BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O16 (958 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 1e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 42 6e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 40 0.003 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.004 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 37 0.021 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 37 0.028 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 37 0.028 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 37 0.028 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 37 0.028 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 36 0.037 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 35 0.085 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 35 0.11 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 34 0.15 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.26 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 33 0.26 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 33 0.34 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 33 0.34 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 33 0.34 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 33 0.34 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 33 0.34 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 33 0.34 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 33 0.34 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 33 0.34 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 33 0.34 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 33 0.34 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 33 0.34 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 33 0.34 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 33 0.34 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 33 0.34 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 33 0.34 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 33 0.34 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 33 0.34 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 33 0.34 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 33 0.34 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 33 0.34 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 33 0.34 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 33 0.34 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 33 0.34 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 33 0.34 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 33 0.34 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 33 0.34 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 33 0.34 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 33 0.34 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 33 0.34 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 33 0.34 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 33 0.34 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 33 0.34 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 33 0.34 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 33 0.34 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 33 0.34 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 33 0.34 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 33 0.34 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 33 0.34 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 33 0.34 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 33 0.34 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 33 0.34 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.34 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 33 0.34 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 33 0.34 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 33 0.34 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 33 0.34 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 33 0.34 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 33 0.34 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 33 0.34 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 33 0.34 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 33 0.34 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 33 0.34 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 33 0.34 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 33 0.34 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.34 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 33 0.34 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 33 0.34 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 33 0.34 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 33 0.34 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 33 0.34 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 33 0.34 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 33 0.34 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 33 0.34 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 33 0.34 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 33 0.34 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 33 0.34 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 33 0.34 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 33 0.34 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 33 0.34 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 33 0.34 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 33 0.34 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 33 0.34 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 33 0.34 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.34 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 33 0.34 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 33 0.34 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 33 0.34 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 33 0.34 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 33 0.34 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.34 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 33 0.34 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 33 0.34 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 33 0.34 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 33 0.34 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.34 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 33 0.34 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 33 0.34 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 33 0.34 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 33 0.34 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 33 0.34 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 33 0.34 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 33 0.34 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 33 0.34 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 33 0.34 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 33 0.34 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 33 0.34 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 33 0.34 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 33 0.34 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 33 0.34 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 33 0.34 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 33 0.34 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 33 0.34 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 33 0.34 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 33 0.34 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 33 0.34 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 33 0.34 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 33 0.34 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 33 0.34 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 33 0.34 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_32638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 393 PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP 423 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P+ P P PPP PP P P PPP PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 41.5 bits (93), Expect = 0.001 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P PPP P P P PPP PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PPP PP P Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP P P Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P PPP PP P Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP P P P PPP PP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PPP PP P Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP P P P PPP PP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P PP P P PPP PP P Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PPP PP P Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PP PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P P P PP P Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P PPP PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P PPP PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 36.3 bits (80), Expect = 0.037 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPP 401 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP P P P PP PP P PP P P L Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPAL 434 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P P PP P PP P PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP P PP P PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP P P PP P PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 375 PPSPPPPPPPPPPSPP-PPPQPPPPPPPPPPPPPPP 409 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P P PP P PP P PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P P PP P PP P PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP P PP P PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P P Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 395 PPPPPPPPPPPPPPPP-PPPPPPPPAPPPPPPPPPP 429 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPP 943 P P P P PPP PP P PP Sbjct: 412 PPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P P PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 42.3 bits (95), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 84 NRPTRGERRFAYWAL 98 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 864 PXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P P P PP PP P PP P PP Sbjct: 468 PPPPPPPPP--PPPPPPPPPPPFPPPPPP 494 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 861 QPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 Q P P PP PP P PP P PP Sbjct: 462 QAPPPPPPPP-PPPPPPPPPPPPPPPPFPP 490 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPP 926 PP P P P PP PP P PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPP 926 PP P P P PP PP P PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPP 926 PP P P P PP PP P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 207 PPPRPPPSPPPPPPPPSPSPPRP-PPPPPPSPPRP 240 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPP--RPPPPPPPSP 237 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P + QP P P PP PP P P P PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 860 PTXXPXPXP-PPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PPP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP PP P P PP PP P Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPP 232 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P P PP P Sbjct: 218 PPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 205 PPPPPRPPPSPPPPPP--PPSPSPPRPPPPPPPSPP 238 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 T P P P P P P P PP PP P Sbjct: 202 TQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P PPP P P PPP P P Sbjct: 222 PSPSP-PRPPPPPPPSPPRPLAAKLPEPPPIPNMP 255 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP P P P PP P P PP P P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRP 240 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P Q P P PP PP P PP P P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRP 229 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PT P P PPP P P PPP PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 36.7 bits (81), Expect(2) = 0.004 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PT P P PPP P P PPP PP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PT P PPP P P PPP PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PT P PPP P P PPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP P P PPP PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPP-XPXXXXPXXXXPPPXPP 952 P P P PPP P P P PPP PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPP-XPXXXXPXXXXPPPXPP 952 P P P PPP P P P PPP PP Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXP---PPXPPXP 958 P P PP PP P P P PP PP P Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 28.7 bits (61), Expect = 7.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 6/35 (17%) Frame = +2 Query: 872 PXPXP---PPXPPXPXXXXPXXXXP---PPXPPXP 958 P P P PP PP P P P PP PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPP 380 Score = 21.8 bits (44), Expect(2) = 0.004 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPP 754 PPPP + P P PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPP 377 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 766 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 807 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 8 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 49 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 31 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 72 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 413 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 454 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 562 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 603 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 30 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 71 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/43 (46%), Positives = 21/43 (48%) Frame = -3 Query: 680 TPAXXPFYGXWPXGGLWVXIXFPGXIPXXWGITXLPPXGGXIP 552 TPA PFYG WP GL + F W IT LPP IP Sbjct: 8 TPATRPFYGSWPFAGLLLTCSFLRYPLILW-ITVLPPLSELIP 49 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ T P P PPP PP P P P PP P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 + P P P P PPP PP P P PPP PP Sbjct: 681 MVPPPPPPPPPPPPPPPPPP----PQPSTPPPPPP 711 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 + P+P P PPP PP P P P PP P Sbjct: 673 ILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPP 709 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P P P PPP PP P P PPP P Sbjct: 682 VPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PPP P P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTP----PPPPPSTP 714 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP P P PP PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPP---PPPSTPP 715 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P P P P PP PP P P P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P + P P P PP PP P PP P PP Sbjct: 677 PIQTMVPPPPPPPPPPPPPP---PPPPPQPSTPPPP 709 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P P PPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 38.3 bits (85), Expect = 0.009 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P PPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPP 1183 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P PPP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXP 907 P P P P PPP PP P Sbjct: 1165 PPPPSSPSPPPPPPPPPP 1182 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCV-DNRIT 58 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 58 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 100 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.012 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 SGG LW NAS AFLR LAF P P DNRIT Sbjct: 16 SGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 58 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP----XXXXPPPXPPXP 958 P P P P PPP PP P P PPP PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYP 133 Score = 34.3 bits (75), Expect = 0.15 Identities = 23/89 (25%), Positives = 25/89 (28%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPP P P PP P + + P P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP P P P PP PP P Sbjct: 210 PYP-PPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 878 PXPP-PXPPXPXXXXPXXXXPPPXPPXP 958 P PP P PP P P PPP PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYP 117 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 4/39 (10%) Frame = +2 Query: 854 PLPTXXPXPXP--PPXPPXPXXXXPXXXXPP--PXPPXP 958 P P P P P PP PP P P PP P PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 33.1 bits (72), Expect = 0.34 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 2/95 (2%) Frame = +2 Query: 680 FXHRPPPPDHXXKXXXPXQRWPXPPXX-IKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXP 856 F PP P P +P PP P S P Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP 147 Query: 857 LPTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP P P Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPP 182 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPN-APYPPPPNPPYPP 134 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 691 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 660 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 696 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 35.9 bits (79), Expect = 0.049 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G Sbjct: 676 GGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 693 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G G G G G G G Sbjct: 682 GGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 774 GDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYG 808 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 793 GGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXV 862 G GG GGG G G GG GGG G G + Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVI 878 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G G Sbjct: 776 GGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDG 810 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G G Sbjct: 799 GGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDG 833 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G GG GGG G G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 33.9 bits (74), Expect = 0.20 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGG 816 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G G Sbjct: 795 GGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G G Sbjct: 828 GGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGG 862 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 948 GXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GGG G G GG GGG G G G G Sbjct: 845 GDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G GG GGG G G G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGG 801 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G GGG G G G Sbjct: 817 GGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGG 851 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G GG GGG G G G G Sbjct: 834 GGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGG 868 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G G GGG G G G Sbjct: 813 GGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 71 GGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGG 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGG 108 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 76 GGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGG 110 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGR 856 G G GGG G G GG GGG G G VGR Sbjct: 83 GDDGDGGGGDGGGGGGGGDGGGGGGGG-GGGVGR 115 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G GGG G G G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGG 100 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP PGERRFAYWAL Sbjct: 49 NRPTPGERRFAYWAL 63 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 36.7 bits (81), Expect = 0.028 Identities = 21/44 (47%), Positives = 22/44 (50%) Frame = -2 Query: 705 SGGGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 +GG LW NAS AFLR LAF P P DNRIT Sbjct: 92 AGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSV-DNRIT 134 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 36.3 bits (80), Expect = 0.037 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PLPTXXPXPX----PPPXPPXPXXXXPXXXXPPPXPP 952 P+P P P PPP PP P P PPP PP Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPP 319 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ P P PP P P PP PP P Sbjct: 309 PSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 35.1 bits (77), Expect = 0.085 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P PPP PP Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPP 720 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +2 Query: 842 SXLXPLPTXXPXPXP-----PPXPPXPXXXXPXXXXPPPXPP 952 S P+P P P P PP PP P PPP PP Sbjct: 706 SGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 4/38 (10%) Frame = +2 Query: 857 LPTXXPXPXPPPX----PPXPXXXXPXXXXPPPXPPXP 958 LP P P PPP PP P P PP PP P Sbjct: 709 LPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP PP P PPP PP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPP 701 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP L P P PP PP PP P P Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G GG GGG G G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGG 53 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P P PPP PP Sbjct: 294 PPPADGSAPAPPPPPP-PGGAPPPPPPPPPPPP 325 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PPP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPX-PPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PP PP P Sbjct: 302 PAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PP P P PPP PP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 872 PXPXPPPXP---PXPXXXXPXXXXPPPXPPXP 958 P P PPP P P P PPP PP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP P PP P PP Sbjct: 292 PPPPPADGSAPAPPPP--PPPGGAPPPPPPPPPPPP 325 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P P PP P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PPL P P PP P PP Sbjct: 75 PPPPAAPPAAPPPPPPLPAP----PPPPAQPAPQPP 106 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPX-PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P PPP P P Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P PPP P P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAP 94 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPPLP 684 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 6/33 (18%) Frame = +2 Query: 872 PXPXPPPX------PPXPXXXXPXXXXPPPXPP 952 P P PPP PP P P PPP PP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PP PP P P PPP PP P Sbjct: 966 PGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP P P PP PP P Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 860 PTXXPXPX---PPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ P P PPP PP P PP PP P Sbjct: 942 PSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 PLP P P PP P P PPP PP Sbjct: 931 PLPPPPPGGSAPSQPPPPGGNAP----PPPPPP 959 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P PPL PP PP P PP Sbjct: 957 PPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -2 Query: 699 GGGLWXNASXXAFLRXLAFXXPLGXNXXSXGXPXXXGDNRIT 574 G LW NAS AFLR LAF P P DNRIT Sbjct: 2 GRSLWKNASNAAFLRFLAFCWPFAHMFYPALSPDSV-DNRIT 42 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPP 952 PPP PP P P PPP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPP 217 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ P P PPP P P P P PP P Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 89 GGGGFGGG-GGGGFGGGGGGGFGGGGGGGGGFGGG 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G G Sbjct: 92 GFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGG 117 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G G GGG G G Sbjct: 100 GFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G G GGG G G G G Sbjct: 90 GGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGG 124 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G Sbjct: 91 GGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 120 NRPTRGERRFAYWAL 134 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 77 NRPTRGERRFAYWAL 91 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 125 NRPTRGERRFAYWAL 139 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 86 NRPTRGERRFAYWAL 100 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 124 NRPTRGERRFAYWAL 138 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 146 NRPTRGERRFAYWAL 160 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 248 NRPTRGERRFAYWAL 262 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 68 NRPTRGERRFAYWAL 82 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 86 NRPTRGERRFAYWAL 100 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 73 NRPTRGERRFAYWAL 87 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 144 NRPTRGERRFAYWAL 158 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 98 NRPTRGERRFAYWAL 112 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 62 NRPTRGERRFAYWAL 76 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 158 NRPTRGERRFAYWAL 172 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 55 NRPTRGERRFAYWAL 69 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 56 NRPTRGERRFAYWAL 70 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 85 NRPTRGERRFAYWAL 99 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 203 NRPTRGERRFAYWAL 217 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 45 NRPTRGERRFAYWAL 59 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 44 NRPTRGERRFAYWAL 58 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 345 NRPTRGERRFAYWAL 359 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 200 NRPTRGERRFAYWAL 214 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 100 NRPTRGERRFAYWAL 114 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 86 NRPTRGERRFAYWAL 100 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 563 NRPTRGERRFAYWAL 577 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 275 NRPTRGERRFAYWAL 289 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 319 NRPTRGERRFAYWAL 333 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 162 NRPTRGERRFAYWAL 176 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 120 NRPTRGERRFAYWAL 134 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 46 NRPTRGERRFAYWAL 60 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 56 NRPTRGERRFAYWAL 70 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 85 NRPTRGERRFAYWAL 99 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 480 NRPTRGERRFAYWAL 494 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 77 NRPTRGERRFAYWAL 91 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 40 NRPTRGERRFAYWAL 54 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 131 NRPTRGERRFAYWAL 145 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 54 NRPTRGERRFAYWAL 68 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 68 NRPTRGERRFAYWAL 82 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 89 NRPTRGERRFAYWAL 103 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 5509 NRPTRGERRFAYWAL 5523 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 105 NRPTRGERRFAYWAL 119 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 192 NRPTRGERRFAYWAL 206 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 15 NRPTRGERRFAYWAL 29 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P P P PP PP P Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P+ P P PP P PP Sbjct: 1246 PPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPP 1281 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 65 NRPTRGERRFAYWAL 79 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 552 NRPTRGERRFAYWAL 566 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 51 NRPTRGERRFAYWAL 65 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 166 NRPTRGERRFAYWAL 180 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 65 NRPTRGERRFAYWAL 79 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 652 NRPTRGERRFAYWAL 666 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 123 NRPTRGERRFAYWAL 137 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 173 NRPTRGERRFAYWAL 187 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 48 NRPTRGERRFAYWAL 62 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 69 NRPTRGERRFAYWAL 83 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 91 NRPTRGERRFAYWAL 105 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 68 NRPTRGERRFAYWAL 82 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 98 NRPTRGERRFAYWAL 112 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 57 NRPTRGERRFAYWAL 71 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 58 NRPTRGERRFAYWAL 72 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 68 NRPTRGERRFAYWAL 82 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 84 NRPTRGERRFAYWAL 98 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 361 NRPTRGERRFAYWAL 375 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 82 NRPTRGERRFAYWAL 96 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 51 NRPTRGERRFAYWAL 65 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 189 NRPTRGERRFAYWAL 203 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 580 NRPTRGERRFAYWAL 594 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 302 NRPTRGERRFAYWAL 316 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 75 NRPTRGERRFAYWAL 89 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 806 NRPTRGERRFAYWAL 820 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 585 NRPTRGERRFAYWAL 599 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 141 NRPTRGERRFAYWAL 155 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 191 NRPTRGERRFAYWAL 205 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 90 NRPTRGERRFAYWAL 104 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 220 NRPTRGERRFAYWAL 234 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 491 NRPTRGERRFAYWAL 505 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 36 NRPTRGERRFAYWAL 50 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 149 NRPTRGERRFAYWAL 163 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 146 NRPTRGERRFAYWAL 160 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 936 NRPTRGERRFAYWAL 950 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 62 NRPTRGERRFAYWAL 76 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 104 NRPTRGERRFAYWAL 118 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 441 NRPTRGERRFAYWAL 455 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 45 NRPTRGERRFAYWAL 59 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 48 NRPTRGERRFAYWAL 62 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 74 NRPTRGERRFAYWAL 88 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 428 NRPTRGERRFAYWAL 442 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 237 NRPTRGERRFAYWAL 251 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 244 NRPTRGERRFAYWAL 258 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 204 NRPTRGERRFAYWAL 218 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 147 NRPTRGERRFAYWAL 161 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 40 NRPTRGERRFAYWAL 54 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 44 NRPTRGERRFAYWAL 58 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 756 NRPTRGERRFAYWAL 770 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 49 NRPTRGERRFAYWAL 63 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 56 NRPTRGERRFAYWAL 70 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 67 NRPTRGERRFAYWAL 81 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 26 NRPTRGERRFAYWAL 40 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 121 NRPTRGERRFAYWAL 135 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 146 NRPTRGERRFAYWAL 160 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 107 NRPTRGERRFAYWAL 121 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 231 NRPTRGERRFAYWAL 245 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 57 NRPTRGERRFAYWAL 71 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 105 NRPTRGERRFAYWAL 119 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 140 NRPTRGERRFAYWAL 154 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 65 NRPTRGERRFAYWAL 79 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 182 NRPTRGERRFAYWAL 196 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 1685 NRPTRGERRFAYWAL 1699 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 107 NRPTRGERRFAYWAL 121 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 75 NRPTRGERRFAYWAL 89 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 119 NRPTRGERRFAYWAL 133 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 77 NRPTRGERRFAYWAL 91 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 105 NRPTRGERRFAYWAL 119 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 44 NRPTRGERRFAYWAL 58 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 84 NRPTRGERRFAYWAL 98 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 53 NRPTRGERRFAYWAL 67 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 947 NRPTRGERRFAYWAL 961 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 94 NRPTRGERRFAYWAL 108 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 91 NRPTRGERRFAYWAL 105 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 427 NRPTRGERRFAYWAL 441 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 57 NRPTRGERRFAYWAL 71 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 109 NRPTRGERRFAYWAL 123 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 187 NRPTRGERRFAYWAL 201 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 475 NRPTRGERRFAYWAL 489 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 82 NRPTRGERRFAYWAL 96 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 473 NRPTRGERRFAYWAL 487 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 95 NRPTRGERRFAYWAL 109 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 53 NRPTRGERRFAYWAL 67 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 53 NRPTRGERRFAYWAL 67 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 51 NRPTRGERRFAYWAL 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 97 NRPTRGERRFAYWAL 111 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 104 NRPTRGERRFAYWAL 118 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 243 NRPTRGERRFAYWAL 257 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 154 NRPTRGERRFAYWAL 168 >SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 81 NRPTRGERRFAYWAL 95 >SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 29 NRPTRGERRFAYWAL 43 >SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 123 NRPTRGERRFAYWAL 137 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 1158 NRPTRGERRFAYWAL 1172 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 54 NRPTRGERRFAYWAL 68 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 74 NRPTRGERRFAYWAL 88 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 59 NRPTRGERRFAYWAL 73 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 12 NRPTRGERRFAYWAL 26 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +3 Query: 450 NRPXPGERRFAYWAL 494 NRP GERRFAYWAL Sbjct: 52 NRPTRGERRFAYWAL 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,787,294 Number of Sequences: 59808 Number of extensions: 251350 Number of successful extensions: 4489 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2940 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -