame = +2 Query: 644 PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXX-LXPX-PXXXXGPK 817 P T+P PP P P P P L P P P Sbjct: 179 PPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPET-PLPPGSPHIPPAPLHPHIPPAPPNPS 237 Query: 818 XXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P PP P P P P Sbjct: 238 KAIATPNPPMPETPLPPATPN-PFIPPASPNPSIPPAPPNPSIPAPP 283 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 32.7 bits (71), Expect = 0.46 Identities = 25/92 (27%), Positives = 27/92 (29%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GGG GGG G G G G G Sbjct: 250 GDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 309 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 + G G+G G G GG G GG Sbjct: 310 DGDGD-GDGDGDGDGDGDGDGGGGDGGGDDGG 340 Score = 32.3 bits (70), Expect = 0.60 Identities = 25/93 (26%), Positives = 27/93 (29%), Gaps = 1/93 (1%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG GGG G G G G G G G Sbjct: 254 GDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDGDG 313 Query: 782 EXXXXFFXXG-GXGEGGGGXXGXGGWXXGXXGG 687 + G G G+GGGG G G G Sbjct: 314 DGDGDGDGDGDGDGDGGGGDGGGDDGGDGDGDG 346 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 Query: 797 GXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G + GG G GGGG G GG+ G GG Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGG 785 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 32.7 bits (71), Expect = 0.46 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 752 GXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 G G GG G GGW G GG G P G +G Sbjct: 2 GQGPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWG 41 Score = 31.9 bits (69), Expect = 0.80 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 752 GXGEGGG-GXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 G G+GGG G GGW G GG G P G +G Sbjct: 25 GRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWG 65 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = -2 Query: 755 GGXGEGGGGXXG---XGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 GG G G GG G GGW G GG G G +G Sbjct: 6 GGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWG 49 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.46 Identities = 23/93 (24%), Positives = 24/93 (25%), Gaps = 3/93 (3%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P PS P PPP P+ P P Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIA 171 Query: 864 P---XXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P P PP PP Sbjct: 172 PAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P PP P PP P Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPP 141 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 P P P P PPP PPP PP Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP G P P PPP PPP P P P Sbjct: 188 PPPPSGGPPPP---PPPPPPPPPPPILELAAPPP 218 Score = 29.1 bits (62), Expect = 5.6 Identities = 22/96 (22%), Positives = 24/96 (25%), Gaps = 6/96 (6%) Frame = +2 Query: 689 PPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPX 868 PP P P P + P P P + PP P Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 869 XX------PXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PPP PP P Sbjct: 171 APAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Score = 28.7 bits (61), Expect = 7.4 Identities = 22/87 (25%), Positives = 24/87 (27%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPX 857 R PPP P P+ PPP P+ P P P Sbjct: 136 RAPPPPPPIAPATGGPPPPPPIAPAT---------GGPPPPPPIAP-----AATVPAPAV 181 Query: 858 XXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P PP P PP PP Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PP PP PP P P P Sbjct: 182 PLAAASPPPPSGGPPPPPPPPPPPPP 207 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PPXPXXXPXXP-XXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P P PP PP Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 752 GXGEGGGGXXGXGGWXXGXXGG 687 G G+GGGG G GG G GG Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGG 325 Score = 29.9 bits (64), Expect(2) = 0.47 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 306 GDGGGGGDGGGGGGGGGGGG 325 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G G GGG GGG G G G G Sbjct: 304 GDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDG 340 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G+GGGG G GG G GG Sbjct: 309 GGGGDGGGGGGGGGG-GGGDGGG 330 Score = 21.4 bits (43), Expect(2) = 0.47 Identities = 11/31 (35%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = -2 Query: 797 GXGGXEXXXXFFXXG-GXGEGGGGXXGXGGW 708 G GG + G G G+G G G GW Sbjct: 326 GDGGGDGDGDGDGDGDGDGDGDGDGDGDDGW 356 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 32.3 bits (70), Expect = 0.60 Identities = 29/111 (26%), Positives = 32/111 (28%), Gaps = 1/111 (0%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXX-GXXXXIXXSXXXXWXXSXXGXGG 786 G G G G G G GGG G G G G W G G Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMG 301 Query: 785 XEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 + G +GG G GGW GG G P G +G Sbjct: 302 RGPGGGW----GRMQGGMGRGPGGGWGRMQGGGMGRGPGGGLGRGPGGGWG 348 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXP 957 P PPP PPP PP P P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 32.3 bits (70), Expect = 0.60 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXP 951 P P PPP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPS 752 PPP P P P P PP PS Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPS 76 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGG 471 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 748 GXKGGGVXXGXGDGXXGXXGGG 683 G GGG G GDG G GGG Sbjct: 447 GGDGGGGGDGGGDGIDGGDGGG 468 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 32.3 bits (70), Expect = 0.60 Identities = 18/71 (25%), Positives = 20/71 (28%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P + P L P P + T P P P P PP Sbjct: 910 PPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPP 969 Query: 926 XXPPPXXPPXP 958 PP PP P Sbjct: 970 PPLPPLPPPPP 980 Score = 31.5 bits (68), Expect = 1.1 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P P P P PPP P + ST P P Sbjct: 908 PPPPLPLAPEPPPPLPPPP--PPIQTTRPTVPTTPTTQASTTRP---------TPPPPTS 956 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPP 938 P PP P PP PP Sbjct: 957 ALPPPIPATQVPPPPLPPLPPPPPP 981 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 31.9 bits (69), Expect = 0.80 Identities = 15/47 (31%), Positives = 18/47 (38%) Frame = +1 Query: 823 NXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 N + + + P PP P P PPP PP PP P P Sbjct: 1014 NVPDPLPTDPPTEPPTDPP-TPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P PPP P P P TPPP P Sbjct: 1028 PTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 31.9 bits (69), Expect = 0.80 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PPP PP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKK 767 PPP P P P PPP P KK Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPPVKK 252 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 42 GGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGG 78 Score = 27.9 bits (59), Expect(2) = 0.94 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGG 909 G G G GG GGG GGG Sbjct: 41 GGGGGGGGGGGGGGGGGG 58 Score = 22.6 bits (46), Expect(2) = 0.94 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 935 GXGGGXGGGXGXXXXXG 885 G GGG GGG G G Sbjct: 75 GGGGGGGGGDGDGDGDG 91 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P P Sbjct: 62 PIPPTLPPPPPPPPPPLPPP 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXP 957 PPP PPP PP P P Sbjct: 68 PPPPPPPPPPLPPPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P P Sbjct: 286 PIPPTLPPPPPPPPPPLPPP 305 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXP 957 PPP PPP PP P P Sbjct: 292 PPPPPPPPPPLPPPPP 307 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 31.5 bits (68), Expect = 1.1 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP P P PP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPP----XPPPXPPXXXPXP 957 P PP P P PPP PPP PP P P Sbjct: 955 PPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/85 (25%), Positives = 23/85 (27%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P +P P P PS P P P P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAP-----------PPGGG 969 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPP 938 P P PP P PP PP Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 977 PGGSAPPPPPPPPPPPPP 994 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP PPP P P P Sbjct: 726 PPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PPP PPP P P P Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPP 714 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/66 (27%), Positives = 22/66 (33%) Frame = +1 Query: 760 QKKXXXXSXPPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 Q++ PP P L + + P PP P P PPP PPP Sbjct: 668 QEQEKLKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPM----PPPPPPPPPGCA 723 Query: 940 XXXPXP 957 P P Sbjct: 724 GLPPPP 729 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P PPP PPP P P P P Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 5/42 (11%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPP-----XPPPXPPXXXPXPXP 963 P PP G P PPP PPP PP P P Sbjct: 661 PPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPP 702 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 80 GGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDG 116 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G G G GG GGG GGG G GG Sbjct: 87 GGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGG 120 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXX--PXPXXPPXXPPPXXPP 952 PP P P P P P P PP PP PP Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P PP P P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPP 156 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P Sbjct: 794 PPPPPPPPPPPPEDLIIPLP 813 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 25.0 bits (52), Expect(2) = 2.1 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP P Sbjct: 820 PPPPPPPPPEEP 831 Score = 23.8 bits (49), Expect(2) = 2.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 886 PXXXXXPXPPPXPPP 930 P P PPP PPP Sbjct: 813 PHEDSPPPPPPPPPP 827 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P PP G P P P PPP P P P Sbjct: 222 SLPPMIPPVGMLGHPPMGAPPPPHSMPPPGMPPPGMMPPP 261 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 54 GGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGG 72 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGG 76 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 886 PXXXXXPXPPPXPPP--XPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXP 815 P PPP P P P PPP PS + P P ST P Sbjct: 1036 PSAQPLPPPRKPSPP-PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQP 1084 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P PP P P PPP PP P P P P Sbjct: 1052 SAVPIPPPRKPSPPPSE---PAPPPRQPPPPSTSQPVPPP 1088 Score = 28.7 bits (61), Expect = 7.4 Identities = 19/72 (26%), Positives = 22/72 (30%), Gaps = 1/72 (1%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPX-PXXXPXXPXXPXXXPXPXXP 922 P P +K P P P P+ + PP P P P P P P Sbjct: 1026 PVPPKRKASPPSAQPLPP----PRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPST 1081 Query: 923 PXXPPPXXPPXP 958 PP P P Sbjct: 1082 SQPVPPPRQPDP 1093 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP P PP P P P Sbjct: 1040 PLPPPRKPSPPPSAVPIPPP 1059 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P Sbjct: 75 PLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 73 PPPLCAPPPPPPPPPPPP 90 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 74 PPLCAPPPPPPPPPPPPP 91 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +1 Query: 838 MXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 M + P P G P P PPP P PP P P Sbjct: 1231 MMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP 1272 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP PP PP P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 29.9 bits (64), Expect = 3.2 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = -2 Query: 938 GGXGGGXGG-GXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFF 762 GG GGG GG G G GG G G GG + Sbjct: 48 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG-------GGCDGGGGDGDGGGGGDGDG--- 97 Query: 761 XXGGXGEGGGGXXGXGG 711 GG G+GGGG G GG Sbjct: 98 --GGGGDGGGGGDGGGG 112 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G+GGGG G GG GG Sbjct: 84 GGDGDGGGGGDGDGGGGGDGGGG 106 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXG 699 GG G+GGGG G GG G Sbjct: 92 GGDGDGGGGGDGGGGGDGG 110 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 119 GYGGGRGGGGYGGGRGGGYG 138 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXP 957 P P PPP PPP PP P Sbjct: 276 PLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 274 PPPLCAPPPPPPPPPPPP 291 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 275 PPLCAPPPPPPPPPPPPP 292 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 320 GGGGGGGGGGGGGGGGGGGG 339 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 34 GYGGGPNGGGGGGGGGGGGG 53 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 206 GYGGGRGGGGYGGGRGGGGG 225 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 29.9 bits (64), Expect = 3.2 Identities = 25/77 (32%), Positives = 27/77 (35%), Gaps = 1/77 (1%) Frame = -2 Query: 938 GGXGGGXGG-GXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFF 762 GG GGG GG G G GG G G GG + Sbjct: 63 GGDGGGGGGDGDGDDDDGDGNVGDDGGGDG-------GGCDGGGGDGDGGGGGDGDG--- 112 Query: 761 XXGGXGEGGGGXXGXGG 711 GG G+GGGG G GG Sbjct: 113 --GGGGDGGGGGDGGGG 127 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G+GGGG G GG GG Sbjct: 99 GGDGDGGGGGDGDGGGGGDGGGG 121 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXG 699 GG G+GGGG G GG G Sbjct: 107 GGDGDGGGGGDGGGGGDGG 125 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGE 630 GG G+GG G G GG G G G P G G+ Sbjct: 37 GGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGD 78 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P P P P Sbjct: 31 PPPPYEAPPPPPGP---PGPDGPPGFPGPQGPNGP 62 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP P P PP P Sbjct: 627 PPGPASPPSPPGPPGPPGPKGPPGP 651 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP P P PP P Sbjct: 712 PPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP P P PP P Sbjct: 797 PPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP P P PP P Sbjct: 882 PPGPASPPSPPGPPGPPGPKGPPGP 906 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P P P P P T PP P P P P PP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPR-TQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 Query: 935 PPXXPP 952 P PP Sbjct: 216 PRTQPP 221 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PP PP P P P Sbjct: 181 PPPIPPIDPPRTQPPPIP 198 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PP PP P P P Sbjct: 194 PPPIPPIDPPRTQPPPIP 211 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP PPP P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPP 119 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 880 GXPXXXXXPXPPPXPPPXPPXXXPXP 957 G P P PP PP PP P P Sbjct: 93 GDPPPPATPPPPTMPPTPPPPQTPAP 118 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 905 PXPXXPPXXPPPXXPPXP 958 P P PP PPP PP P Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP P P P P Sbjct: 82 PPPPPPPPPASNVPAPPP 99 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P P P PP Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 P P PPP PP P P P Sbjct: 940 PTPTPPPSPPPKEPTPPP 957 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP P P P Sbjct: 942 PTPPPSPPPKEPTPPPSSKP 961 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.1 bits (62), Expect = 5.6 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 5/64 (7%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXP-----PPXPPPXPPXXXP 951 PP P + S P P P P P PP PPP P P Sbjct: 316 PPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPP 375 Query: 952 XPXP 963 P P Sbjct: 376 PPPP 379 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P P P P PPP PP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPPLPP 276 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 5.6 Identities = 21/95 (22%), Positives = 22/95 (23%) Frame = +2 Query: 665 PPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXX 844 PP P P TI + P P P P T Sbjct: 14 PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDP 73 Query: 845 XXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXP 949 P P P P P P PPP P Sbjct: 74 PPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 PP P P P PPP PP P P Sbjct: 2622 PPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFP 2653 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPS 752 P P P P P P TPPP PS Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPS 63 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 28.7 bits (61), Expect = 7.4 Identities = 25/89 (28%), Positives = 26/89 (29%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G G G GGG G G GG G S E Sbjct: 410 GNGAEEGDNGYSGGGGAGLNSN-GRNNKNFGGSRGTGGEGGKSFLAGGAGGRSNQNDVEG 468 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXG 690 F GG GGG G GG+ G G Sbjct: 469 G--FGGGGGPNGAGGGGGGGGGYSGGASG 495 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PP PP PP Sbjct: 115 PPAPTSVPSGPRAPPGGPG-APPPPPPPAVVPP 146 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXP---PPXXPPXP 958 P P P P P P PP P PP PP P Sbjct: 168 PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPP 205 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 852 PXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP P PP PP PP Sbjct: 167 PPAAPFMAPAAPPAPPPPGAPAAPP-APPFGGPP 199 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PPP PP Sbjct: 178 PPAPPP-PGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 28.7 bits (61), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGG--XGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 192 GGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYG 230 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P PP PP PP Sbjct: 429 PPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPP 461 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXP 936 P P P P PPP PPP P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P Sbjct: 375 PFAPPPPPPPPPPPAPGSTP 394 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PP PP P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 28.3 bits (60), Expect = 9.8 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 1/84 (1%) Frame = -2 Query: 935 GXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFXX 756 G GGG G G G G GG G + G GG E Sbjct: 134 GRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGR---------GGNGGGRGGGE------GG 178 Query: 755 GGXGEG-GGGXXGXGGWXXGXXGG 687 GG G G GGG G GG G G Sbjct: 179 GGRGRGTGGGSRGGGGDGRGRGRG 202 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.3 bits (60), Expect = 9.8 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 875 PXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP PPP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 >SB_19502| Best HMM Match : UPF0181 (HMM E-Value=1.2) Length = 423 Score = 28.3 bits (60), Expect = 9.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 298 CWGTSTTAPSSCRPSVAFRWQ 236 CWGT + PSS +PS+ W+ Sbjct: 193 CWGTRQS-PSSAKPSIRLMWK 212 >SB_3455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 587 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 865 PXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P P P P PP P P P Sbjct: 460 PIPVHSPPQIEKVPIPFPYPVPSPPQIKPMPYP 492 >SB_51968| Best HMM Match : PT (HMM E-Value=0.54) Length = 514 Score = 28.3 bits (60), Expect = 9.8 Identities = 13/55 (23%), Positives = 21/55 (38%) Frame = +1 Query: 493 KDVLKITFPLKQKQPEDSKRPVAXXXXXXXXXVSREEMXFTXXXPXSPXLPXGQG 657 K K P ++++ E+ +RP + R P P LP G+G Sbjct: 427 KKTTKPLLPEEEEEEEEEERPTPKPTKAKPTTIKRRPTEIPTKKPTKPLLPEGEG 481 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXP 951 P P P PPP PPP PP P Sbjct: 340 PTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 28.3 bits (60), Expect = 9.8 Identities = 28/118 (23%), Positives = 29/118 (24%), Gaps = 4/118 (3%) Frame = +3 Query: 612 HXRVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXT----PPPFXPSXXXKKXXXX 779 H RV P R R PPP P P P + PPP P Sbjct: 518 HPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Query: 780 FXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P T P P P P P PP PP P Sbjct: 578 HPRVPPPGTPHPRVPP---PGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVP 632 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 166 PPPPPLPPPPPP 177 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 211 PPPPPPPPPPPP 222 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 212 PPPPPPPPPPPP 223 Score = 28.3 bits (60), Expect = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 213 PPPPPPPPPPPP 224 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 28.3 bits (60), Expect = 9.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P P P PP Sbjct: 411 PPGPHGPPFGPRGPPPHGGPPRGPMGPGPGMPP 443 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,027,169 Number of Sequences: 59808 Number of extensions: 509845 Number of successful extensions: 6828 Number of sequences better than 10.0: 93 Number of HSP's better than 10.0 without gapping: 1685 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3913 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2836293838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -