BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O17 (1055 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 23 5.2 AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esteras... 23 5.2 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 22 9.1 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 22 9.1 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 5.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 176 NFTNKAFFSLH 144 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ850290-1|CAH64510.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.6 bits (46), Expect = 5.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 176 NFTNKAFFSLH 144 NF NKAFF H Sbjct: 20 NFNNKAFFCFH 30 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 544 PPPLXQHHKNSNASKXRXWPKPPPXXFLXIPXAL 645 PPP ++ + + P P P F P A+ Sbjct: 117 PPPARSPYEWIKKTSYQSQPNPEPADFADAPDAI 150 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.8 bits (44), Expect = 9.1 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 544 PPPLXQHHKNSNASKXRXWPKPPPXXFLXIPXAL 645 PPP ++ + + P P P F P A+ Sbjct: 117 PPPARSPYEWIKKTSYQSQPNPEPADFADAPDAI 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,990 Number of Sequences: 336 Number of extensions: 2802 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 30207421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -