BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O20 (963 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g05440.2 68415.m00575 glycine-rich protein 43 3e-04 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 5e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 6e-04 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 42 8e-04 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 41 0.001 At4g01985.1 68417.m00265 expressed protein 41 0.001 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 40 0.002 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 40 0.003 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 39 0.004 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 39 0.006 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 39 0.006 At2g30560.1 68415.m03722 glycine-rich protein 39 0.006 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 38 0.010 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 38 0.010 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 38 0.013 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 37 0.023 At4g30460.1 68417.m04325 glycine-rich protein 37 0.023 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 37 0.023 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 37 0.023 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 36 0.030 At1g11850.2 68414.m01364 expressed protein 33 0.032 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.040 At1g75550.1 68414.m08780 glycine-rich protein 36 0.040 At4g33660.1 68417.m04781 expressed protein 36 0.053 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 36 0.053 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 36 0.053 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.053 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 35 0.070 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 35 0.070 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 35 0.070 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 35 0.070 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.070 At3g50180.1 68416.m05486 hypothetical protein 35 0.093 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.093 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 35 0.093 At1g27710.1 68414.m03387 glycine-rich protein 34 0.12 At3g51290.1 68416.m05614 proline-rich family protein 28 0.14 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 34 0.16 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 33 0.21 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 33 0.28 At1g22060.1 68414.m02759 expressed protein 33 0.28 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.37 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 33 0.37 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.37 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 33 0.37 At1g61080.1 68414.m06877 proline-rich family protein 31 0.38 At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family... 28 0.39 At5g20130.1 68418.m02396 expressed protein 32 0.65 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 32 0.65 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 32 0.65 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 32 0.65 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 32 0.65 At2g05510.1 68415.m00583 glycine-rich protein 32 0.65 At1g62240.1 68414.m07021 expressed protein 32 0.65 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 30 0.85 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 31 0.86 At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar... 31 0.86 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.86 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 31 0.86 At1g04800.1 68414.m00476 glycine-rich protein 31 0.86 At1g29380.1 68414.m03592 hypothetical protein 28 0.91 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 26 1.1 At2g05530.1 68415.m00585 glycine-rich protein 31 1.1 At1g10620.1 68414.m01204 protein kinase family protein contains ... 31 1.1 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.5 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 31 1.5 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 31 1.5 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 1.5 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 1.5 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 1.5 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 27 1.6 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 30 2.0 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 30 2.0 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 30 2.0 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 30 2.0 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 30 2.0 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.0 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 30 2.0 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 30 2.0 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 25 2.4 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 30 2.6 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 30 2.6 At5g38560.1 68418.m04662 protein kinase family protein contains ... 30 2.6 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 30 2.6 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 30 2.6 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 30 2.6 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 30 2.6 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 30 2.6 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 30 2.6 At1g53625.1 68414.m06096 expressed protein 30 2.6 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 30 2.6 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 30 2.6 At1g11850.1 68414.m01363 expressed protein 30 2.6 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 3.5 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 3.5 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 29 3.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 29 3.5 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 3.5 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 3.5 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 3.5 At1g15830.1 68414.m01900 expressed protein 29 3.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 29 4.6 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 4.6 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 29 4.6 At5g02600.2 68418.m00195 heavy-metal-associated domain-containin... 29 4.6 At5g02600.1 68418.m00196 heavy-metal-associated domain-containin... 29 4.6 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 29 4.6 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 29 4.6 At3g24550.1 68416.m03083 protein kinase family protein contains ... 29 4.6 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 4.6 At1g07310.1 68414.m00778 C2 domain-containing protein contains s... 29 4.6 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 29 4.6 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 29 6.1 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 29 6.1 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 6.1 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 29 6.1 At1g52560.1 68414.m05933 26.5 kDa class I small heat shock prote... 29 6.1 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 29 6.1 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 29 6.1 At2g16630.1 68415.m01909 proline-rich family protein contains pr... 24 7.1 At5g46780.2 68418.m05763 VQ motif-containing protein contains PF... 24 7.4 At5g46780.1 68418.m05762 VQ motif-containing protein contains PF... 24 7.4 At5g61660.1 68418.m07736 glycine-rich protein 28 8.0 At5g55540.1 68418.m06919 expressed protein 28 8.0 At4g34920.1 68417.m04951 1-phosphatidylinositol phosphodiesteras... 28 8.0 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 28 8.0 At4g16240.1 68417.m02464 hypothetical protein 28 8.0 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 28 8.0 At4g08230.1 68417.m01358 glycine-rich protein 28 8.0 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 28 8.0 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 28 8.0 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 28 8.0 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 8.0 At2g30505.1 68415.m03716 Expressed protein 28 8.0 At2g05440.1 68415.m00574 glycine-rich protein 28 8.0 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 28 8.0 At1g68390.1 68414.m07813 expressed protein contains Pfam profile... 28 8.0 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 28 8.0 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 8.0 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 28 8.0 At1g47660.1 68414.m05295 hypothetical protein 28 8.0 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 28 8.0 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/92 (30%), Positives = 29/92 (31%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GGG G G G GG G G G Sbjct: 44 GGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHY 103 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 + GG G GGGG G GG G GG Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGG 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 116 GHGGGGHYGGGGGGYGGGGGHHGGGG 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/87 (28%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = -3 Query: 937 GGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSX--HXXXFGXXVXXGXGAKXXXXFF 764 GG GG G GG G G G G H G G G Sbjct: 44 GGGHGGHGGHGGGGGH-GHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGH 102 Query: 763 FXXXXGXKGGGVXXGXGDGXXGXXGGG 683 + G GGG G G G GGG Sbjct: 103 YGGGGGHYGGGGGGHGGGGHYGGGGGG 129 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 42.3 bits (95), Expect = 5e-04 Identities = 26/98 (26%), Positives = 27/98 (27%) Frame = +2 Query: 665 PPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXX 844 PP PP P + P P P P P P Sbjct: 404 PPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPV 463 Query: 845 XXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP P P Sbjct: 464 YSPPPPPPPPPPPP--PVYSPPPPSPPPPPPPVYSPPP 499 Score = 41.9 bits (94), Expect = 6e-04 Identities = 26/96 (27%), Positives = 28/96 (29%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P P + PP S +P P P Sbjct: 397 PVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPP---------P 447 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P PP PP PP Sbjct: 448 VYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPP 483 Score = 39.5 bits (88), Expect = 0.003 Identities = 29/115 (25%), Positives = 31/115 (26%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P + PP PP P + P P P P Sbjct: 404 PPSLPSPPP-PAPIFSTPPTLTSPPPPSPPPPVYS---------PPPPPPPPPPVYSPPP 453 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PP P P P P P P PPP PP P Sbjct: 454 PPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP PPP PP P P P Sbjct: 483 PPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP+P P P P P PPP PPP PP P P P Sbjct: 412 PPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 470 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP P P P P Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/73 (26%), Positives = 21/73 (28%) Frame = +2 Query: 740 LXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXX 919 L P P + P P + PP P P P P P Sbjct: 402 LPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Query: 920 PPXXPPPXXPPXP 958 P PPP PP P Sbjct: 462 PVYSPPPPPPPPP 474 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/98 (27%), Positives = 29/98 (29%) Frame = +2 Query: 665 PPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXX 844 PP PP P + P P P P P P V + Sbjct: 433 PPVYSPPPPPPPPPPVYS--------PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYS--- 481 Query: 845 XXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP P P Sbjct: 482 ---PPPP--SPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 35.1 bits (77), Expect = 0.070 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PPP PP P P P Sbjct: 468 PPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP 501 Score = 35.1 bits (77), Expect = 0.070 Identities = 30/115 (26%), Positives = 30/115 (26%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P PP PP P P P P P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPP---PPPPPVYSPPPPPVYSSPP----PP 524 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P T PP P P P P P P PPP PP P Sbjct: 525 PSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPE-PYYYSSPPPPHSSPPPHSPPPP 578 Score = 35.1 bits (77), Expect = 0.070 Identities = 29/116 (25%), Positives = 30/116 (25%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P P PP PP P P + P P Sbjct: 486 SPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP 545 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PP P P P P P P PPP PP P Sbjct: 546 PPPQFSPPPPEPYY--YSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPP--PPTP 597 Score = 35.1 bits (77), Expect = 0.070 Identities = 30/115 (26%), Positives = 33/115 (28%) Frame = +2 Query: 605 WXSPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXL 784 + SP P P P T PP PP P + P P P Sbjct: 518 YSSPPPPPSPAPTPVY-CTRPPPPPPHSPPPPQFSPPPPEPYYYSSPP--PPHSSPPPHS 574 Query: 785 XPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXP 949 P P P + PP P P P P P P P PPP P Sbjct: 575 PPPPHSPPPP----IYPYLSPPPPPTPVSSP--PPTPVYSPPPPPPCIEPPPPPP 623 Score = 34.7 bits (76), Expect = 0.093 Identities = 26/115 (22%), Positives = 27/115 (23%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P PP PP P + P P P Sbjct: 434 PVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PP P P P P P PPP PP P Sbjct: 494 VYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP PPP P P P P Sbjct: 438 PPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPP 471 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P PP P P P Sbjct: 441 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P PP P P P Sbjct: 472 PPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPP--XPPXXXPXPX 960 PP P + S P PP P PPP PPP PP P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Query: 961 P 963 P Sbjct: 491 P 491 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P P P PPP P P P P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P PP P P P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPP--XPPXXXPXPXP 963 S P PP P PPP PPP PP P P P Sbjct: 465 SPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 P PP P P PPP PPP P P P P Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P PPP PPP PP P P Sbjct: 482 PPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 515 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PP P P P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PPP PP P P P P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P P P P P Sbjct: 504 PPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPP 540 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 4/41 (9%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXP----PPXPPPXPPXXXPXPXP 963 P PP P P P PP PPP PP P P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/96 (21%), Positives = 23/96 (23%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P PPP P +P P P + Sbjct: 564 PPPHSSPPPHSP----PPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPP 619 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P PP Sbjct: 620 PPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 41.9 bits (94), Expect = 6e-04 Identities = 33/113 (29%), Positives = 34/113 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GGG GG G G G G S G GG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGG- 208 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 + GG G GGGG G GG G G G G G G Sbjct: 209 -----YGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGG 256 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/85 (32%), Positives = 29/85 (34%), Gaps = 2/85 (2%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGX--GXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GGG GGG G G GG G G GG Sbjct: 205 GAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGS 264 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGW 708 GG G GGGG G GG+ Sbjct: 265 YGGEHGGGSGG-GHGGGGGHGGGGY 288 Score = 36.3 bits (80), Expect = 0.030 Identities = 34/117 (29%), Positives = 35/117 (29%), Gaps = 3/117 (2%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG---XXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGX 792 G G G GGG GGG G G GG G + S G Sbjct: 47 GVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGE 106 Query: 791 GGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXGY 621 GG GG GGGG G GG GG G G G GY Sbjct: 107 GGGGGYGG--AAGGHAGGGGGGSGGGGGSAYGAGGEHASGYG-NGAGEGGGAGASGY 160 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 1/80 (1%) Frame = -2 Query: 935 GXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFXX 756 G G G GGG G G GG G G GG Sbjct: 146 GNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGG 205 Query: 755 -GGXGEGGGGXXGXGGWXXG 699 GG G GGGG G GG G Sbjct: 206 AGGYGGGGGGGSGGGGAYGG 225 Score = 35.1 bits (77), Expect = 0.070 Identities = 30/94 (31%), Positives = 31/94 (32%), Gaps = 4/94 (4%) Frame = -2 Query: 956 GXGXXXGGXGGGXG-GGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXW---XXSXXGXG 789 G GG GGG G GG G GG G + S G G Sbjct: 31 GQASGGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGG 90 Query: 788 GXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G GEGGGG G GG G GG Sbjct: 91 GGGAASSGGYASGAGEGGGG--GYGGAAGGHAGG 122 Score = 34.7 bits (76), Expect = 0.093 Identities = 32/121 (26%), Positives = 33/121 (27%), Gaps = 7/121 (5%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXX-------GGXXGXXXXIXXSXXXXWXXS 804 G G GG GGG GGG G G GG G + Sbjct: 113 GGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHG 172 Query: 803 XXGXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 G GG G GEGGG G G GG G G G Sbjct: 173 GGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232 Query: 623 Y 621 Y Sbjct: 233 Y 233 Score = 34.3 bits (75), Expect = 0.12 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 1/91 (1%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXG-GXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXX 776 GG GG GG G G G G G G G GA Sbjct: 172 GGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGG 231 Query: 775 XXFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG G G G G GGG Sbjct: 232 GYGSGGGEGGGYGGGAAGGYGGGGGGGEGGG 262 Score = 33.9 bits (74), Expect = 0.16 Identities = 29/103 (28%), Positives = 32/103 (31%), Gaps = 3/103 (2%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXG-AKXX 776 GG GG GG G GG G G G H +G G G Sbjct: 190 GGGEGGGAGGG--GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGA 247 Query: 775 XXFFFXXXXGXKGGGVXXGX--GDGXXGXXGGGXRXXXGXXXP 653 + G +GGG G G G G GGG G P Sbjct: 248 AGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHGGGGYAP 290 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP PP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P PP PPP PP P Sbjct: 56 PEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 35.5 bits (78), Expect = 0.053 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 823 NXXNXMXSXXPXXPPXXXXGXPXXXXXPXPP-PXPPPXPPXXXPXPXP 963 N N S P P P P PP P PPP PP P P P Sbjct: 42 NDNNPPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 S P PP P P PP PPP PP P P Sbjct: 75 SPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSP 112 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 47 PPSPSPEPE-PEPADCPPPPPPPPCPPPPSPPPCP 80 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PP PPP PP Sbjct: 62 PPPP---PPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P P P PP PPP PP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPP 77 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P P P P P PPP PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP PP PP P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P Sbjct: 63 PPPPPPPCPPPPSPPPCP-PPPSPPPSPPPPQLPPPP 98 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P PP PP P P Sbjct: 80 PPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPP 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPX---PPXXXPXPXP 963 P P P P PPP PPP PP P P P Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPP-PXPPXXXPXPXP 963 S P P P P PP PP P PP P P P Sbjct: 51 SPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P PPP P P P P PPP P Sbjct: 58 PADCPPPPPPPPCPPPPSPPPCPPPPSP 85 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPS 752 PPP P PSP P PP PS Sbjct: 66 PPPPCPPPPSPPPCPPPPSPPPS 88 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P P PP PP P P P Sbjct: 74 PSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP 740 P PE P PP P P P P +PPP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPP 91 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/73 (24%), Positives = 18/73 (24%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P P P PPP P P P P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAP 105 Query: 864 PXXXPXXPXXXXP 902 P P P P Sbjct: 106 PKPQPSPPTPDLP 118 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/97 (30%), Positives = 31/97 (31%), Gaps = 5/97 (5%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG-----XXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXX 798 G G GG GGG GGG G G GG G Sbjct: 87 GGGSSGGRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSE 146 Query: 797 GXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G GG + GG GGGG G GG G GG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/90 (27%), Positives = 26/90 (28%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG G GG G GG G G G G G G Sbjct: 99 GGRGGGRGSGGGYGGGGG----GYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGG 154 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 + G GGG G G G G GGG Sbjct: 155 GGGYGGGGGYGGGGGGYGGG-GRGGGGGGG 183 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 3/95 (3%) Frame = -2 Query: 962 GXGXGXXXGGX---GGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGX 792 G G G GG GGG GGG G G GG G Sbjct: 123 GVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Query: 791 GGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG GG G GGGG G GG G G Sbjct: 183 GGAGGSVG--AGGGIGSGGGGTVGAGGRGSGGASG 215 Score = 39.1 bits (87), Expect = 0.004 Identities = 29/96 (30%), Positives = 29/96 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G V G G Sbjct: 429 GGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGG 488 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGG G G G G GGG R G Sbjct: 489 G-------GGIGGGAGGGVGGGVGGGVGGGVRGAVG 517 Score = 38.7 bits (86), Expect = 0.006 Identities = 27/92 (29%), Positives = 27/92 (29%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GGG GGG G G GG G GG Sbjct: 55 GGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGG 114 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G G GG G GG G GG Sbjct: 115 GAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGG 146 Score = 38.7 bits (86), Expect = 0.006 Identities = 26/90 (28%), Positives = 26/90 (28%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GGG G G G G GG G G G Sbjct: 112 GGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGA 171 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G G GG G GG GG Sbjct: 172 GGGVGGGVGAGGGAGGSVGAGGGIGSGGGG 201 Score = 37.1 bits (82), Expect = 0.017 Identities = 26/88 (29%), Positives = 27/88 (30%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 G GG GGG GGG G GG G + G Sbjct: 426 GGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGG---SVGGGGRGSGGAGGGTGGSVGAGG 482 Query: 770 XFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGG G GG G GG Sbjct: 483 GVGVGGGGGIGGGAGGGVGGGVGGGVGG 510 Score = 36.7 bits (81), Expect = 0.023 Identities = 30/95 (31%), Positives = 30/95 (31%), Gaps = 3/95 (3%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG-XXXXIXXSXXXXWXXSXXGXGG 786 G G GG GGG GGG G GG G S S GG Sbjct: 340 GGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGG 399 Query: 785 XEXXXXFFXXGGXG--EGGGGXXGXGGWXXGXXGG 687 GG G G GG G GG G GG Sbjct: 400 ASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGG 434 Score = 36.7 bits (81), Expect = 0.023 Identities = 30/110 (27%), Positives = 30/110 (27%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GG GG G G GG G G GG Sbjct: 398 GGASGGASGGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGG 457 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 GG G G GG G G G GG G G G Sbjct: 458 GSV------GGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVG 501 Score = 35.5 bits (78), Expect = 0.053 Identities = 33/116 (28%), Positives = 34/116 (29%), Gaps = 3/116 (2%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXS-XXGXGG 786 G G G GG GG G G G GG G + G GG Sbjct: 303 GGGGGGSVGG--GGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGG 360 Query: 785 XEXXXXFFXXGGXGEG--GGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 GG G G GGG G GG G GG G G G G Sbjct: 361 AVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAG 416 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/90 (30%), Positives = 28/90 (31%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GGG GGG G G G G + G GG Sbjct: 488 GGGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGV-----------GGAGRGSGGASG 536 Query: 776 XXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G GGG G G G GG Sbjct: 537 GAGAGGGAGGGVGGGANVGVGVGAGGSTGG 566 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/96 (29%), Positives = 28/96 (29%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G G GA Sbjct: 489 GGGIGGGAGGGVGGGVGGGVGGGVRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGA---- 544 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGG G G G G GGG G Sbjct: 545 -------GGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 34.7 bits (76), Expect = 0.093 Identities = 31/115 (26%), Positives = 34/115 (29%), Gaps = 2/115 (1%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXG-GXXGXXXXI-XXSXXXXWXXSXXGXG 789 G G G GGG GG G G G G G + + + G G Sbjct: 43 GRGSVGVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAG 102 Query: 788 GXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 G GG G G GG G GG G G G G G G Sbjct: 103 GGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVG 157 Score = 34.3 bits (75), Expect = 0.12 Identities = 28/93 (30%), Positives = 28/93 (30%), Gaps = 1/93 (1%) Frame = -2 Query: 962 GXGXGXXXGGXG-GGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGG 786 G G GG G GG GG G G G G S G GG Sbjct: 198 GGGGTVGAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGGAGGSGGGSVGGGGRGSGG 257 Query: 785 XEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G GGG G GG G GG Sbjct: 258 VGASGG--AGGNVGAGGGLGGGVGGGVGGGVGG 288 Score = 34.3 bits (75), Expect = 0.12 Identities = 30/90 (33%), Positives = 30/90 (33%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G S G G GA Sbjct: 271 GGGLGGGVGGGVGGGVGGSVG-GAVGGAVGGAVGGGGGGSVGGGGRGSGGASG-GASGGA 328 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGGV G G G G GGG Sbjct: 329 SGGAGGSVGA-GGGVGGGVGGGVGGGVGGG 357 Score = 33.5 bits (73), Expect = 0.21 Identities = 28/96 (29%), Positives = 29/96 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG G GG G GG G G G G G V G GA Sbjct: 74 GGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGA---GGGVGGGVGAGGGA 130 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGG G G G GGG + G Sbjct: 131 GGSVGAGGGI-GGGAGGAIGGGASGGVGGGGKGRGG 165 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/94 (29%), Positives = 28/94 (29%), Gaps = 2/94 (2%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGG-XGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGG 786 G G GG GG GGG G GG G G GG Sbjct: 229 GASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGG 288 Query: 785 XEXXXXFFXXGG-XGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GG G G Sbjct: 289 SVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASG 322 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/95 (29%), Positives = 28/95 (29%) Frame = -3 Query: 949 GXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXX 770 G GG GG G GG G G G G G V G G Sbjct: 299 GGAVGGGGGGSVGG-GGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGG 357 Query: 769 FFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GG V G G G GGG R G Sbjct: 358 V-----GGAVGGAVGGAVGGGGGGSVGGGGRGSGG 387 Score = 31.9 bits (69), Expect = 0.65 Identities = 28/90 (31%), Positives = 28/90 (31%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G G G G K Sbjct: 112 GGGGAGGGVGGGVGAGGGAG--GSVGAGGGIGGGAGGAIGG-----GASGGVGGGGKGRG 164 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGGV G G G GGG Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGG 194 Score = 31.5 bits (68), Expect = 0.86 Identities = 28/97 (28%), Positives = 28/97 (28%), Gaps = 1/97 (1%) Frame = -3 Query: 952 GGXXXG-GXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXX 776 GG G G GG G GG G G G G V G G Sbjct: 228 GGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVG 287 Query: 775 XXFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GG V G G G GGG R G Sbjct: 288 GSV-----GGAVGGAVGGAVGGGGGGSVGGGGRGSGG 319 Score = 31.1 bits (67), Expect = 1.1 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 2/98 (2%) Frame = -3 Query: 952 GGXXXG--GXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKX 779 GG G G GG G GG G G G G S G G G Sbjct: 127 GGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGK-SGGGAGGGVGGGVGAGGGA 185 Query: 778 XXXFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GGG G G G GGG G Sbjct: 186 GGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAG 223 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/109 (25%), Positives = 29/109 (26%), Gaps = 2/109 (1%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG G GG G G G G G Sbjct: 122 GGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGA 181 Query: 772 XFFFXXXXGXKGG--GVXXGXGDGXXGXXGGGXRXXXGXXXPXRXVXSG 632 G GG G G G G G G G R G V +G Sbjct: 182 G-------GGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAG 223 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GGG GGG GG G + G G Sbjct: 494 GGAGGGVGGGVGGGVGGG----VRGAVGGAVGGGVGGAGRGSGGASGGAGAGGGAGGGVG 549 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGG 711 G G GGG G GG Sbjct: 550 GGANVGVGVGAGGSTGGGAAGGGG 573 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 40.3 bits (90), Expect = 0.002 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 37.5 bits (83), Expect = 0.013 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP P P Sbjct: 394 PPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 36.7 bits (81), Expect = 0.023 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP PP P Sbjct: 376 PPSPPPPPPPPPPP---PPPPPPPPPPPPPPPPPP 407 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP 413 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P PP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P P PPP P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P PP P P P P P PP PP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 953 XP 958 P Sbjct: 437 PP 438 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 4/41 (9%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPP----PXPPXXXPXPXP 963 P PP P P PPP PP P PP P P P Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 31.9 bits (69), Expect = 0.65 Identities = 23/90 (25%), Positives = 24/90 (26%) Frame = +3 Query: 654 GXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*X 833 G P PPP P P P P PPP P P P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 Query: 834 LNXXXXPXXXPXXXPXXPXXXXPPXXPXXP 923 + P P P P P P P Sbjct: 433 V--YPPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 31.9 bits (69), Expect = 0.65 Identities = 20/72 (27%), Positives = 20/72 (27%), Gaps = 1/72 (1%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P P P P P V P P P P P P PP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Query: 926 -XXPPPXXPPXP 958 PPP P P Sbjct: 442 YVYPPPPPSPQP 453 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/68 (26%), Positives = 18/68 (26%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P P P P P PP P P P P PP P Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Query: 935 PPXXPPXP 958 P PP P Sbjct: 441 PYVYPPPP 448 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 P PP P P PP PPP PP P P P Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPP 449 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPP---PXPPPXPPXXXPXPXP 963 P PP P P PP P PPP PP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYP 426 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PPP P P PP P P P Sbjct: 395 PPPPPPPPPPPPPYVYPSPPPPPPSP-PPYVYPPPPP 430 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/71 (25%), Positives = 18/71 (25%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P P P P P PP P P P P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 926 XXPPPXXPPXP 958 PP P P Sbjct: 437 PPSPPYVYPPP 447 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/79 (22%), Positives = 20/79 (25%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P P P P + P P P + Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPP 446 Query: 846 XXPXXXPXXXPXXPXXXXP 902 P P P P P Sbjct: 447 PPPSPQPYMYPSPPCNDLP 465 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXP 957 P PP P P PPP PPP PP P P Sbjct: 403 PPPPPYVYPSPPPPP--PSPPPYVYPPPPPPYVYPPP 437 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP PP P P P P Sbjct: 418 PSPPPYVYPPPPPPYVYP-PPPSPPYVYPPPPPSPQP 453 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/91 (26%), Positives = 28/91 (30%), Gaps = 1/91 (1%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P PSP P +PPP P+ P P T ++ Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Query: 864 PXXXPXXPXXXXPP-XXPXXPPXXPPXXXPP 953 P P PP P P PP P Sbjct: 143 SVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 Score = 38.3 bits (85), Expect = 0.008 Identities = 26/106 (24%), Positives = 30/106 (28%) Frame = +3 Query: 633 PEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXX 812 P T P PP P PSP P +PPP P+ P P T Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPS 143 Query: 813 PXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 ++ P P P P PP PP P Sbjct: 144 VPSPTPPVS-PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTP 188 Score = 38.3 bits (85), Expect = 0.008 Identities = 27/108 (25%), Positives = 30/108 (27%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P T P PP P PSP P +PPP P+ P P T Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPT 159 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 + P P P P P P P P P Sbjct: 160 PSVPSPTPPVPTDPMPSPPPPVSP--PPPTPTPSVPSPPDVTPTPPTP 205 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/118 (22%), Positives = 34/118 (28%), Gaps = 1/118 (0%) Frame = +3 Query: 603 DGXHXRVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXF 782 DG + P+P + P PP P P+P P P S Sbjct: 69 DGGYTPPAPVPPVSPPP--PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSV 126 Query: 783 XAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXP-PXXPPXXXPP 953 +P P + P + P P P P P P P PP PP Sbjct: 127 PSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPP 184 Score = 32.7 bits (71), Expect = 0.37 Identities = 26/115 (22%), Positives = 30/115 (26%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P PP PP P ++ P P P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPP--PPTPTPSVPS---------PTPPVSPPPPTPTPSV 162 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P + + PP P P P P P P P PP P P Sbjct: 163 PSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTP 217 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/62 (30%), Positives = 21/62 (33%), Gaps = 5/62 (8%) Frame = +2 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXX--PXXXPXPXXPPXXP---PPXXPP 952 P P P +V + PP P P P P P P P P PP PP Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 953 XP 958 P Sbjct: 137 PP 138 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 9/80 (11%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXT----VXTXXXXXXPPXPXXXPXXPXX--PXXXP 907 P P P P P P T V + PP P P P P P Sbjct: 77 PVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Query: 908 XPXXPPXXP---PPXXPPXP 958 P P P PP PP P Sbjct: 137 PPTPTPSVPSPTPPVSPPPP 156 Score = 30.7 bits (66), Expect = 1.5 Identities = 26/116 (22%), Positives = 28/116 (24%), Gaps = 3/116 (2%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P PP PP P ++ P P P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPP--PPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPT 189 Query: 794 PXXXXGPKXXTVXTXXXXXXPPX---PXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P PP P P P P P PP P P P Sbjct: 190 PSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSP 245 Score = 30.3 bits (65), Expect = 2.0 Identities = 25/106 (23%), Positives = 27/106 (25%), Gaps = 1/106 (0%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P T P PP P + P P + P P Sbjct: 147 PTPPVSPPP-PTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXP-XXPPXXPPP 940 P V P P P P P P PP PPP Sbjct: 206 SVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 39.1 bits (87), Expect = 0.004 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GGG GG G G GG G G G Sbjct: 97 GGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGG---GGGSYGGGRR 153 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGW 708 E + GG G G GG G GGW Sbjct: 154 EGGGGY--GGGEGGGYGGSGGGGGW 176 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/90 (27%), Positives = 27/90 (30%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXX 773 GG GG GG GG G G G G + G G G Sbjct: 92 GGGHRGGGGGGYRSGGGGGYSGG--GGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS-- 147 Query: 772 XFFFXXXXGXKGGGVXXGXGDGXXGXXGGG 683 + GGG G G G G GGG Sbjct: 148 ---YGGGRREGGGGYGGGEGGGYGGSGGGG 174 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 38.7 bits (86), Expect = 0.006 Identities = 29/92 (31%), Positives = 32/92 (34%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG G GGG G G P GG G + G G Sbjct: 301 GGGGGYNRGGYSMGGGGGYG-----GGPGDMYGGSYGEPGGGYGGPSGSY-----GGGYG 350 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 + G G GGGG G GG+ G GG Sbjct: 351 SSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGG 382 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/88 (30%), Positives = 29/88 (32%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 G GG G GGG G G GG G + G GG Sbjct: 335 GGGYGGPSGSYGGGYGSSGIGGY-----GGGMGGAGGGGYRGGGGYDMGGVGGGGAGG-- 387 Query: 770 XFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 + GG G GGG G GG G GG Sbjct: 388 --YGAGGGGNGGGSFYGGGGGRGGYGGG 413 Score = 35.1 bits (77), Expect = 0.070 Identities = 35/115 (30%), Positives = 35/115 (30%), Gaps = 3/115 (2%) Frame = -2 Query: 956 GXGXXXGGXGG-GXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXE 780 G G GG GG G GGG G G P G G S G GG Sbjct: 267 GYGGEFGGYGGGGYGGGVG--PYRGEPALGYSGRYGG----GGGGYNRGGYSMGGGGGYG 320 Query: 779 XXXXFFXXGGXGEGGGGXXGXGGWXXGXXG--GXXPXXXGXXXPXPXGXFGEXGY 621 G GE GGG G G G G G G G G GY Sbjct: 321 GGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGY 375 Score = 33.5 bits (73), Expect = 0.21 Identities = 29/110 (26%), Positives = 32/110 (29%), Gaps = 1/110 (0%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXG-GXEXX 774 G G GGG GGG G GG + G G G Sbjct: 230 GGYGDGYGGGHGGGYGGPGGPYKSGGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRG 289 Query: 773 XXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 G GGGG GG+ G GG G G +GE G Sbjct: 290 EPALGYSGRYGGGGGGYNRGGYSMGGGGG----YGGGPGDMYGGSYGEPG 335 Score = 32.7 bits (71), Expect = 0.37 Identities = 24/85 (28%), Positives = 26/85 (30%) Frame = -3 Query: 937 GGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXXFGXXVXXGXGAKXXXXFFFX 758 GG GG G GG G G G + G GA + Sbjct: 335 GGGYGGPSGSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGG-----YG 389 Query: 757 XXXGXKGGGVXXGXGDGXXGXXGGG 683 G GGG G G G G GGG Sbjct: 390 AGGGGNGGGSFYGGGGGRGGYGGGG 414 Score = 31.9 bits (69), Expect = 0.65 Identities = 33/118 (27%), Positives = 35/118 (29%), Gaps = 11/118 (9%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXX--GXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGX- 792 G G G GGG GGG G G P GG G S G Sbjct: 305 GYNRGGYSMGGGGGYGGGPGDMYGGSYGEPGGGYGGPSGSYGGGYGSSGIGGYGGGMGGA 364 Query: 791 -GGXEXXXXFFXXGGXGEGG-------GGXXGXGGWXXGXXGGXXPXXXGXXXPXPXG 642 GG + GG G GG GG G G + G G G P G Sbjct: 365 GGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYGGGGGRGGYGGGGSGRYHPYG 422 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/90 (26%), Positives = 25/90 (27%), Gaps = 1/90 (1%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXF-XAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PP P P P PP P K + P P T P P Sbjct: 41 PPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPP 100 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P P PP P Sbjct: 101 PTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P K P P P PK TV PP P P P P P P P Sbjct: 63 PPTVKPPPPYIPCPPPPYTPKPPTVKP------PPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Query: 935 PPXXPPXP 958 P PP P Sbjct: 117 PTVKPPPP 124 Score = 36.3 bits (80), Expect = 0.030 Identities = 29/111 (26%), Positives = 29/111 (26%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P P P P P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTP 135 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P TV PP P P P P P PP PP PP P Sbjct: 136 YTPPPPTVKP------PPPPVVTPPPPTPTPEAPCPPPPPTPYPP--PPKP 178 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP PP PP P P P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/111 (25%), Positives = 28/111 (25%), Gaps = 2/111 (1%) Frame = +2 Query: 632 PRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLX--PXPXXX 805 P P PP P P P P K P P P Sbjct: 52 PTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYV 111 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P TV PP P P P P P P PP PP P Sbjct: 112 KPPPPPTVKP------PPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPP 156 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P P Sbjct: 68 PPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P P Sbjct: 84 PPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPP 117 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P PP P P PP PP PP P P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPP 155 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPP 109 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/59 (27%), Positives = 17/59 (28%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P + P PP P PPP P P P P P P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTP 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PP PP PP P P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PPP P PP P P P Sbjct: 57 PTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPP 93 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXX-PXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P P PP P P Sbjct: 145 PPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPPKPETCP 182 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/92 (30%), Positives = 30/92 (32%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG GGG GGG G G G G + S Sbjct: 11 GGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSN-RSSYISRDNF 69 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 E GG G+GGGG G G G G Sbjct: 70 ESDPK-GGSGGGGKGGGGGGGISGGGAGGKSG 100 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GG G GG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGG 27 Score = 31.1 bits (67), Expect = 1.1 Identities = 27/98 (27%), Positives = 29/98 (29%), Gaps = 2/98 (2%) Frame = -3 Query: 952 GGXXXGGXXGGXXGXXGGXXXXGXXGXXXGXXXGXXXXXSXHXXX--FGXXVXXGXGAKX 779 GG GG GG G GG G G G S + F G G Sbjct: 22 GGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKGGSGGGG 81 Query: 778 XXXFFFXXXXGXKGGGVXXGXGDGXXGXXGGGXRXXXG 665 G GG G G G G GGG + G Sbjct: 82 KGGGGGGGISGGGAGG-KSGCGGGKSGGGGGGGKNGGG 118 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G+GGGG GG G GG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGG 32 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 37.9 bits (84), Expect = 0.010 Identities = 30/127 (23%), Positives = 39/127 (30%) Frame = +3 Query: 573 DDPYXCKS*RDGXHXRVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPS 752 DDPY ++ R P P+ P P P P P +PPP P Sbjct: 509 DDPYDASPVKN---RRSPPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPP--PV 563 Query: 753 XXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXX 932 + P P ++ P ++ P P P P PP P P Sbjct: 564 YSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP---PVFSPPPPVFSPPPPSPVYSPPP 620 Query: 933 PPXXXPP 953 P PP Sbjct: 621 PSHSPPP 627 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 2/64 (3%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP--XXPPPXX 946 P P P P + PP P P P P P PP PPP Sbjct: 548 PIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVF 607 Query: 947 PPXP 958 P P Sbjct: 608 SPPP 611 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/71 (25%), Positives = 20/71 (28%), Gaps = 3/71 (4%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXP---P 925 P + P P P P + PP P P P P P P Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSP 594 Query: 926 XXPPPXXPPXP 958 PP PP P Sbjct: 595 PPPPVFSPPPP 605 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P PP P P PP PP P P P Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPP 569 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.9 bits (84), Expect = 0.010 Identities = 29/108 (26%), Positives = 30/108 (27%), Gaps = 4/108 (3%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPS---PXPXXTPPPFXPSXXXKKXXXXFXA-PX 794 PLP + P R PPP P S P P PPP P A P Sbjct: 581 PLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPP 640 Query: 795 PXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P PP P PP PP Sbjct: 641 PPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 35.9 bits (79), Expect = 0.040 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P T+ PP P P P P PP PPP PP Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Query: 953 XP 958 P Sbjct: 606 PP 607 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/90 (23%), Positives = 23/90 (25%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P P PPP P P P ++ P Sbjct: 642 PPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAP 701 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P P P PP Sbjct: 702 PPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPP--PXPPPXPPXXXPXPXP 963 P PP P P PP P PPP PP P P Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP 615 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXP 951 P PP G PPP PPP PP P Sbjct: 620 PPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIP 652 Score = 31.9 bits (69), Expect = 0.65 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P + PP P P P P P P PPP PP Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIP--SPSAPPPPPPP 624 Query: 953 XP 958 P Sbjct: 625 PP 626 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/71 (28%), Positives = 20/71 (28%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P L P P P T T PP P P P P Sbjct: 468 PSDPPSSGDHVTLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPP-----PLFMSTTSFSP 522 Query: 926 XXPPPXXPPXP 958 PPP PP P Sbjct: 523 SQPPPPPPPPP 533 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/92 (23%), Positives = 24/92 (26%), Gaps = 1/92 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XL-NX 842 P PPP P P P PPP P P P + P + Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGST 631 Query: 843 XXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P PP PP Sbjct: 632 GNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPP 663 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/51 (29%), Positives = 17/51 (33%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 PP P + + S P PP P PP PPP PP Sbjct: 483 PPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/59 (25%), Positives = 17/59 (28%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P + + PP P PPP P PP P P P Sbjct: 547 PPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/90 (22%), Positives = 21/90 (23%) Frame = +2 Query: 689 PPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPX 868 PP P T P P + P P PP P Sbjct: 643 PPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPP 702 Query: 869 XXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P PP P PP P Sbjct: 703 PLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/109 (23%), Positives = 30/109 (27%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P ++PP PP P P P + P P P Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPP-----------PPPPPSSRSIPSPSAPPPPPP 623 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P + PP P P P P P PPP PP Sbjct: 624 PPPSFGSTGNKRQAQPPPPPPPPP-----PTRIPAAKCAP--PPPPPPP 665 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/59 (25%), Positives = 16/59 (27%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P + P PP P PPP PP P P P Sbjct: 660 PPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPP 718 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +1 Query: 781 SXPPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXP 936 S PP P + + S P PP P PP PPP P Sbjct: 502 SQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLP 553 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 37.5 bits (83), Expect = 0.013 Identities = 24/95 (25%), Positives = 25/95 (26%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P TPPP P P P + P N Sbjct: 63 PTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPE----STNSP 118 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P PP P PP P Sbjct: 119 PPPEVFEPPPPPADEDESPPAPPPPEQLPPPASSP 153 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/109 (22%), Positives = 29/109 (26%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P+ + P PPP P SP P P P+ P P + Sbjct: 18 PPPDTSSDGSAAPPPTDSAPPPSPPADSSPPPAL--PSLPPAVFSPPPTVSSPPPPPLDS 75 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P L P P P PP PP PP Sbjct: 76 SPPPPP--DLTPPPSSPPPPDAPPPIPIVFPPPI--DSPPPESTNSPPP 120 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/104 (23%), Positives = 27/104 (25%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P+ P PPP P P PPP P+ + AP P Sbjct: 91 PPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPP-PPADEDESP----PAPPPPEQ 145 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P P PP PP Sbjct: 146 LPPPASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAPPNAPP 189 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +2 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P PP P P P P P PPP PP P Sbjct: 39 PSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPP--PDLTPPPSSPPPP 93 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 36.7 bits (81), Expect = 0.023 Identities = 25/99 (25%), Positives = 29/99 (29%), Gaps = 3/99 (3%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P R PP P P P +PPP P +P P P ++ Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSPPP--PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Query: 846 XXP---XXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP P PP Sbjct: 569 PPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPP 607 Score = 35.1 bits (77), Expect = 0.070 Identities = 24/108 (22%), Positives = 25/108 (23%) Frame = +2 Query: 635 RXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGP 814 R P PP PP P P P + P P Sbjct: 516 RSPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSP 575 Query: 815 KXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PPP P P Sbjct: 576 PPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPP 623 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/116 (23%), Positives = 29/116 (25%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P PP PP P + P P P Sbjct: 517 SPPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP 576 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P + PP P P P P P P PPP P P Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSP--PPPVFSPPP 630 Score = 35.1 bits (77), Expect = 0.070 Identities = 28/116 (24%), Positives = 30/116 (25%), Gaps = 2/116 (1%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P P PP PP P + P P P P Sbjct: 532 SPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPV--FSPPPPVYSPPPPVHSP 589 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP--XXPPPXXPP 952 P P V + P P P P P P P PP PP Sbjct: 590 PPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 Score = 31.9 bits (69), Expect = 0.65 Identities = 27/107 (25%), Positives = 29/107 (27%) Frame = +3 Query: 633 PEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXX 812 P R P PP P P P P +PPP S P P + Sbjct: 511 PVTKRRSPPPAPVNSPPPPVYSP-PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPP 569 Query: 813 PXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P PP P P P PP Sbjct: 570 PPVFSPPPPVYSPP--PPVHSPPPPVHSPPPPAPVHSPPPPVHSPPP 614 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PPP P PP P P P Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PP PP PP P P P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP P P P P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P P P P PP P P P Sbjct: 583 PPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P Sbjct: 591 PPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPP 624 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 36.7 bits (81), Expect = 0.023 Identities = 30/113 (26%), Positives = 31/113 (27%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G G G G G G G S + S G G Sbjct: 49 GIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGSEAGSYAGSHAGSGSG 108 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 G G GGGG G GG G GG G G G G Sbjct: 109 GRSGS---GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 3/91 (3%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 G GG G G G G G G G S S G GG + Sbjct: 34 GLDLGGIGAGIGIGIGIGGGGSGSGAGAGSGSGGGGSSSSSSSSSSSSSSSGGGGGDAGS 93 Query: 770 XFFXXGGX--GEGGGGXXGXG-GWXXGXXGG 687 G G G GG G G G G GG Sbjct: 94 EAGSYAGSHAGSGSGGRSGSGRGRGSGGGGG 124 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 36.7 bits (81), Expect = 0.023 Identities = 30/118 (25%), Positives = 32/118 (27%), Gaps = 3/118 (2%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P + PP PP + L P P P Sbjct: 47 PQPDPQPPTPPTFQPA-PPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPP 105 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXX---PXXXPXPXXPPXXPPPXXPPXP 958 P P T PP P P P P P P PP PP PP P Sbjct: 106 PPPAITPPPPPAITPPLS--PPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPP 161 Score = 33.9 bits (74), Expect = 0.16 Identities = 25/86 (29%), Positives = 28/86 (32%), Gaps = 1/86 (1%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P P P T P P+ +P P +T P L P Sbjct: 44 PPPPQPD-PQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPL---PPPLSP 99 Query: 864 PXXXPXXPXXXXPPXXP-XXPPXXPP 938 P P P PP P PP PP Sbjct: 100 PQTTPPPPPAITPPPPPAITPPLSPP 125 Score = 28.7 bits (61), Expect = 6.1 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 5/64 (7%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPX--PPP---XPPXXXP 951 PP P + P PP P P PP PPP PP P Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPP 90 Query: 952 XPXP 963 P P Sbjct: 91 KPLP 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/105 (23%), Positives = 27/105 (25%), Gaps = 2/105 (1%) Frame = +2 Query: 644 PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXX 823 P + T PP P P + P P P P P Sbjct: 71 PPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAIT 130 Query: 824 TVX--TXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P P PP PP PP Sbjct: 131 PPPPLATTPPALPPKPLPPPLSP--PQTTPPP--PPAITPPLSPP 171 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PPP P Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSP 78 Score = 28.3 bits (60), Expect = 8.0 Identities = 26/114 (22%), Positives = 30/114 (26%), Gaps = 2/114 (1%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXX--LX 787 P P + P PP PP P T P P + P + Sbjct: 53 PPTPPTFQPAPPANDQPPPPPQSTSPP-PVATTPPALPPKPLPPPLSPPQTTPPPPPAIT 111 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXP 949 P P P + PP P P P P PP PP P Sbjct: 112 PPPPPAITPP---LSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 36.7 bits (81), Expect = 0.023 Identities = 24/102 (23%), Positives = 26/102 (25%) Frame = +3 Query: 648 RXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX 827 R P PPP P P P +PPP P + P P P Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV 549 Query: 828 *XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP PP PP Sbjct: 550 HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 36.3 bits (80), Expect = 0.030 Identities = 27/116 (23%), Positives = 28/116 (24%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P PP PP P P P P + Sbjct: 492 SPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHS 551 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PP P P P P PP PP PP P Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP--PPVHSPPPP 605 Score = 35.1 bits (77), Expect = 0.070 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 P PP P P PPP PPP PP P P P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 Score = 34.3 bits (75), Expect = 0.12 Identities = 29/112 (25%), Positives = 31/112 (27%) Frame = +3 Query: 618 RVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXP 797 R P P P PPP P P P +PPP P P P Sbjct: 490 RRSPPPPPVHSPPPPSPIHSPPPPPVYS-PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Query: 798 XSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 + P P P P P PP P P PP PP Sbjct: 549 VHSPPPPVHSPPPPVHSPP--PPVHSPPPPVHSPPP--PVYSPPPPPVHSPP 596 Score = 32.7 bits (71), Expect = 0.37 Identities = 27/115 (23%), Positives = 28/115 (24%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P P + PP PP P P P P Sbjct: 532 PVYSPPP---PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPP 588 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PP P P P P P P PPP P P Sbjct: 589 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP--PPPVHSPPP 641 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P P Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPP 665 Score = 31.9 bits (69), Expect = 0.65 Identities = 29/118 (24%), Positives = 35/118 (29%), Gaps = 6/118 (5%) Frame = +3 Query: 618 RVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP----FXPSXXXKKXXXXF- 782 R P P+ P PP P +P P P P P+ + F Sbjct: 431 RSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPYDQSPVKFR 490 Query: 783 XAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXP-XXPPXXPPXXXPP 953 +P P P + P P P P PP P PP PP PP Sbjct: 491 RSPPPPPVHSPPPPSPIHSPPPPPVYSP--PPPPPVYSPPPPPPVYSPPPPPPVHSPP 546 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/112 (23%), Positives = 27/112 (24%), Gaps = 3/112 (2%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P + P P P P Sbjct: 567 PPPVHSPPPPVHSPPPPVYSPPPPPVHS----PPPPVHSPPPPVHSPPPPVYSPPPPPPV 622 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXP---XXPXXXPXPXXPPXXPPPXXPP 952 P PP P P P P P PP PP PP Sbjct: 623 HSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPP 674 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPX-PPPXPPXXXPXPXP 963 S P P P P PP PPP PP P P P Sbjct: 500 SPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP 540 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXP 957 P P P P PPP PPP PP P P Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPP 547 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP PP P P Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 P PP P P PPP PP PP P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPP 548 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP P P P P Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPP 621 Score = 28.3 bits (60), Expect = 8.0 Identities = 28/119 (23%), Positives = 29/119 (24%), Gaps = 3/119 (2%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P P PP PP P + P P P P Sbjct: 505 SPIHSPPPP--PVYSPPPPPPVYSPPPPPP---VYSPPPPPPVHSPPPPVHSPPPPVHSP 559 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP---XXPPPXXPPXP 958 P P PP P P P PP PPP P P Sbjct: 560 PPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPP 618 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP P PP P P P Sbjct: 559 PPPPVHSPPPPVHSP-PPPVHSPPPPVYSPPPPP 591 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/71 (30%), Positives = 23/71 (32%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P K P P P P + T PP P P P P P PP Sbjct: 675 PPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPT-PIVHTSSPPPPPPP 733 Query: 926 XXPPPXXPPXP 958 PPP PP P Sbjct: 734 --PPPPAPPTP 742 Score = 32.3 bits (70), Expect = 0.49 Identities = 29/124 (23%), Positives = 32/124 (25%), Gaps = 9/124 (7%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLP-PXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXK---KKXPXX 781 P P P + LP P PP T+ P P P Sbjct: 670 PARSPPPISNSDKKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPP 729 Query: 782 LXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP-----PPXX 946 P P P + PP P P P P P PP P P Sbjct: 730 PPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAPSA 789 Query: 947 PPXP 958 PP P Sbjct: 790 PPPP 793 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G GG G Sbjct: 69 GAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAGGGLG 105 Score = 31.9 bits (69), Expect(2) = 0.032 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GG+ G GG Sbjct: 81 GGLGGGGGGLLGGGGFGGGAGGG 103 Score = 23.4 bits (48), Expect(2) = 0.032 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G G G G G G G G G G GG Sbjct: 54 GGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGG 87 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 35.9 bits (79), Expect = 0.040 Identities = 19/66 (28%), Positives = 22/66 (33%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P ++ P L P P P + PP P P P P PP P Sbjct: 1063 PLPQESPPPLPPLPPSPPPPSPP-LPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSP 1121 Query: 935 PPXXPP 952 PP PP Sbjct: 1122 PPPPPP 1127 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PP PP P P P Sbjct: 1071 PLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 781 SXPPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPX 960 S PP P S P PP P P PP PP PP P P Sbjct: 1068 SPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALF--PPLPPPPSQPPPPPLSPPPSPPPPP 1125 Query: 961 P 963 P Sbjct: 1126 P 1126 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 PLPE + P PPP P PSP P PP PS P P Sbjct: 1056 PLPEDSP------PLPQESPPPLPPLPPSPPP--PSPPLPPSSLPPPPPAALFPPLPPPP 1107 Query: 807 XXP 815 P Sbjct: 1108 SQP 1110 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/62 (25%), Positives = 17/62 (27%) Frame = +2 Query: 773 PXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P + P P P P P P P PPP P Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Query: 953 XP 958 P Sbjct: 1118 PP 1119 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GGW G GG Sbjct: 78 GGGGGGGGGGGGGGGWGWGGGGG 100 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GW G GG Sbjct: 80 GGGGGGGGGGGGGWGWGGGGGGG 102 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G GG GGG GGG G G GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GGG GGG G G G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGG 111 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWG 96 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 72 GGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGG 98 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGG 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 70 GGGGGGGGGGGGGGGGGGGG 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G GG GGG GGG G G GG G Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 35.5 bits (78), Expect = 0.053 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PP PPP PP P Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXP 936 P PP P P PPP PPP P Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPPP 44 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 35.5 bits (78), Expect = 0.053 Identities = 28/92 (30%), Positives = 28/92 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GGG GGG G GG G GG Sbjct: 98 GRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGG- 156 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G G GGGG G GG G GG Sbjct: 157 ---------GYSGGGGGGRYGSGGGGGGGGGG 179 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPP 61 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 34.7 bits (76), Expect = 0.093 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 875 PXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PP PPP PP P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXP 951 PP P P PPP PPP PP P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P + PPP P P P P PPP P P P T Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVT 82 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/71 (26%), Positives = 19/71 (26%) Frame = +2 Query: 740 LXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXX 919 L P P P P P P V PP P P P Sbjct: 37 LFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 Query: 920 PPXXPPPXXPP 952 PP PP PP Sbjct: 97 PPRSQPPPKPP 107 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 P P P P PPP PPP PP Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 S P P P P PPP PPP PP Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPP 63 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 35.5 bits (78), Expect = 0.053 Identities = 29/116 (25%), Positives = 31/116 (26%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P+ P P PP P P P K P P Sbjct: 29 SPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPT--PPKPQPKPAPPP-EP 85 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PK + PP P P P P P P P P P P Sbjct: 86 KPAPPPAPKPVPCPSPPK---PPAPTPKPVPPHGPPPKPAPAPTPAPSPKPAPSPP 138 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P P PP P P P Sbjct: 62 PVPPPACPPTPPKPQPKPAPPPEPKPAPP-PAPKPVP 97 Score = 32.7 bits (71), Expect = 0.37 Identities = 26/97 (26%), Positives = 26/97 (26%), Gaps = 1/97 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPF-XPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNX 842 P P P P PS P P P PS K AP P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP-----KP 58 Query: 843 XXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P P P PP P Sbjct: 59 QPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKP 95 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/100 (23%), Positives = 24/100 (24%) Frame = +2 Query: 659 TLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTX 838 T P PP P P + K P P P PK Sbjct: 5 TPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVP 64 Query: 839 XXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P P PP P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKP 104 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PP PP P P P Sbjct: 56 PKPQPKPVPPPACPPTPPKPQPKPAP 81 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/113 (23%), Positives = 29/113 (25%) Frame = +2 Query: 614 PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPX 793 P P P + PP P P P P K + P + P Sbjct: 8 PSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQ-PKPVPPP 66 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PK PP P P P P P PP P PP Sbjct: 67 ACPPTPPKPQPKPAP-----PPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +1 Query: 853 PXXPPXXXXGX-PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P P P PPP P P P P Sbjct: 40 PKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%), Gaps = 3/40 (7%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPX---XXPXPXP 963 P P P P PPP P P PP P P P Sbjct: 15 PPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSP 54 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 35.1 bits (77), Expect = 0.070 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEX 777 G G GG GGG G G G GG G G GG Sbjct: 89 GGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGR 148 Query: 776 XXXFFXXGGXGEGGGGXXGXGGW 708 GG G GG G GGW Sbjct: 149 REGGGYGGGDGGSYGG--GGGGW 169 Score = 34.7 bits (76), Expect = 0.093 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFX 759 GG GGG GG G G GG G G GG Sbjct: 88 GGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGG--------- 138 Query: 758 XGGXGEGGGGXXGXGGWXXGXXG 690 GG G GGGG GG+ G G Sbjct: 139 -GGRGYGGGGRREGGGYGGGDGG 160 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -3 Query: 748 GXKGGGVXXGXGDGXXGXXGGGXRXXXGXXXPXRXVXSGXG 626 G GGG G G G G GGG G R G G Sbjct: 95 GGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSG 135 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 35.1 bits (77), Expect = 0.070 Identities = 22/88 (25%), Positives = 26/88 (29%), Gaps = 1/88 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P P P +PPP P + P P S ++ Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHS 464 Query: 846 XXPXXXP-XXXPXXPXXXXPPXXPXXPP 926 P P P P P PP Sbjct: 465 SPPPPSPEFEGPLPPVIGVSYASPPPPP 492 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 PP P P PPP PPP PP P P P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPPSP 440 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPP-XPPPXPPXXXPXPXP 963 P PP P P PP PPP PP P P P Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPP 449 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 876 PXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P PP PP PP Sbjct: 403 PSPPIVALPPPPPPSPPLPPPVYSPP 428 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P PP PP PP Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPP 437 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 35.1 bits (77), Expect = 0.070 Identities = 29/118 (24%), Positives = 33/118 (27%), Gaps = 7/118 (5%) Frame = +3 Query: 621 VXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXT-------PPPFXPSXXXKKXXXX 779 V P P+ P + P P P P P P PPP P K Sbjct: 79 VKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPS- 137 Query: 780 FXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P +T P + P P P P P P PP PP Sbjct: 138 --TPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 31.9 bits (69), Expect = 0.65 Identities = 26/109 (23%), Positives = 28/109 (25%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P+ T PP P P + P K P P P Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPT 169 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P T T P P P P P P PP PP P Sbjct: 170 PTPPVVTPPT------PTPPVITPPTPTPPVVTPPTPTPPVITPPTPTP 212 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/97 (24%), Positives = 24/97 (24%) Frame = +2 Query: 668 PXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXX 847 P PP P P P K P P PK TV Sbjct: 39 PPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKP----PTVKPHPKPPTVKPHPKP 94 Query: 848 XXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P PP PPP P P Sbjct: 95 PTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPP 131 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/111 (24%), Positives = 28/111 (25%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P + P P P P P Sbjct: 714 PPPVHSPPPPVHSPPPPVQSPPPPPVFS--PPPPAPIYSPPPPPVHSPPPPVHSPPPPPV 771 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PP P P P P P P PPP P P Sbjct: 772 HSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSP--PPPVFSPPP 820 Score = 34.7 bits (76), Expect = 0.093 Identities = 29/129 (22%), Positives = 33/129 (25%), Gaps = 2/129 (1%) Frame = +3 Query: 573 DDPYXCKS*RDGXHXRVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP--FX 746 +DPY + P E T P PPP P P P +PPP Sbjct: 611 NDPYDASPIKKRRPQPPSPSTEETKTTSPQSPPV-HSPPPPPPVHSPPPPVFSPPPPMHS 669 Query: 747 PSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPP 926 P +P P P P P P PP PP Sbjct: 670 PPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 729 Query: 927 XXPPXXXPP 953 PP Sbjct: 730 PVQSPPPPP 738 Score = 33.9 bits (74), Expect = 0.16 Identities = 28/116 (24%), Positives = 29/116 (25%), Gaps = 1/116 (0%) Frame = +2 Query: 614 PXXXPXPRXY-PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 P P P Y P PP PP P + P P P P Sbjct: 666 PMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHS-----PPPPVHSPPPPVHSP 720 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P PP P P P P P PPP P P Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPP 776 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/96 (25%), Positives = 25/96 (26%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P PP P +P P P Sbjct: 693 PPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPA----PI 748 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP PP PP Sbjct: 749 YSPPPPPVHSPPPPVHSPPPPPVHSPP--PPVHSPP 782 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P PPP P PP P P P Sbjct: 734 PPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 31.5 bits (68), Expect = 0.86 Identities = 26/111 (23%), Positives = 27/111 (24%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P + P P P P P Sbjct: 664 PPPMHSPPPPVYSPPPPVHSPPPPPVHS------------PPPPVHSPPPPVHSPPPPVH 711 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P PP P P P P P PP PP P Sbjct: 712 SPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPP 762 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPX--PPPXPPXXXPXPXP 963 PP P P PPP PPP P P P P Sbjct: 720 PPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/63 (28%), Positives = 21/63 (33%), Gaps = 4/63 (6%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPX----PPPXPPPXPPXXXPX 954 PPSP + + + P PP P P PPP P PP P Sbjct: 626 PPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPP 685 Query: 955 PXP 963 P P Sbjct: 686 PPP 688 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/74 (25%), Positives = 19/74 (25%), Gaps = 3/74 (4%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P P P P P PP P P P P PP Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPP 708 Query: 926 ---XXPPPXXPPXP 958 PPP P P Sbjct: 709 PVHSPPPPVHSPPP 722 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/74 (25%), Positives = 19/74 (25%), Gaps = 3/74 (4%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P P P P P PP P P P P PP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Query: 926 ---XXPPPXXPPXP 958 PPP P P Sbjct: 723 PVHSPPPPVQSPPP 736 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 PP P P PP PP PP P P Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPP 694 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/110 (22%), Positives = 26/110 (23%), Gaps = 1/110 (0%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P PP PP P P P P + P Sbjct: 721 PPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHS--PPPPVHSPPPPPVHSPPPPV 778 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXP-XXPPXXPPPXXPP 952 P PP P P P P P PP P PP Sbjct: 779 HSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTPLPP 828 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PP P P P P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP P PP P P P Sbjct: 706 PPPPVHSPPPPVHSP-PPPVHSPPPPVQSPPPPP 738 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.1 bits (77), Expect = 0.070 Identities = 27/114 (23%), Positives = 30/114 (26%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXP 790 SP P P P T PP P P + P P P P Sbjct: 70 SPPPEPSP---PSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAP-PPANPVSSPPPESSPP 125 Query: 791 XPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P + + PP P P P P PP PP P Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPPSHSP 179 Score = 33.1 bits (72), Expect = 0.28 Identities = 28/115 (24%), Positives = 31/115 (26%), Gaps = 6/115 (5%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPP-----PFXPSXXXKKXXXXFXAP 791 PL P PP P P P P PP P + P Sbjct: 67 PLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPP 126 Query: 792 XPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPP-XXPPXXXPP 953 P + P + P P P P PP P PP PP PP Sbjct: 127 PPPTEAPPTTPITSPSPPTNPPPPPESPPSLP-APDPPSNPLPPPKLVPPSHSPP 180 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/71 (29%), Positives = 22/71 (30%), Gaps = 2/71 (2%) Frame = +2 Query: 746 PXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXP--XXPXXXPXPXX 919 P P P P P GP T+ PP P P P P P Sbjct: 64 PETPLSSPPPEPSPPSPSLT-GPPPTTIPVSP----PPEPSPPPPLPTEAPPPANPVSSP 118 Query: 920 PPXXPPPXXPP 952 PP PP PP Sbjct: 119 PPESSPPPPPP 129 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P G P PPP P P PP P P Sbjct: 75 PSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPP 111 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/61 (27%), Positives = 18/61 (29%), Gaps = 2/61 (3%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPP--PXPPPXPPXXXPXPX 960 PP P + P PP P PP P PPP P P P Sbjct: 102 PPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPD 161 Query: 961 P 963 P Sbjct: 162 P 162 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 34.7 bits (76), Expect = 0.093 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P PP PPP PP P Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPP 42 Score = 32.3 bits (70), Expect = 0.49 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P P Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXP 951 P P PPP PPP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPPRLGP 46 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP PP P P Sbjct: 27 PQPPPPPPPPPPPPPPRLGP 46 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXP 749 R PPP P P P P PP P Sbjct: 23 RAPPPQPPPPPPPPPPPPPPRLGP 46 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 34.7 bits (76), Expect = 0.093 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = +2 Query: 761 KKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPP 940 +K+ P P P G K T PP P P P P P P PPP Sbjct: 645 EKRPPRVPRPPPRSAGGGKS----TNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPP 700 Query: 941 XXPP 952 PP Sbjct: 701 PPPP 704 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP G P P PP PP PP P P P Sbjct: 672 PPLPGGGPPPP---PPPPGGGPPPPPGGGPPPPP 702 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPP 930 P PP G P PPP PPP Sbjct: 680 PPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 34.7 bits (76), Expect = 0.093 Identities = 23/90 (25%), Positives = 25/90 (27%), Gaps = 1/90 (1%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXX-PXXXX*XLNXXXXPXX 860 PP P P P PP + P+ K P S P P Sbjct: 74 PPVKAPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVK 133 Query: 861 XPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P P PP PP P Sbjct: 134 PPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 163 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXX--FXAPXPXSTXXPXXXX*XLNXXXXPX 857 PP P P P PP P+ K AP T P P Sbjct: 94 PPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTKPPVKPP-VYPPTKAPV 152 Query: 858 XXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P P PP PP P Sbjct: 153 KPPTKPPVKPPVYPPTKAPVKPPTKPPVKPP 183 Score = 31.5 bits (68), Expect = 0.86 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPX--STXXPXXXX*XLNXXXXPX 857 PP P P P PP + P+ K P T P P Sbjct: 126 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPP-TKPPVKPPV 184 Query: 858 XXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P P PP PP P Sbjct: 185 SPPAKPPVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/88 (26%), Positives = 24/88 (27%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXP 866 PP P +P T PP P AP T P P P Sbjct: 122 PPVYPPTKAPVKPPTKPPVKPPVYPPTK-----APVKPPTKPPVKPP-VYPPTKAPVKPP 175 Query: 867 XXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P PP PP P Sbjct: 176 TKPPVKPPVSPPAKPPVKPPVYPPTKAP 203 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/85 (24%), Positives = 23/85 (27%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PP P P P PP + P+ K P S P Sbjct: 146 PPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVK-------PPVYP 198 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P P PP PP Sbjct: 199 PTKAPVKPPVSPPTKPPVTPPVYPP 223 Score = 28.7 bits (61), Expect = 6.1 Identities = 21/90 (23%), Positives = 24/90 (26%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PP P P P PP + P+ K P P + P Sbjct: 106 PPVKPPVSPPAKPPVKPPVYPPTKAPVKPPTK--PPVKPPVYPPTKAP--VKPPTKPPVK 161 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P P P PP Sbjct: 162 PPVYPPTKAPVKPPTKPPVKPPVSPPAKPP 191 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/89 (24%), Positives = 25/89 (28%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXP 866 PP P +P T PP P AP T P ++ P P Sbjct: 142 PPVYPPTKAPVKPPTKPPVKPPVYPPTK-----APVKPPTKPPVKPP--VSPPAKPPVKP 194 Query: 867 XXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P PP P P P PP Sbjct: 195 PVYPPTKAPVKPPVSPPTKPPVTPPVYPP 223 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 34.3 bits (75), Expect = 0.12 Identities = 32/114 (28%), Positives = 34/114 (29%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFX 759 GG G G GGG G G GG G W G G Sbjct: 108 GGGGPGYGGG-GYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGP--------- 157 Query: 758 XGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXGYXXVXSISS 597 G G GGGG G GG G G G G G G+ V + S Sbjct: 158 --GYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKGS 209 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/93 (30%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = -2 Query: 962 GXGXGXXXGGX--GGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXG 789 G G G GG GGG GGG G G G G + G G Sbjct: 118 GYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGG----------PGYGSGGGGIG 167 Query: 788 GXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXG 690 G GG G G GG GG G G Sbjct: 168 GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYG 200 Score = 28.7 bits (61), Expect = 6.1 Identities = 25/83 (30%), Positives = 25/83 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G GG GGG G G GG G I G GG Sbjct: 139 GYGSGGGLGWDGGNGGGGPGYGSGGG--GIGGGGGIGGGVIIGGGGGGCGGSCSGGGGG- 195 Query: 782 EXXXXFFXXGGXGEGGGGXXGXG 714 GG G GG G G Sbjct: 196 --------GGGYGHGGVSTKGSG 210 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 28.3 bits (60), Expect(2) = 0.14 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 71 PSPPPPPPPRPP 82 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 105 PPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 106 PPPPPPPPPPPP 117 Score = 26.2 bits (55), Expect(2) = 4.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXP 951 P PPP P P PP P Sbjct: 73 PPPPPPPRPPPPPLSP 88 Score = 24.6 bits (51), Expect(2) = 0.14 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 Query: 913 PPXPPPXPPXXXP 951 PP PPP PP P Sbjct: 105 PPPPPPPPPPPPP 117 Score = 21.4 bits (43), Expect(2) = 4.0 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 925 PPXPPXXXPXPXP 963 PP PP P P P Sbjct: 105 PPPPPPPPPPPPP 117 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPS-PXPXXTPPPFXPSXXXKKXXXXFXAPXP 797 P + PPP P PS P P PPP P KK P P Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPP 940 PP P P P P P P PP PPP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPP--PPP 85 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PP PPP PP P P Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPP 78 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 64 PPPPPPTSPPPPSP---PPPSPPPPSPPPPSPPPP 95 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P PPP P PSP P PPP P Sbjct: 66 PPPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPP 740 PPP P PSP P PPP Sbjct: 77 PPPPSPPPPSPPPPSPPPP 95 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P P P PP PP P P P Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PP P P P P Sbjct: 69 PTSPPPPSPPPPSPPPPSPPPPSPPP 94 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PP P P P P Sbjct: 65 PPPPPTSPPPPSPPPPSPPP 84 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXP--XPXXPPXXPPPXXPPXP 958 PP P P P P P P PP PPP P P Sbjct: 159 PPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXP-PPXPPPXPPXXXPXPXP 963 PP P P P PP PP PP P P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPP 192 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 199 ESMLDTHSLWSNLANEMQHLDDMMKELSLKFPSIINE 309 E MLDT +S++ E++ + D +LSLKF + E Sbjct: 1932 EEMLDTKGRYSSMETELREMHDRYSQLSLKFAEVEGE 1968 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 32.7 bits (71), Expect = 0.37 Identities = 24/85 (28%), Positives = 26/85 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GGG GG G G G G S + G GG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGS 182 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGW 708 G G GGG GG+ Sbjct: 183 GAGGYGGDATGHGGAGGGYGSSGGF 207 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -2 Query: 764 FXXGGXGEGGGGXXGXGGWXXGXXG 690 F GG G GGGG G GG+ G G Sbjct: 125 FGGGGYGGGGGGYGGSGGYGGGAGG 149 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXG 624 GG G G GG G GG+ G GG G G +G G Sbjct: 141 GGYGGGAGGYGGSGGY-GGGAGGYGGNSGGGYGGNAAGGYGGSG 183 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/80 (30%), Positives = 25/80 (31%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFX 759 G GGG GGG G G GG G S G GG + Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGG-YGGSGGYGGGAGGYGGNSGGGYGGNAAGG--YG 180 Query: 758 XGGXGEGGGGXXGXGGWXXG 699 G G GG G GG G Sbjct: 181 GSGAGGYGGDATGHGGAGGG 200 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 32.7 bits (71), Expect = 0.37 Identities = 26/111 (23%), Positives = 28/111 (25%), Gaps = 2/111 (1%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P P PPP P P P PP P +P P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPV 103 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXP--XXPPXXPPXXXPP 953 +N P P P PP P PP P PP Sbjct: 104 NLSPPPP-PVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPP 153 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/97 (23%), Positives = 25/97 (25%), Gaps = 1/97 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXX-TPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNX 842 P PPP P P P +PPP P P P L+ Sbjct: 66 PVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 125 Query: 843 XXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP PP P PP Sbjct: 126 PPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPP 162 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP P P PP P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPP 298 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P P P PPP P P P P Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P P P PPP PP P P P Sbjct: 259 PPGRSAPPPPPAAAPPPQP-PPPPPPKPQPPPPP 291 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPP 740 P PPP P P P P PPP Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPP 291 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/93 (24%), Positives = 27/93 (29%), Gaps = 3/93 (3%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPX---PXSTXXPXXXX*XLNXXXXP 854 PP P P+ P PPP + P P + P + P Sbjct: 102 PPIQKPPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161 Query: 855 XXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP PP PP PP Sbjct: 162 TYSPPIKP--PPVHKPPTPTYSPPIKPPVHKPP 192 Score = 31.1 bits (67), Expect = 1.1 Identities = 22/92 (23%), Positives = 24/92 (26%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPX 857 + PP P P+ P PPP P P P P Sbjct: 454 KPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQ-----PPPVQKPPTPTYSPPVKPPPI 508 Query: 858 XXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P P PP PP Sbjct: 509 QKPPTPTYSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 30.3 bits (65), Expect = 2.0 Identities = 32/121 (26%), Positives = 32/121 (26%), Gaps = 5/121 (4%) Frame = +2 Query: 611 SPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXX---PXKKKXPXX 781 SP P P P PP P T P P K P Sbjct: 383 SPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVH 442 Query: 782 LXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXP-XXPPXXPPP-XXPPX 955 P P K V PP P P P P P PP PPP PP Sbjct: 443 KPPTPIYSPPVKPPPVHK------PPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPT 496 Query: 956 P 958 P Sbjct: 497 P 497 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPP-XXPPXP 958 PP P P P P PP PPP PP P Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/95 (24%), Positives = 27/95 (28%), Gaps = 3/95 (3%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAP---XPXSTXXPXXXX*XLNXXX 848 + PP P P+ P PPP P P T P ++ Sbjct: 571 KPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 630 Query: 849 XPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP PP P Sbjct: 631 TPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVQKP 663 Score = 29.5 bits (63), Expect = 3.5 Identities = 23/96 (23%), Positives = 25/96 (26%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P P PP + P P T P + Sbjct: 53 PSYTTPPPPIYSPPIYPPPIQKPPTYSPPIYPPP-----IQKPPTPTYSPPIYPPPIQKP 107 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP PP P Sbjct: 108 PTPTYSPPIYP--PPIQKPPTPTYSPPIYPPPIQKP 141 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/97 (22%), Positives = 24/97 (24%), Gaps = 1/97 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXS-TXXPXXXX*XLNX 842 P PP P +P PP P K + P P Sbjct: 260 PTPIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPI 319 Query: 843 XXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P P PP PP Sbjct: 320 KPPPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXP-XXPPXXPPP-XXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 327 PPTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP 363 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXP-XXPPXXPPP-XXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 511 PPTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 29.5 bits (63), Expect = 3.5 Identities = 23/95 (24%), Positives = 27/95 (28%), Gaps = 3/95 (3%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAP---XPXSTXXPXXXX*XLNXXX 848 + PP P P+ P PPP P P T P ++ Sbjct: 554 KPPPIHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPP 613 Query: 849 XPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP PP P Sbjct: 614 TPTYSPPIKP--PPVHKPPTPTYSPPIKPPPVHKP 646 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/94 (23%), Positives = 27/94 (28%), Gaps = 2/94 (2%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPF--XPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXX 851 + PP P P+ P PPP P+ P P ++ Sbjct: 151 KPPPVQMPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPT 210 Query: 852 PXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP PP PP P Sbjct: 211 PIYSPPIKP--PPVHKPPTPTYSPPVKPPPVHKP 242 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/109 (23%), Positives = 28/109 (25%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P +P PP P P P K P P Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P T+ PP P P P P P PPP PP Sbjct: 515 --PLPTTIAA------PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPP 555 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/92 (25%), Positives = 24/92 (26%), Gaps = 2/92 (2%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PPP P PPP P F P P P + P Sbjct: 440 PPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPP--PPLPPAVMPLKHFAPPPPTP 497 Query: 864 PXXXPXXPXXXXPPXXPXXPP--XXPPXXXPP 953 P P PP P P PP PP Sbjct: 498 PAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPP 529 Score = 25.8 bits (54), Expect(2) = 0.38 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 910 PPPXPPPXPP 939 PPP PPP PP Sbjct: 454 PPPPPPPPPP 463 Score = 25.4 bits (53), Expect(2) = 0.38 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 904 PXPPPXPPPXP 936 P PPP PPP P Sbjct: 416 PPPPPPPPPPP 426 >At4g16790.1 68417.m02536 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 473 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 280 PSPPPPPPPPPP 291 Score = 25.8 bits (54), Expect(2) = 0.39 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 910 PPPXPPPXPP 939 PPP PPP PP Sbjct: 329 PPPPPPPPPP 338 Score = 25.4 bits (53), Expect(2) = 0.39 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 904 PXPPPXPPPXP 936 P PPP PPP P Sbjct: 283 PPPPPPPPPLP 293 >At5g20130.1 68418.m02396 expressed protein Length = 202 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXG 699 GG G GGGG G GGW G Sbjct: 93 GGKGGGGGGWFGGGGWFSG 111 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/89 (24%), Positives = 24/89 (26%) Frame = +3 Query: 687 PPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXP 866 P P S P PP+ P + P P P L P Sbjct: 296 PYFPPSGQSQPPPTIQPPYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQH---PSGYN 352 Query: 867 XXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P PP PP P Sbjct: 353 PEEPPYPQQSYPPNPPRQPPSHPPPGSAP 381 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPPXXXPXPXP 963 P P PPP PPP PP P P Sbjct: 16 PMRGRVPLPPPPPPPPPPMRRRAPLP 41 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +1 Query: 838 MXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 M P PP P P PPP PPP P P P Sbjct: 17 MRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPM-RRRAPLPPP 57 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.9 bits (69), Expect = 0.65 Identities = 29/121 (23%), Positives = 31/121 (25%), Gaps = 3/121 (2%) Frame = +2 Query: 605 WXS-PXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXX 781 W S P P P YP P P P + P P P Sbjct: 157 WSSDPPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDS 216 Query: 782 LXPXPXXXXG-PKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXP-PX 955 P P P + P P P P P P P P P P P P Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPS 276 Query: 956 P 958 P Sbjct: 277 P 277 Score = 31.5 bits (68), Expect = 0.86 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP P P PP P P P Sbjct: 165 PPPPPYPSPLPPPPSPSPTP 184 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 913 PPXPPPXPPXXXPXPXP 963 PP PPP PP P P P Sbjct: 161 PPLPPPPPPYPSPLPPP 177 Score = 28.7 bits (61), Expect = 6.1 Identities = 16/60 (26%), Positives = 18/60 (30%), Gaps = 1/60 (1%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXP-PXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P + + P P P P P P P P P P P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGP 223 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.9 bits (69), Expect = 0.65 Identities = 26/91 (28%), Positives = 27/91 (29%), Gaps = 1/91 (1%) Frame = +3 Query: 684 PPPXXPXXP-SPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXX 860 PP P P SP P P P P + F A P P P Sbjct: 30 PPLVFPLLPLSPPPSPPPSPSSPP----RLPPPFPALFPPEPPLPPRFELPPPLFPPPPL 85 Query: 861 XPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P PP P PP PP PP Sbjct: 86 PRLPPPLLPPPEEPPREPPPPPP-PPEEPPP 115 Score = 31.9 bits (69), Expect = 0.65 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 1/97 (1%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXK-KXXXXFXAPXPXSTXXPXXXX*XLNX 842 P PPP P PS P PPPF + F P P P Sbjct: 35 PLLPLSPPPSPPPSPS-SPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPP--------- 84 Query: 843 XXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P PP P PP P PP Sbjct: 85 --LPRLPP---PLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P PP PPP PP Sbjct: 77 PPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPP 109 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P PP PPP P P Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P PP PPP PP P Sbjct: 83 PPLPRLPPPL-LPPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXP----PXXPPPXXPP 952 PP P P P P P P P PPP PP Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPP 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P PP PPP PP P P Sbjct: 83 PPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 31.9 bits (69), Expect = 0.65 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXXXFFX 759 GG GG GGG G GG G G GG Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGY------------GGGHGGHYGGGGGHY 92 Query: 758 XGGXGEGGGGXXGXGGWXXGXXGG 687 GG G GGGG G GG G G Sbjct: 93 GGGGGHGGGGHYGGGGHHGGGGHG 116 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 31.9 bits (69), Expect = 0.65 Identities = 26/92 (28%), Positives = 28/92 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G GG GGG GG G G G S + S G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG-----RVSSSGEYSASAGGGGSG 150 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 E GG G+G G G G G Sbjct: 151 EGS----GGGGGGDGSSGSGSGSGSGSGSGTG 178 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXP 957 PPP PPP PP P P Sbjct: 296 PPPSPPPPPPPPPPQP 311 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 298 PSPPPPPPPPPP 309 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 383 PSPPPPPPPPPP 394 Score = 25.8 bits (54), Expect(2) = 0.85 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPP 930 PP P P PPP PPP Sbjct: 373 PPQYQSLIPPPSPPPPPPPPPPP 395 Score = 24.2 bits (50), Expect(2) = 0.85 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PPP PPP P P Sbjct: 421 PAPPPPPPPRYTQFDPQTPP 440 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 31.5 bits (68), Expect = 0.86 Identities = 31/116 (26%), Positives = 31/116 (26%), Gaps = 5/116 (4%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPX--PXXTIXXXXXXXXX-LXPXXPXKKKXPXXLXPX- 793 P P TLPP PP P I L P P P P Sbjct: 274 PNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTL 333 Query: 794 PXXXXGPKXXTVXTXXXXXXPPX-PXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P V PP P P P P P P P P P P P Sbjct: 334 PPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIP 389 >At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 646 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -2 Query: 791 GGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 GG + F GG GG G GG G GG G P P G +G Sbjct: 557 GGRDFRRESFSRGG---GGADYYGGGGGYGGVPGGGYGAMPGGYGPVPGGGYG 606 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.86 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +3 Query: 690 PXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXPX 869 P P P P P +PPP P P P P P P Sbjct: 85 PSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPP----TPSLPPPAPK 140 Query: 870 XXPXXPXXXXPPXXPXXPPXXPP 938 P P PP P P PP Sbjct: 141 KSPSTP--SLPPPTPKKSPPPPP 161 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/100 (24%), Positives = 29/100 (29%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P+P P + PPP P P T PF P KK +P P + Sbjct: 80 PIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLT--PFVPHPTPKKS----PSPPPTPS 133 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPP 926 P + P P P P P PP Sbjct: 134 LPPPAPKKSPSTPSLPPPTPKKSPPPPPSHH-SSSPSNPP 172 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P PP P P P PPP P P P Sbjct: 126 PSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPP 160 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PPP P P PP P P Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPP 477 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/85 (24%), Positives = 23/85 (27%) Frame = +3 Query: 699 PXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXP 878 P P P P PPP+ S P P P + P P Sbjct: 457 PPPPPPSP-SPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPP 515 Query: 879 XXPXXXXPPXXPXXPPXXPPXXXPP 953 PP P PP P PP Sbjct: 516 PYVYSSPPPPPPSPPPPCPESSPPP 540 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/101 (24%), Positives = 29/101 (28%), Gaps = 5/101 (4%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPP----FXP-SXXXKKXXXXFXAPXPXSTXXPXXXX* 830 P PPP P P P P +PPP + P + + P S P Sbjct: 516 PYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYY 575 Query: 831 XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P P P PP Sbjct: 576 PPVTNSPPPPSPVYYPPV-TYSPPPPSPVYYPQVTPSPPPP 615 Score = 29.9 bits (64), Expect = 2.6 Identities = 29/126 (23%), Positives = 32/126 (25%), Gaps = 2/126 (1%) Frame = +3 Query: 579 PYXCKS*RDGXHXRVXPLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXX 758 PY S + P P P PPP P P +PPP P Sbjct: 478 PYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPE-S 536 Query: 759 XKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPP--XX 932 + AP S P P P P PP PP Sbjct: 537 SPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYS 596 Query: 933 PPXXXP 950 PP P Sbjct: 597 PPPPSP 602 Score = 29.5 bits (63), Expect = 3.5 Identities = 30/123 (24%), Positives = 32/123 (26%), Gaps = 4/123 (3%) Frame = +2 Query: 602 RWXSPXXXPXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXX 781 R SP P + P R PP PP P P P P Sbjct: 437 RAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPP- 495 Query: 782 LXPXPXXXXGPKXXTVXTXXXXXX----PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXP 949 P P P V + PP P P P P P P P P Sbjct: 496 --PPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPC-PESSPPPPVVYYAPVTQSP 552 Query: 950 PXP 958 P P Sbjct: 553 PPP 555 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P PPP PPP PP P P Sbjct: 506 PPYVYSSPPPPYVYSSPPP-PPPSPPPPCPESSP 538 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXP 957 P PPP PPP P P P Sbjct: 523 PPPPPSPPPPCPESSPPP 540 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.5 bits (68), Expect = 0.86 Identities = 33/120 (27%), Positives = 35/120 (29%), Gaps = 6/120 (5%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG-XXGXXXXIXXSXXXXWXXSXXGXG- 789 G G G G GGG GGG G G GG G G Sbjct: 81 GFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVDGGAGKGVDGGAGKGFDGGVGKGVDGGAG 140 Query: 788 -GXEXXXXFFXXGGXG---EGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFGEXGY 621 G + GG G EGG G GG G GG G G G G+ Sbjct: 141 KGFDGGVGKGFEGGIGKGIEGGVGKGFDGGAGKGVDGGAIGGIGGGAGKEIGGGIGGGGH 200 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG GGGG GGW G GG Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGG 81 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/92 (27%), Positives = 28/92 (30%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G GG GGG GGG G G G G + + G G Sbjct: 72 GGWIGGSVGGFGGGIGGGFGGGGFGGGAGKGVDGGFGKGVD-GGAGKGVDGGAGKGFDGG 130 Query: 782 EXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G +GG G GG G GG Sbjct: 131 VGKGVDGGAGKGFDGGVGKGFEGGIGKGIEGG 162 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 27.9 bits (59), Expect(2) = 0.91 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G G GGG GGG G GG G Sbjct: 102 GGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTG 138 Score = 22.2 bits (45), Expect(2) = 0.91 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGW 708 GG G GG G G W Sbjct: 133 GGGDTGAGGGVGSGQW 148 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 910 PPPXPPPXPP 939 PPP PPP PP Sbjct: 365 PPPPPPPPPP 374 Score = 25.8 bits (54), Expect(2) = 1.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 910 PPPXPPPXPP 939 PPP PPP PP Sbjct: 394 PPPPPPPPPP 403 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 886 PXXXXXPXPPPXPPP 930 P P PPP PPP Sbjct: 359 PPLVYSPPPPPPPPP 373 Score = 23.8 bits (49), Expect(2) = 1.1 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 886 PXXXXXPXPPPXPPP 930 P P PPP PPP Sbjct: 360 PLVYSPPPPPPPPPP 374 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -2 Query: 797 GXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 G GG + GG G GGG G GG+ G GG Sbjct: 47 GNGGYNGGGGY--NGGGGHNGGGYNGGGGYNGGGHGG 81 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 PPSP Q P PP P P P PPP PP P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTP-PPTPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P PP PP PP Sbjct: 51 PPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPP 83 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P PP PPP P P Sbjct: 60 PPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPP 94 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 P PP P PPP PPP PP Sbjct: 315 PPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P PPP PP P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P Sbjct: 310 PPPPPPPPPPLLQQPPPP 327 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PPP PP P P P Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PPP PP Sbjct: 311 PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXP 749 P + PPP P PSP P PP P Sbjct: 44 PKPVQCPPPPRPSVPSPNPRPVTPPRTP 71 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGGXXPXXXGXXXPXPXGXFG 633 GG G GGGG G GG+ G G G G +G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 797 GXGGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXG 690 G GG + GG GGGG G GG+ G G Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGG 618 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +2 Query: 854 PPXPXXXPXXPXX-----PXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 504 PPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPP 543 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +1 Query: 790 PSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PSP + P PP P P PPP P P PP P P Sbjct: 511 PSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSP-PPPSPSPPPPYIYSSPPP 567 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXP 815 PPP PS PPP P + +P P S P Sbjct: 514 PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPS 752 PPP P P P P PPP PS Sbjct: 223 PPPPPPSQPLPRPLLLPPPPPPS 245 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/88 (26%), Positives = 25/88 (28%), Gaps = 3/88 (3%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKK---XXXXFXAPXPXSTXXPXXXX*XLNXXXXP 854 PPP PSP PP P+ +P P S P N P Sbjct: 95 PPPTSNESPSPPEDSETPPAPPNESNDNNPPPSQDLQSPPPSS---PSPNVGPTNPESPP 151 Query: 855 XXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P PP P P PP Sbjct: 152 LQSPPAPPASDPTNSPPASPLDPTNPPP 179 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 26.6 bits (56), Expect(2) = 1.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG GGG G GG+ G GG Sbjct: 127 GGGSYGGGRREGGGGYGGGEGGG 149 Score = 22.6 bits (46), Expect(2) = 1.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G G G GG GG GG G G GG Sbjct: 102 GGGGGRREGG--GGYSGGGGGYSSRGGGGGSYGG 133 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXP-XPPPXPPPXPPXXXPXPXP 963 S P PP G P P PPP PP P P P Sbjct: 147 SPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXX--PXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXP-XPPPXPPPXPPXXXPXPXP 963 S P PP G P P PPP PP P P P Sbjct: 147 SPSPSRPPKRSRGPPRPPTRPKSPPPRKSSFPPSRSPPPPP 187 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXX--PXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P PP P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPP 406 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP P PP P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P PP P Sbjct: 56 PPSPYPHPHPPP-PSPYPHPHQPPPPPHVLPPPPP 89 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P P P P P P PP P P P Sbjct: 41 PHHPPPPHFSPPHQ---PPPSPYPHPHPPPPSPYPHP 74 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPP--XXPPPXXPPXP 958 PP P P P P P PP P P PP P Sbjct: 44 PPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXX-PXPPPXPPPXPPXXXPXPXP 963 P PP P P P P PP PP P P P Sbjct: 52 PHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPP 89 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P PP PPP P P Sbjct: 69 PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPP 103 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXP 934 P KK+ P P P PK PP P P P P P P Sbjct: 217 PPKKEVPP---PVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVPVYKPPPKIEKPPP 273 Query: 935 PPXXPPXP 958 P P P Sbjct: 274 VPVYKPPP 281 Score = 30.3 bits (65), Expect = 2.0 Identities = 29/111 (26%), Positives = 31/111 (27%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P + +PP PP P P P KK P P Sbjct: 329 PVPVHKPPPKIVIPPPKIEHPPPVPVYKPPPKIEHPPIYIP--PIVKKP----CPPPVPI 382 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P V PP P P P P P P P P PP P Sbjct: 383 YKPP---VVIPKKPCPPPVPVYKPPVVVIPKK-PCPPLPQLPPLPKFPPLP 429 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXG 885 G G G GG GGG GGG G G Sbjct: 122 GGGGGYSYGGGGGGYGGGGGGYGGGG 147 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -3 Query: 739 GGGVXXGXGDGXXGXXGGGXRXXXGXXXPXRXV 641 GGG+ G G G G GGG G P R V Sbjct: 213 GGGLGGGNGSGGGGGGGGGGGRISGGSSPRRHV 245 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 30.3 bits (65), Expect = 2.0 Identities = 27/95 (28%), Positives = 29/95 (30%), Gaps = 3/95 (3%) Frame = -2 Query: 962 GXGXGXXXGGXG---GGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGX 792 G G G GG G GG GGG G GG G + + G Sbjct: 125 GGGYGASDGGYGAPAGGYGGGAGGYGGNSSYSGNAGGGGG------YGGNSSYGGNAGGY 178 Query: 791 GGXEXXXXFFXXGGXGEGGGGXXGXGGWXXGXXGG 687 GG GG G G G G G GG Sbjct: 179 GGNPPYSGNAVGGGGGYGSNFGGGGGYGVAGGVGG 213 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 25.4 bits (53), Expect(2) = 2.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGW 708 GG GEGGGG G GW Sbjct: 72 GGGGEGGGG--GRRGW 85 Score = 23.0 bits (47), Expect(2) = 2.4 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GGG GG G G G G Sbjct: 43 GGAEGGGAWGGGGGGGGAWGGEGEGGGEWGGGGEGGG 79 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +1 Query: 760 QKKXXXXSXPPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 Q K PP P Q P PP P P PPP PPP P Sbjct: 339 QNKPKFSQPPPPPNRAAFQAITQEKS-----PVPPPRRS---PPPLQTPPPPPPPPPLAP 390 Query: 940 XXXPXPXP 963 P P Sbjct: 391 PPPPQKRP 398 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 863 PXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PP PPP P P Sbjct: 40 PLPLPLSPISPPFFPLESSPPSPPPPLPPTPP 71 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 29.9 bits (64), Expect = 2.6 Identities = 22/98 (22%), Positives = 23/98 (23%) Frame = +2 Query: 665 PPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXXTVXTXXX 844 PP PP P T+ P P P P P T Sbjct: 98 PPSTPATTPPAPPQTVSPPPP------PDASPSPPAPTTTNPPPKPSPSPPGETPSPPGE 151 Query: 845 XXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P PP P P Sbjct: 152 TPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDP 189 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/95 (23%), Positives = 23/95 (24%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P PPP P SP P +PPP P P P P Sbjct: 50 PVVSSSPPP--PVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPP 107 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P PP P P Sbjct: 108 APPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPP 142 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 PP P PPP P P PP P P Sbjct: 117 PPPDASPSPPAPTTTNPPPKPSPSPPGETPSP 148 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/90 (24%), Positives = 26/90 (28%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 P P P P P +PPP S +P P S+ P + P Sbjct: 32 PSAPPPVTPPPSPPQSPPPVVSS---SPPPPVVSSPPPSSSPPPSP---PVITSPPPTVA 85 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P PP P P PP P Sbjct: 86 SSPPPPVVIASPPPSTPATTPPAPPQTVSP 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPP---XXPPXP 958 PP P P P P PP PPP PP P Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPP 59 Score = 28.3 bits (60), Expect = 8.0 Identities = 22/89 (24%), Positives = 25/89 (28%), Gaps = 5/89 (5%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPP-----FXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXX 848 PPP P P P +PPP PS +P P P + Sbjct: 40 PPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPP--VVIASP 97 Query: 849 XPXXXPXXXPXXPXXXXPPXXPXXPPXXP 935 P P P PP P P P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPP 126 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXP 951 P PPP PPP PP P Sbjct: 67 PPPPPPPPPPPPLQQP 82 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXP 951 P PPP PPP PP P Sbjct: 120 PPPPPPPPPPPPTITP 135 Score = 29.9 bits (64), Expect = 2.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXP 951 P PPP PPP PP P Sbjct: 151 PPPPPPPPPPPPTITP 166 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 1/67 (1%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXP-PXPXXXPXXPXXPXXXPXPXXPPXX 931 P P P P P P P P P P P P P Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRPL 109 Query: 932 PPPXXPP 952 PPP PP Sbjct: 110 PPPPPPP 116 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 3/23 (13%) Frame = +1 Query: 904 PXPPPX---PPPXPPXXXPXPXP 963 P PPP PPP PP P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSP 83 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P P P PPP P P Sbjct: 54 PEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEP 87 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 29.9 bits (64), Expect = 2.6 Identities = 27/88 (30%), Positives = 28/88 (31%), Gaps = 11/88 (12%) Frame = -2 Query: 938 GGXGGGXG-GGXGXXXXXGXPXXXXGGXX-GXXXXIXXSXXXXWXXSXXGXGGXEXXXXF 765 GG GGG G GG G G P GG G + G GG Sbjct: 4 GGCGGGPGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPG 63 Query: 764 FXXGGXGE---------GGGGXXGXGGW 708 F G G GGGG G G W Sbjct: 64 FGPRGPGPWSGPRGPRPGGGGGPGPGPW 91 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP PPP PP P Sbjct: 6 PPYPPL-PQPPSQNSLAPPPP-PPSLPPPVPPPPP 38 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXX-RXPPPXXPXXPSPXPXXTPPPFXP 749 PLP+ + P PPP P PS P PPP P Sbjct: 10 PLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPP 51 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +1 Query: 838 MXSXXPXXPPXXXXGXPXXXXXPXPPP-XPPPXPP 939 M S P PP P PPP PPP PP Sbjct: 1 MASYRPPYPPLPQPPSQNSLAPPPPPPSLPPPVPP 35 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 PP P PPP PP PP P P Sbjct: 6 PPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPP 37 Score = 25.8 bits (54), Expect(2) = 4.0 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 905 PXPXXPPXXPPPXXPPXP 958 P P PP PPP P P Sbjct: 72 PPPPPPPSAPPPLVPDPP 89 Score = 21.8 bits (44), Expect(2) = 4.0 Identities = 11/46 (23%), Positives = 13/46 (28%) Frame = +2 Query: 788 PXPXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPP 925 P P P ++ P P P P P P PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 29.9 bits (64), Expect = 2.6 Identities = 27/116 (23%), Positives = 30/116 (25%), Gaps = 5/116 (4%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKK--KXPXXLXPX-- 793 P P PP PP T + P P + + P P Sbjct: 53 PPTTTTPPVSAAQPPASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVS 112 Query: 794 PXXXXGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPP-XXPPXP 958 P P T PP P P P P P P P P PP P Sbjct: 113 PPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/58 (29%), Positives = 18/58 (31%), Gaps = 1/58 (1%) Frame = +1 Query: 787 PPSPXXLXXQXXNXXNXMXSXXPXXPPXXXXGXPXXXXXPXPPP-XPPPXPPXXXPXP 957 P +P Q S P PP P P P P PPP P P P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/108 (23%), Positives = 26/108 (24%), Gaps = 3/108 (2%) Frame = +2 Query: 644 PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKX---PXXLXPXPXXXXGP 814 P T PP PP P P P P + P P P Sbjct: 67 PASPVTPPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPP 126 Query: 815 KXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P P PP P P Sbjct: 127 PTPASPPPAPASPPPAPASPPPAPVSP--PPVQAPSPISLPPAPAPAP 172 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 752 GXGEGGGGXXGXGGWXXGXXGG 687 G G+GGGG G GG G GG Sbjct: 67 GGGDGGGGGCGGGGGCGGGGGG 88 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 938 GGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 GG GGG GGG G G GG G Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGG 88 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGG 861 G GG GGG GGG G G GG Sbjct: 60 GGDGGGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/79 (29%), Positives = 23/79 (29%) Frame = -2 Query: 950 GXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 G GG G G G G G G G G S G GG Sbjct: 4 GGYRGGRGDGRGRGGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGD--GHGRGGGGDRGRG 61 Query: 770 XFFXXGGXGEGGGGXXGXG 714 G G GGGG G G Sbjct: 62 YSGRGDGRGRGGGGDRGRG 80 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/83 (26%), Positives = 22/83 (26%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGX 783 G G G G G G G G G G G G GG Sbjct: 17 GGGGDRGRGYSGRGDGRGRGGDGDRGYSGRGDGHGRGGGGDRGRGYSGRGDGRGRGGGGD 76 Query: 782 EXXXXFFXXGGXGEGGGGXXGXG 714 G G GGGG G G Sbjct: 77 RGRGYSGRGDGHGRGGGGDRGRG 99 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPP 939 P P P P PPP PPP PP Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLPPPPPP 40 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXG 903 G G G GG GGG GGG G Sbjct: 71 GAGLGLGGGGFGGGAGGGLG 90 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 2/70 (2%) Frame = +2 Query: 755 PXKKKXPXXLXPXPXXXXGPKXXTVXTXXXXXXPPX-PXXXPXXPXXPXXXPXPXX-PPX 928 P K L P P T PP P P P P P PP Sbjct: 43 PATKPPSPALKPPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPV 102 Query: 929 XPPPXXPPXP 958 PP PP P Sbjct: 103 QPPTYKPPTP 112 Score = 29.1 bits (62), Expect = 4.6 Identities = 26/109 (23%), Positives = 27/109 (24%) Frame = +2 Query: 626 PXPRXYPXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXX 805 P P P T P PP TI + P P P L P Sbjct: 55 PTPSYKPPTLPTTPIKPPTTKPPVKPPTIP--------VTPVKPPVSTPPIKLPPVQPPT 106 Query: 806 XGPKXXTVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P TV P P P PP PP PP Sbjct: 107 YKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPP 155 Score = 28.7 bits (61), Expect = 6.1 Identities = 22/98 (22%), Positives = 23/98 (23%), Gaps = 2/98 (2%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAP--XPXSTXXPXXXX*XLN 839 P PP P P P PP P+ P P Sbjct: 54 PPTPSYKPPTLPTTPIKPPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTPT 113 Query: 840 XXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P P P PP PP PP Sbjct: 114 VKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPP 151 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/90 (25%), Positives = 26/90 (28%), Gaps = 1/90 (1%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PP P P+ P T P P+ + P T P P Sbjct: 121 PPTYKPPTPTVKPPTTSPVKPPTTPPVQSP-----PVQPPTYKPPTSPVKPPTTTPPVKP 175 Query: 864 PXXXPXX-PXXXXPPXXPXXPPXXPPXXXP 950 P P P PP P PP PP P Sbjct: 176 PTTTPPVQPPTYNPPTTPVKPPTAPPVKPP 205 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 1/91 (1%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXXXXPXXX 863 PP P P P PP + P K P P + P Sbjct: 90 PPVSTP--PIKLPPVQPPTYKPPTPTVKPPSV--QPPTYKPPTPTVKPPTTSPVKPPTTP 145 Query: 864 PXXXPXX-PXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P PP P PP Sbjct: 146 PVQSPPVQPPTYKPPTSPVKPPTTTPPVKPP 176 Score = 28.3 bits (60), Expect = 8.0 Identities = 26/104 (25%), Positives = 29/104 (27%), Gaps = 2/104 (1%) Frame = +3 Query: 633 PEXTXRXGXXXPXXXRXPPPXX-PXXPSPX-PXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P T + P + P P P SP P TPP P P +T Sbjct: 110 PTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKPPTT 169 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPP 938 P P P P P P P PP PP Sbjct: 170 TPPVKPPTTTPPVQPPTYNPPTTPVKP----PTAPPVKPPTPPP 209 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P P P P PPP PP Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPP 1151 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P P PP PP P P P Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 962 GXGXGXXXGGXGGGXGGGXGXXXXXGXPXXXXGGXXG 852 G G G GG GG GG G P GG G Sbjct: 185 GGGPGGASGGGPGGASGGASGDKPEGAPGDKPGGAWG 221 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 875 PXXPXXPXXXPXPXXPPXXPPPXXP 949 P P P P P PP PPP P Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPPP 78 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/105 (22%), Positives = 24/105 (22%) Frame = +2 Query: 644 PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXX 823 P T P P P T P P P P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 824 TVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 T PP P P P P P P PP P P Sbjct: 83 PPATPPPVASPPPPVASP-PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP 740 P P T P PPP P +P P +PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/105 (22%), Positives = 24/105 (22%) Frame = +2 Query: 644 PXXRXTLPPXXXXXXPPXPXXTIXXXXXXXXXLXPXXPXKKKXPXXLXPXPXXXXGPKXX 823 P T P P P T P P P P P Sbjct: 23 PTSPPTATPAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Query: 824 TVXTXXXXXXPPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 T PP P P P P P P PP P P Sbjct: 83 PPATPPPVASPPPPVASP-PPATPPPVATPPPAPLASPPAQVPAP 126 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPP 740 P P T P PPP P +P P +PPP Sbjct: 58 PPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP 95 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 865 PXXXXGXPXXXXXPXPPPXPPPXPPXXXPXP 957 P G P PP PPP PP P P Sbjct: 242 PASSLGKRDENSSPFAPPTPPPPPPPPPPRP 272 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/79 (27%), Positives = 24/79 (30%), Gaps = 4/79 (5%) Frame = -2 Query: 938 GGXGGGXGGGXG----XXXXXGXPXXXXGGXXGXXXXIXXSXXXXWXXSXXGXGGXEXXX 771 GG GGG GGG G GG + G GG + Sbjct: 401 GGGGGGDGGGGQGTGIGGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGVT 460 Query: 770 XFFXXGGXGEGGGGXXGXG 714 GG G GGG G G Sbjct: 461 GSDGGGGRGRGGGKVAGGG 479 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 266 PPPPSSPPPPPPPPPTPP 283 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 755 GGXGEGGGGXXGXGGWXXGXXGG 687 GG G+GGGG G GG G G Sbjct: 127 GGGGQGGGGQGGGGGGAEGGTTG 149 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P PP P PP PP PP P P Sbjct: 29 SQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPP 68 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/37 (32%), Positives = 12/37 (32%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PP PP PP P P Sbjct: 24 PTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP 60 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 844 SXXPXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 S P P P PP PP PP P P P Sbjct: 33 SHPPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPP 72 >At5g02600.2 68418.m00195 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At5g02600.1 68418.m00196 heavy-metal-associated domain-containing protein low similarity to gi:3168840 copper homeostasis factor; contains Pfam heavy-metal-associated domain PF00403; predicted proteins, Arabidopsis thaliana Length = 319 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP PP P P Sbjct: 225 PPPPPPPSPPQSSPPSPP 242 >At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) identical to WIP2 protein [Arabidopsis thaliana] gi|18027012|gb|AAL55722; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 383 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXP 957 P PPP PPP PP P Sbjct: 54 PPPPPTPPPSPPLREALP 71 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 853 PXXPPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 P PP P PPP PPP P P P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPPPQLPFGPKLPFP 45 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/106 (23%), Positives = 26/106 (24%), Gaps = 2/106 (1%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P T P P SP P TP PS +P P S Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXP--PXXPXXPPXXPP 938 P P P P P P P P PP Sbjct: 65 PPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPP 110 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P PP PPP PP P P Sbjct: 59 PLPPSLPPPSPPGSLTPPLP 78 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 886 PXXXXXPXPPPXPPPXPP 939 P P PPP PPP PP Sbjct: 36 PTRFFLPHPPPPPPPPPP 53 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 P P P P P PP PPP PP Sbjct: 42 PHPPPPPPPPPPPLYFSYFSLPPPPPPPHLPP 73 >At1g07310.1 68414.m00778 C2 domain-containing protein contains similarity to shock protein SRC2 [Glycine max] gi|2055230|dbj|BAA19769 ; contains Pfam profile PF00168:C2 domain Length = 352 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXP 957 P PPP PPP P P P Sbjct: 169 PSPPPPPPPQAPITAPSP 186 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP P P PP P P P Sbjct: 49 PPPPPSPPPPSCTPSPPP 66 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 Query: 862 PPXXXXGXPXXXXXPXPPPXPPPXPPXXXPXPXP 963 PP P P PP PPP P P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLP 83 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 PP P P P P P PP PP P Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPP 86 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 28.7 bits (61), Expect = 6.1 Identities = 23/95 (24%), Positives = 24/95 (25%) Frame = +3 Query: 666 PXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXSTXXPXXXX*XLNXX 845 P + P P P P P TPP P P P T P Sbjct: 28 PPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPK---PKPAPAPT-PPKPKPAPAPTP 83 Query: 846 XXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 P P P P P P P P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTP 118 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 29 PKPKPAPAPTPPKPKPTPAP 48 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 40 PKPKPTPAPTPPKPKPKPAP 59 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 51 PKPKPKPAPTPPKPKPAPAP 70 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 62 PKPKPAPAPTPPKPKPAPAP 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 73 PKPKPAPAPTPPKPKPKPAP 92 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 84 PKPKPKPAPTPPNPKPTPAP 103 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXPXP 963 P P P P P PP P P P Sbjct: 95 PNPKPTPAPTPPKPKPAPAP 114 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXP 749 R PPP P P P +PPP P Sbjct: 96 RIPPPQPPPPPQPLNLFSPPPPPP 119 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.7 bits (61), Expect = 6.1 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPP--PFXPS 752 P+P T P PP P P P P +PP P PS Sbjct: 56 PMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPS 99 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPP 952 PP P P P P P PP PP P Sbjct: 141 PPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASP 173 >At1g52560.1 68414.m05933 26.5 kDa class I small heat shock protein-like (HSP26.5-P) contains Pfam profile: PF00011 Hsp20/alpha crystallin family; identified in Scharf, K-D., et al,Cell Stress & Chaperones (2001) 6: 225-237. Length = 232 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/79 (15%), Positives = 40/79 (50%) Frame = +1 Query: 181 FSPYVRESMLDTHSLWSNLANEMQHLDDMMKELSLKFPSIINEGRVEGDKYQISIHLPGY 360 F+P + E T + + L ++++ + ++ ++ + + + D Y++ +PG Sbjct: 88 FTPTLNEFFPPT--IGNTLIQATENMNRIFDNFNVNPFQLMGQVKEQDDCYKLRYEVPGL 145 Query: 361 EQKDINVKAKNGVLMVQAN 417 ++D+ + +G+L ++ + Sbjct: 146 TKEDVKITVNDGILTIKGD 164 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 28.7 bits (61), Expect = 6.1 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 904 PXPPPXPPPXPPXXXPXP 957 P PPP PPP PP P Sbjct: 82 PQPPPPPPPPPPSSSRNP 99 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 28.7 bits (61), Expect = 6.1 Identities = 24/108 (22%), Positives = 30/108 (27%) Frame = +3 Query: 627 PLPEXTXRXGXXXPXXXRXPPPXXPXXPSPXPXXTPPPFXPSXXXKKXXXXFXAPXPXST 806 P P+ T + PPP P P PPP+ S + +P P T Sbjct: 650 PTPKPTYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYS----SPPPPYYSPAPKPT 705 Query: 807 XXPXXXX*XLNXXXXPXXXPXXXPXXPXXXXPPXXPXXPPXXPPXXXP 950 + P P P PP P PP P Sbjct: 706 YKSPPPPYVYSSPPPPYYSP--SPKPTYKSPPPPYVYSSPPPPPYYSP 751 >At2g16630.1 68415.m01909 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 359 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 10/30 (33%), Positives = 10/30 (33%) Frame = +3 Query: 864 PXXXPXXPXXXXPPXXPXXPPXXPPXXXPP 953 P P P PP P P P PP Sbjct: 179 PVISPDPPATLPPPKVPVISPDPPTTLPPP 208 Score = 22.6 bits (46), Expect(2) = 7.1 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 Query: 684 PPPXXPXXPSPXPXXTPPPFXP 749 PPP P P P P P P Sbjct: 158 PPPQVPVMPPPQVPVKPHPKVP 179 >At5g46780.2 68418.m05763 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 23.8 bits (49), Expect(2) = 7.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 910 PPPXPPPXPPXXXP 951 PPP PPP P P Sbjct: 102 PPPPPPPPPVQSVP 115 Score = 23.0 bits (47), Expect(2) = 7.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 904 PXPPPXPPP 930 P PPP PPP Sbjct: 101 PPPPPPPPP 109 >At5g46780.1 68418.m05762 VQ motif-containing protein contains PF05678: VQ motif Length = 237 Score = 23.8 bits (49), Expect(2) = 7.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 910 PPPXPPPXPPXXXP 951 PPP PPP P P Sbjct: 102 PPPPPPPPPVQSVP 115 Score = 23.0 bits (47), Expect(2) = 7.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 904 PXPPPXPPP 930 P PPP PPP Sbjct: 101 PPPPPPPPP 109 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 748 GXKGGGVXXGXGDGXXGXXGGG 683 G +GGG G G+G G GGG Sbjct: 95 GARGGGYGYGSGNGRSGGGGGG 116 >At5g55540.1 68418.m06919 expressed protein Length = 1380 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 259 DDMMKELSLKFPSIINEGRVEGDKYQISIH 348 D + SL PSI+ EGR + K+QI+ H Sbjct: 866 DPSSPDSSLLVPSILEEGRGKTQKWQINTH 895 >At4g34920.1 68417.m04951 1-phosphatidylinositol phosphodiesterase-related contains weak similarity to 1-phosphatidylinositol phosphodiesterase precursor (EC 3.1.4.10) (Phosphatidylinositol-specific phospholipase C) (PI-PLC). (Swiss-Prot:P34024) [Listeria monocytogenes] Length = 318 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/36 (27%), Positives = 20/36 (55%) Frame = +1 Query: 184 SPYVRESMLDTHSLWSNLANEMQHLDDMMKELSLKF 291 S Y++++ +DT W+ + ++HL + S KF Sbjct: 209 SDYLKDNWIDTDLPWTKFQSNLKHLSEQQPTSSRKF 244 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 70 GFGGAGGGLGGGLGGGAGSGLGGG 93 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 16 GGGGHGGGAGGGFGGGAGGGGGHG 39 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 129 GGGGGYGGGGGGYGGGGGGYGGGG 152 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXGXP 879 G G GG GGG GG G G P Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPP 84 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 427 PPPPPPPPPPPP 438 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 428 PPPPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 429 PPPPPPPPPPPP 440 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 46 PPPPPRPPPPPP 57 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 202 PQPPPHPPPPPP 213 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 55 PPPPPPPPPPPP 66 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 6 PPPPPPPPPPPP 17 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 7 PPPPPPPPPPPP 18 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 956 GXGXXXGGXGGGXGGGXGXXXXXG 885 G G GG GGG GGG G G Sbjct: 91 GGGGHYGGGGGGYGGGGGHHGGGG 114 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 910 PPPXPPPXPPXXXPXPXP 963 PPP PPP P P P P Sbjct: 38 PPPPPPPPPLSLSPPPSP 55 >At1g68390.1 68414.m07813 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266; expression supported by MPSS Length = 408 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 80 PSPPPPPPPSPP 91 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +2 Query: 857 PXPXXXPXXPXXPXXXPXPXXPPXXPPPXXPPXP 958 P P P P P PP PPP P P Sbjct: 247 PAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPP 280 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 247 PPPPPPPPPPPP 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 248 PPPPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 249 PPPPPPPPPPPP 260 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 250 PPPPPPPPPPPP 261 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 4/39 (10%) Frame = +2 Query: 854 PPXPXXXPXXPXXPXXXPXPXXPPXXPPP----XXPPXP 958 PP P P P P PP PPP PP P Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 >At1g47660.1 68414.m05295 hypothetical protein Length = 275 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 678 RXPPPXXPXXPSPXPXXTPPPFXPS 752 R PP P P P TPPP P+ Sbjct: 27 RAAPPARPTTPPPARPTTPPPVWPT 51 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 904 PXPPPXPPPXPP 939 P PPP PPP PP Sbjct: 235 PGPPPPPPPPPP 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,740,836 Number of Sequences: 28952 Number of extensions: 402147 Number of successful extensions: 10555 Number of sequences better than 10.0: 142 Number of HSP's better than 10.0 without gapping: 1587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5241 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2324382072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -