BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O16 (958 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 42 6e-04 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 42 8e-04 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 38 0.007 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 38 0.007 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 38 0.010 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 38 0.013 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 33 0.023 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 37 0.023 At1g75550.1 68414.m08780 glycine-rich protein 37 0.023 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 36 0.030 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 36 0.030 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 36 0.053 At1g61080.1 68414.m06877 proline-rich family protein 36 0.053 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.069 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 35 0.069 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 35 0.092 At5g46730.1 68418.m05757 glycine-rich protein 35 0.092 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 35 0.092 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 35 0.092 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 35 0.092 At1g11850.2 68414.m01364 expressed protein 35 0.092 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 34 0.12 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 34 0.12 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 34 0.12 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 34 0.16 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.16 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 34 0.16 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.21 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 33 0.21 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 33 0.21 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.21 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 33 0.21 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 33 0.21 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 33 0.28 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 33 0.28 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 33 0.28 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 33 0.28 At1g27710.1 68414.m03387 glycine-rich protein 33 0.28 At1g10620.1 68414.m01204 protein kinase family protein contains ... 33 0.28 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 33 0.37 At4g30460.1 68417.m04325 glycine-rich protein 33 0.37 At4g01985.1 68417.m00265 expressed protein 33 0.37 At1g70990.1 68414.m08190 proline-rich family protein 33 0.37 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 33 0.37 At1g15830.1 68414.m01900 expressed protein 33 0.37 At1g02710.1 68414.m00222 glycine-rich protein 33 0.37 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 32 0.49 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 32 0.49 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 32 0.49 At2g30560.1 68415.m03722 glycine-rich protein 32 0.49 At2g05440.2 68415.m00575 glycine-rich protein 32 0.49 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 30 0.51 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 32 0.65 At4g18570.1 68417.m02749 proline-rich family protein common fami... 32 0.65 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 32 0.65 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 32 0.65 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 32 0.65 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 32 0.65 At4g33660.1 68417.m04781 expressed protein 31 0.86 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 31 0.86 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 0.86 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 0.86 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 31 0.86 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 31 0.86 At5g38560.1 68418.m04662 protein kinase family protein contains ... 31 1.1 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 31 1.1 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 31 1.1 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 1.1 At2g05510.1 68415.m00583 glycine-rich protein 31 1.1 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 31 1.1 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 28 1.4 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 1.5 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 31 1.5 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 1.5 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 31 1.5 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 31 1.5 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 31 1.5 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 31 1.5 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 31 1.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 28 1.8 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 30 2.0 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 30 2.0 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 30 2.0 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 30 2.0 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 30 2.0 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 30 2.0 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 30 2.0 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 2.0 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 30 2.0 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 25 2.5 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 2.6 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 30 2.6 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 30 2.6 At2g43800.1 68415.m05445 formin homology 2 domain-containing pro... 30 2.6 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 30 2.6 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 30 2.6 At1g62240.1 68414.m07021 expressed protein 30 2.6 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 30 2.6 At1g29380.1 68414.m03592 hypothetical protein 30 2.6 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 29 3.5 At4g08230.1 68417.m01358 glycine-rich protein 29 3.5 At3g50180.1 68416.m05486 hypothetical protein 29 3.5 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 29 3.5 At5g42860.1 68418.m05224 expressed protein 29 4.6 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 29 4.6 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 4.6 At3g43583.1 68416.m04636 hypothetical protein 29 4.6 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 29 4.6 At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family... 29 4.6 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 29 4.6 At1g26150.1 68414.m03192 protein kinase family protein similar t... 29 4.6 At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id... 29 6.0 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 6.0 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 6.0 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 29 6.0 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 6.0 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 29 6.0 At1g53625.1 68414.m06096 expressed protein 29 6.0 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 29 6.0 At1g35617.1 68414.m04424 hypothetical protein 29 6.0 At1g15840.1 68414.m01901 expressed protein 29 6.0 At1g11130.1 68414.m01274 leucine-rich repeat family protein / pr... 29 6.0 At1g04660.1 68414.m00463 glycine-rich protein 29 6.0 At5g65630.1 68418.m08256 DNA-binding bromodomain-containing prot... 28 8.0 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 28 8.0 At4g24390.2 68417.m03498 F-box family protein (FBX14) similar to... 28 8.0 At4g24390.1 68417.m03497 F-box family protein (FBX14) similar to... 28 8.0 At4g16240.1 68417.m02464 hypothetical protein 28 8.0 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 28 8.0 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 28 8.0 At3g24550.1 68416.m03083 protein kinase family protein contains ... 28 8.0 At3g08640.1 68416.m01003 alphavirus core protein family contains... 28 8.0 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 28 8.0 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 28 8.0 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 28 8.0 At2g05440.1 68415.m00574 glycine-rich protein 28 8.0 At1g53620.1 68414.m06094 glycine-rich protein 28 8.0 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 28 8.0 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 28 8.0 At1g04800.1 68414.m00476 glycine-rich protein 28 8.0 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 24 8.2 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP P P PPP PP Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 41.9 bits (94), Expect = 6e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP P P PPP PP Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 456 PPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PP PP P P PPP PP Sbjct: 476 PPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 38.3 bits (85), Expect = 0.007 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P P PPP PP Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPP---PXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P PP P P PPP PP P Sbjct: 467 PPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPP 504 Score = 37.1 bits (82), Expect = 0.017 Identities = 37/147 (25%), Positives = 40/147 (27%), Gaps = 5/147 (3%) Frame = +2 Query: 533 SFGCGXPVSXPPKGVXRLSPXXXGXPXEXX--FXPKGXXKAXXRKKAXLLAFXHRPPPPD 706 SF CG VS P V L P P F + + PPPP Sbjct: 385 SFSCGRSVSPRPPVVTPLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP 444 Query: 707 HXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXP 886 P P PP + P S P P P P Sbjct: 445 PPPVYSPPPPPPPPPPPPVYSPPP----PPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPP 500 Query: 887 PPXPPXP---XXXXPXXXXPPPXPPXP 958 PP PP P P PP PP P Sbjct: 501 PPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 35.1 bits (77), Expect = 0.069 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P L P P P PP+ P P PP P PP Sbjct: 420 PPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPP 454 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P PP PP P PP P PP Sbjct: 490 PPPPVYSPPPPPPPPP-PPPVYSPPPPPVYSSPPPP 524 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP PP P PP P PP+ Sbjct: 444 PPPPVYSPPPPPP-PPPPPPVYSPPPPPPPPPPPPPV 479 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP PP P PP P PP+ Sbjct: 459 PPPPVYSPPPPPP-PPPPPPPVYSPPPPSPPPPPPPV 494 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP PP P PP P PP+ Sbjct: 475 PPPPVYSP--PPPSPPPPPPPVYSPPPPPPPPPPPPV 509 Score = 33.9 bits (74), Expect = 0.16 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 2/89 (2%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXI--KIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 PPPP H P Q P PP P L P P Sbjct: 538 PPPPPHSPP---PPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP P P PPP PP Sbjct: 595 PTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPL--XPPXXXXPXPPXXXXPXPP 950 PP P P P PP+ PP P PP P PP Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPP 469 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP P P PP PP P PP P PP+ Sbjct: 427 PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPV 463 Score = 32.3 bits (70), Expect = 0.49 Identities = 21/87 (24%), Positives = 22/87 (25%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP P P PP + P P P Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPT 530 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PP P P PPP P Sbjct: 531 PVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/94 (25%), Positives = 24/94 (25%), Gaps = 5/94 (5%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP R P PP P F P P Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHS 580 Query: 872 PXPX-----PPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PP PP P P P PP P Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 29.5 bits (63), Expect = 3.5 Identities = 23/92 (25%), Positives = 24/92 (26%), Gaps = 3/92 (3%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLX--PLPT 865 PPPP P P PP P + P P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Query: 866 XXPXPXPPPXP-PXPXXXXPXXXXPPPXPPXP 958 P PPP P P P PP PP P Sbjct: 517 VYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPP 548 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PT P PPP P P PP PP Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPP 633 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P P P PP P P PPP P Sbjct: 603 PTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPP 634 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 41.5 bits (93), Expect = 8e-04 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP P P PPP PP Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P+ P P PPP PP P P PPP PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P P P PP P Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P P PPP PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P PPP PP P Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 37.9 bits (84), Expect = 0.010 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPP---PXPPXP 958 P P P P PPP PP P P PP P PP P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P PPP PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.1 bits (82), Expect = 0.017 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 858 CQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 C P P P PP PP P PP P PP Sbjct: 374 CSPPSPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P PPP P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 Score = 35.5 bits (78), Expect = 0.053 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +2 Query: 854 PLPTXXPXPXPP---PXPPXPXXXXPXXXXPPPXPP 952 P P P P PP P PP P P PPP PP Sbjct: 396 PPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 404 PPPPYVYPSPPPP-PPSPPPYVYPPPPPPYVYPPPP 438 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPX---PXXXXPXXXXPPPXPPXP 958 P P+ P PPP PP P P PPP P P Sbjct: 416 PPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQP 453 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXX----PPPXPP 952 P P P P PPP P P P PPP PP Sbjct: 405 PPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPP 441 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 376 PPSPPPPPPPPPPPPPPPPP----PPPPPPPPPPPP 407 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXP---PPXPPXP 958 P P P P P PP P P P PP PP P Sbjct: 414 PPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSP 451 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P P PP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPP-LXP-PXXXXPXPPXXXXPXPP 950 PP P P P PP + P P P PP P PP Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P P PPP PP Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPP 86 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 77 PPCPPPPSPPPSPPPPQLPPPPQL-PPPAPPKP 108 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P PP PP P P P P PP P Sbjct: 81 PPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP PP P P PPP P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPP 97 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PP PP P Sbjct: 66 PPPPCPPPPSPPPCPPPP--SPPPSPPPPQLPPPP 98 Score = 35.9 bits (79), Expect = 0.040 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PPP PP P Sbjct: 52 PEPEPEPADCPPPPPPPP---CPPPPSPPPCPPPP 83 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP PP P PP P PP Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPP 106 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP P P P PP PP Sbjct: 72 PPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 843 PPXXLCQPXXPXPXP-PLXPPXXXXPXPPXXXXPXPP 950 PP P P P P P PP P PP P PP Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPP 98 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP P P P PP P P Sbjct: 86 PPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P PP PP P PPP PP P Sbjct: 56 PPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P P PPP PP P PPP PP P Sbjct: 42 IPCLQNQPPPPPSPPPPSCTPSP---PPPSPPPP 72 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP C P P P PP P P P P PP Sbjct: 55 PPPPSCTPSPPPPSPP-PPKKSSCPPSPLPPPPPPP 89 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP P P PP P P Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPP 84 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 37.9 bits (84), Expect = 0.010 Identities = 27/93 (29%), Positives = 31/93 (33%), Gaps = 3/93 (3%) Frame = +2 Query: 689 RPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTX 868 +PPPP + P + P PP +K P P PT Sbjct: 88 KPPPPPYVKPPPPPTVK-PPPPPYVKPPPP---PTVKPPPPPTPYTPPPPTPYTPPPPTV 143 Query: 869 XPXPXP--PPXPPXPXXXXPXXXXPP-PXPPXP 958 P P P P PP P P PP P PP P Sbjct: 144 KPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 33.9 bits (74), Expect = 0.16 Identities = 24/91 (26%), Positives = 25/91 (27%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H P PP K P P PP K P + P P Sbjct: 59 HTPKPPT--VKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPP 116 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP P P P PP P P Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPPTVKPPP 147 Score = 31.9 bits (69), Expect = 0.65 Identities = 22/86 (25%), Positives = 24/86 (27%) Frame = +2 Query: 695 PPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXP 874 PPP K P P PP +K P + P P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPP----PTPYTPPPPTPYTPPPPTVKPPPPPVVT 152 Query: 875 XPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P P P PPP P Sbjct: 153 PPPPTPTPEAPCPPPPPTPYPPPPKP 178 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP +P P P PP P PP P PP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPP 125 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP +P P P PP P PP P PP Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPP 141 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P P PP P PP P PP+ Sbjct: 115 PPPTVKPPPPPTPYTP-PPPTPYTPPPPTVKPPPPPV 150 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP +P P P PP P PP P PP Sbjct: 98 PPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P PP P P PP P PP Sbjct: 139 PPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P P PP P PP P PP Sbjct: 123 PPPTPYTPPPPTPYTP--PPPTVKPPPPPVVTPPPP 156 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPP-LXPPXXXXPXPPXXXXPXPP 950 P +P P PP + PP P PP P PP Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPP 85 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.5 bits (83), Expect = 0.013 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P PPP PP P Sbjct: 597 PRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXX--PPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 572 PPPPPPPPPPLPSRSIPPPLAQPPPPRPPPP 602 Score = 35.1 bits (77), Expect = 0.069 Identities = 23/89 (25%), Positives = 24/89 (26%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP + P P PP P S Sbjct: 577 PPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQ 636 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 637 AQPPPPPPPPPPTRIPAAKCAPPPPPPPP 665 Score = 35.1 bits (77), Expect = 0.069 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP Q P PP P + P T Sbjct: 622 PPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPST-- 679 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP P P PPP PP Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPP 706 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 4/33 (12%) Frame = +2 Query: 872 PXPXPPPXP----PXPXXXXPXXXXPPPXPPXP 958 P P PPP P P P P PPP PP P Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPP 607 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P L QP P P PP PP P P PP Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPP 622 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 T P P PPP PP PP PP P Sbjct: 479 TLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPP 510 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/90 (24%), Positives = 24/90 (26%), Gaps = 1/90 (1%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP P P PP P F + + Sbjct: 601 PPPPPPPSSRSIPSPSAPPPPPPP--PPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAP 658 Query: 872 PXPXPPPXP-PXPXXXXPXXXXPPPXPPXP 958 P P PPP P PPP PP P Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP P P P P PP Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPP 624 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXP--PPXPPXP 958 P PPP PP P P PP PP P Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXP---XXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLP 553 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 3/40 (7%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPP---XPXXXXPXXXXPPPXPPXP 958 L P T P PPP PP P P P PP P Sbjct: 704 LPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 32.7 bits (71), Expect(2) = 0.023 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXP--PPXPPXP 958 P P+ P P PPP P P P PP PP P Sbjct: 55 PPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPPPPPTP 91 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 854 PLPTXXPXP----XPPPXPPXPXXXXPXXXXPPPXPPXP 958 PLP+ P P PPP P P P PP P P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPP 57 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP P P P P PP P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPP 68 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 860 PTXXPXPXPPPXP-PXPXXXXPXXXXPPPXP 949 P P P P P P P P P PPP P Sbjct: 51 PPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXPPXP 958 P P P PPP P P P P P PP P Sbjct: 45 PPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPP 80 Score = 23.0 bits (47), Expect(2) = 0.023 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXP 751 H PPPP P +P P Sbjct: 42 HHPPPPHFSPPHQPPPSPYPHP 63 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 36.7 bits (81), Expect = 0.023 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P P PPP PP Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP P P PPP PP Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYP---PPPPPPP 53 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXG 877 G GG GGG G G GG GGG G Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G G GGG G G Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGGGG 103 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +2 Query: 854 PLPTXXPXPXP--PPXPPXPXXXXPXXXXPPPXP 949 PLP P P P PP PP P P PPP P Sbjct: 1063 PLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 36.3 bits (80), Expect = 0.030 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +2 Query: 860 PTXXPXPXP----PPXPPXPXXXXPXXXXPPPXPPXP 958 P+ P P P PP PP P P PPP PP P Sbjct: 1088 PSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPP 1124 Score = 35.9 bits (79), Expect = 0.040 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PP PP P P PPP PP Sbjct: 1096 PAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPP 1128 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P PPL PP P PP P PP Sbjct: 1087 PPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPP 1122 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/42 (42%), Positives = 18/42 (42%), Gaps = 5/42 (11%) Frame = +2 Query: 848 LXPLPTXXPXPXPP-P----XPPXPXXXXPXXXXPPPXPPXP 958 L PLP P P PP P PP P P PP PP P Sbjct: 1072 LPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPP 1113 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PPL P P P P PP Sbjct: 1070 PPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPP 1105 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P P PP P PP P PP Sbjct: 1095 PPAALFPPLPPPPSQPPPPPLSPPPSPP--PPPPPP 1128 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP PP P PP Sbjct: 1092 PPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 1065 PQESPPPLPPLP------PSPPPPSPPLP 1087 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 L P P P PPP PP P PPP PP Sbjct: 34 LIPTRFFLPHPPPPPPPPPPPLYFSYFSLPPPPPP 68 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP PP P PPP PP Sbjct: 45 PPPPPPPPPPLYFSYFSLPPPPPPP 69 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.5 bits (78), Expect = 0.053 Identities = 27/96 (28%), Positives = 28/96 (29%), Gaps = 5/96 (5%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP H P P PP P + P P Sbjct: 557 HSPPPPVHSPP---PPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPV 613 Query: 866 XXPXPXPP---PXPPXPXXXXPXXXXPPP--XPPXP 958 P P PP P PP P PPP PP P Sbjct: 614 YSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPP 649 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/89 (25%), Positives = 23/89 (25%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP H P P PP P P P Sbjct: 571 HSPPPPVH--SPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPP 628 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PP P P PP PP Sbjct: 629 VFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 33.1 bits (72), Expect = 0.28 Identities = 23/93 (24%), Positives = 26/93 (27%), Gaps = 4/93 (4%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP P P PP + P S P+ + Sbjct: 499 HSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHS 558 Query: 866 XXPXPXPPP----XPPXPXXXXPXXXXPPPXPP 952 P PP PP P P PP PP Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 843 PPXXLCQPXXPXPX--PPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP PP P PP P PP+ Sbjct: 511 PPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPV 549 Score = 31.9 bits (69), Expect = 0.65 Identities = 25/94 (26%), Positives = 27/94 (28%), Gaps = 5/94 (5%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 P P D + +R P PP P S P P Sbjct: 476 PQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYS 535 Query: 872 PXPXPP---PXPPXPXXXXPXXXXPPP--XPPXP 958 P P PP P PP P PPP PP P Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/91 (26%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP H P P PP P S P+ + Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP 553 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P P P PP P PPP PP P Sbjct: 554 P-PVHSPPPPVHSPPPPVHSPPPPVHSPPPP 583 Score = 30.3 bits (65), Expect = 2.0 Identities = 31/137 (22%), Positives = 33/137 (24%), Gaps = 3/137 (2%) Frame = +2 Query: 551 PVSXPPKGVXRLSPXXXGXPXEXXFXPKGXXKAXXRKKAXLLAFXHRPPPPDHXXKXXXP 730 PV PP V P P P + PPPP H P Sbjct: 541 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPP---P 597 Query: 731 XQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXP---PPXPP 901 P PP P + P P P P PP PP Sbjct: 598 PVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Query: 902 XPXXXXPXXXXPPPXPP 952 P PP PP Sbjct: 658 VKSPPPPPVYSPPLLPP 674 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/88 (22%), Positives = 21/88 (23%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 + PPPP P PP P P P Sbjct: 525 YSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 584 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P P PP P P PP P Sbjct: 585 YSPPPPPVHSPPPPVHSPPPPVHSPPPP 612 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP P P PP P PP Sbjct: 496 PPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPP 531 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/87 (28%), Positives = 27/87 (31%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPP K P P PP + + F PLPT Sbjct: 462 PPPAVMPLKHFAPPPPPPLPPAVMPLKH-FAPPPPTPPAFKPLKGSAPPPPPPPPLPTTI 520 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP PP P PPP PP Sbjct: 521 AAPPPPPPPPRAAVAPP----PPPPPP 543 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP PPP PP P Sbjct: 436 PLPSPPPTPPIADIAISMPPPPPPPPPPP 464 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 455 PPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P PPP PP P Sbjct: 502 PLKGSAPPPPPPPPLPTTIAA----PPPPPPPP 530 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 872 PXPXPPPX----PPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P PPP PP P Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P+P PP PP P PPP PP Sbjct: 579 PMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PPP PP Sbjct: 528 PPPRAAVAPPPPPPPPGTAAAPP----PPPPPP 556 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PPP PP Sbjct: 541 PPPGTAAAPPPPPPPPGTQAAPP----PPPPPP 569 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP PP P P P PP Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPP 441 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 35.1 bits (77), Expect = 0.069 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PLP P PPP PP P PPP PP P Sbjct: 673 PLPGGGPP--PPPPPPGGGPPPPPGGGPPPPPPPP 705 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P PPP PP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 8/41 (19%) Frame = +2 Query: 854 PLPTXXPXPXPP--------PXPPXPXXXXPXXXXPPPXPP 952 P PT P P PP P PP P PPP PP Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP P PP PP P Sbjct: 239 PDPTPPPPPPPPIPVKQSATPPPPPPP 265 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.7 bits (76), Expect = 0.092 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PPP PP P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPP 734 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PP PP P PPP PP P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P PPP PP P Sbjct: 687 PRPPPPP-PPPPMQHSTVTKVPPPPPPAP 714 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 T P P PP P P PPP PP P Sbjct: 704 TKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPP 735 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXP-XXXXPXXXXPPPXPPXP 958 P P P PPP PP P PP PP P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAP 760 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 LPT P PP PP P PP PP Sbjct: 763 LPTHSASPPPPTAPPPPPLGQTRAPSAPPPPP 794 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP P PPP PP P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAP 717 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXP-PPXPPXP 958 LP P P PPP P P PP PP P Sbjct: 686 LPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P PPP PP P Sbjct: 708 PPPPPAP-PAPPTPIVHTSSPPPPPPPPPPPAP 739 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 34.7 bits (76), Expect = 0.092 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G GGG G G G G Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGG 242 Score = 33.1 bits (72), Expect = 0.28 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGG-XGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 35 GGGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAG 70 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GG G G G G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGG 227 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GG G GG GGG G G G G Sbjct: 40 GGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYG 74 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G G G G G G G Sbjct: 250 GYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG G G G G G G Sbjct: 213 GGGGSGGGGAYGGGGAHG-GGYGSGGGEGGGYGGG 246 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G G GGG G G G Sbjct: 86 GHGGGGGGAASSGGYASG-AGEGGGGGYGGAAG 117 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG G G G G G G Sbjct: 105 GEGG-GGGYGGAAGGHAGGGGGGSGGGGGSAYGAG 138 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 GG GGG G G GG GGG G G G Sbjct: 191 GGEGGG-AGGGGSHGGAGGYGGGGGGGSGGG 220 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G G GGG G G G Sbjct: 170 GHGGGGGGGSAGGAH--GGSGYGGGEGGGAGGG 200 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXG-GGXGXGXXVGRG 853 G G GGG G G GG GG G G G G Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEG 260 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSP--PPPSPPPP 95 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PP PP P P P P PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPPSP 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP P P P PP PP P PP P P Sbjct: 65 PPPPPTSPPPPSPPPPSPPP----PSPPPPSPPPP 95 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 34.7 bits (76), Expect = 0.092 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 PL P P PPP PP P P PPP PP Sbjct: 36 PLFPQSPPPPPPPPPPPP----PPPPPPPPPPP 64 Score = 34.7 bits (76), Expect = 0.092 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP PPP PP Sbjct: 48 PPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPP 80 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 35 PPLFPQSPPPPPPPPP---PPPPPPPPPPPPPP 64 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PPP PP P PP PP Sbjct: 47 PPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPP 952 PPP PP P PPP PP Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPP 97 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPP 926 PP P P P PP PP P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPP 62 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 34.7 bits (76), Expect = 0.092 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P P P PP PP P Sbjct: 38 PQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTP 72 Score = 34.7 bits (76), Expect = 0.092 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P P P PP PP P Sbjct: 73 PKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXPP 952 P P P P PPP P P P P P P PP Sbjct: 32 PSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P+ P P P P PP P P P PP Sbjct: 50 PCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXPPXP 958 P P P P PPP P P P P P P P P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPP 114 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P PP P P P PP P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P PP P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAP 89 Score = 32.3 bits (70), Expect = 0.49 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 P C P P P P PP P PP P P Sbjct: 64 PPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVP 97 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P PPP P P P P P P P Sbjct: 44 PAPSPSPCPSPPP-KPQPKPVPPPACPPTPPKPQP 77 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXP-PPXPPXPXXXXPXXXXPPPXP-PXP 958 P P P P P PP PP P PPP P P P Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAP 125 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P P P P P P PP P P Sbjct: 26 PGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQP 60 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P PP P PP P P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKP 62 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PP PP P P P PP Sbjct: 58 PQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P PP P P P P P Sbjct: 75 PQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTP 109 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P P P P P P P Sbjct: 48 PSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP +P P PP P P PP P PP Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 P PP K P + P PP K P P PT Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPK-PVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPA 128 Query: 872 PXPXPPPXPPXP 907 P P P P PP P Sbjct: 129 PSPKPAPSPPKP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P P P PP P P Sbjct: 85 PKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPP 119 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 860 PTXXPXPXP-PPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP P P P P P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPP 55 Score = 28.7 bits (61), Expect = 6.0 Identities = 22/88 (25%), Positives = 22/88 (25%) Frame = +2 Query: 695 PPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXP 874 PPP K P P PP P P P P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Query: 875 XPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP P P P P PP P Sbjct: 114 PHGPPP-KPAPAPTPAPSPKPAPSPPKP 140 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G GG GGG G G Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGGAGGG 103 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 L P+PT P P PP P P PPP P P Sbjct: 324 LPPIPTIPTLPPLPVLPPVPIVNPPSLPPPPPSFPVP 360 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P P PP P PP PP P Sbjct: 320 PTPTLPPIPTIPTLPPLPVLPPVPIVNPPSLPPPP 354 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXP--PPXPPXP 958 L P+P P PPP P P P P PP P P Sbjct: 339 LPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIP 377 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 857 LPTXXPXPXPPPXP--PXPXXXXPXXXXPPPXPPXP 958 +PT P P PP P P P P P PP P Sbjct: 330 IPTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVP 365 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 34.3 bits (75), Expect = 0.12 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 + P+P P P P PP P P PPP P Sbjct: 54 MSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMP 87 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP P P PPP P P Sbjct: 50 PPPVMSPMPMMTP-PPMPMTPPPMPMTPPPMPMAP 83 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GG G G GG GGG G G G G Sbjct: 123 GGGGYSGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G GG GG G G G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAG 161 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GG G G GG GG G G Sbjct: 142 GYGGGAGGYGGSGGYGGGAGGYGGNSGGG 170 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXG 877 G G GGG G G GG GGG G Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAG 148 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P PP PP P PP P PP+ Sbjct: 519 PPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPV 555 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP PP P P P PP P Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 31.5 bits (68), Expect = 0.86 Identities = 25/95 (26%), Positives = 27/95 (28%), Gaps = 8/95 (8%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSX-LXPLPTX 868 PPPP + P P PP P + P P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVH 610 Query: 869 XPXPXPP---PXP----PXPXXXXPXXXXPPPXPP 952 P P PP P P P P P PPP PP Sbjct: 611 SPPPPPPVYSPPPPVFSPPPSQSPPVVYSPPPRPP 645 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 854 PLPTXXPXP--XPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P PP PP P P PP PP Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P PP P PP P PP Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP 561 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP P PP P PP+ Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPV 625 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P PP P P PP P PP+ Sbjct: 536 PPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPV 572 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP P PP P PP Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPP 562 Score = 30.3 bits (65), Expect = 2.0 Identities = 25/96 (26%), Positives = 26/96 (27%), Gaps = 5/96 (5%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXX---FXXXXXXXXXXXXXXXXXXXXSXLXP 856 H PPPP H P P PP + P S P Sbjct: 541 HSPPPPVHSPPPP-PVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPP 599 Query: 857 LPTXXPXPX--PPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP PP P PPP P Sbjct: 600 APVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 29.5 bits (63), Expect = 3.5 Identities = 21/89 (23%), Positives = 24/89 (26%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 + PPPP P P PP P S P+ + Sbjct: 531 YSPPPPPPPVHSPPPPVHSPPPPPVYSPPPP--PPPVHSPPPPVFSPPPPVYSPPPPVHS 588 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PP P P PPP PP Sbjct: 589 PPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP P P PP PP P PP P P Sbjct: 544 PPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/91 (24%), Positives = 25/91 (27%), Gaps = 4/91 (4%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXI-KIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTX 868 PPPP + P P PP P + + P Sbjct: 526 PPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Query: 869 XPXPXPP---PXPPXPXXXXPXXXXPPPXPP 952 P PP P PP P P PP PP Sbjct: 586 VHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP + P P P PP P PP P P Sbjct: 551 PPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPP-PXPPXPXXXXPXXXXPPPXPP 952 P P P P P P PP P P PPP PP Sbjct: 152 PPPESLPPPSPESPSPPSPEPPPPSSLEPPPPPP 185 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P+ P P PPP PP P PPP P Sbjct: 16 PMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPP 47 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP PP P PPP PP Sbjct: 16 PMRGRVPLPPPPPPPPPPMRRRAPLPPPPPP 46 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PLPTXXPXPX----PPPXPPXPXXXXPXXXXPPPXPP 952 PLP P P P P PP P PPP PP Sbjct: 39 PLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPP 75 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PPP PP Sbjct: 31 PPPMRRRAPLPPPPPPPMRRRAP---LPPPPPP 60 Score = 29.5 bits (63), Expect(2) = 0.37 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP PPP PP P Sbjct: 45 PPPMRRRAPLPPP-PPPAMRRRVLPRPPPPPPPLP 78 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +2 Query: 854 PLPTXXPXPXPP-----PXPPXPXXXXPXXXXPPPXPP 952 PLP P P PP P PP P PP PP Sbjct: 22 PLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 21.8 bits (44), Expect(2) = 0.37 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIP 772 PPPP + P P PP + P Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAP 53 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPP--XPXXXXPXXXXPPPXPP 952 P P P P PPP PP P PPP PP Sbjct: 267 PPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +1 Query: 637 PPKGQXP*KGXXAGVXP*APPP*PPXKXXXPXSKVAXPP 753 PP P A P PPP PP P K+A PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPP 297 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPP---XPPXP 958 P P PPP PP P P PP PP P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +2 Query: 857 LPTXXPXPXPPP---XPPXPXXXXPXXXXPPPXP 949 LP P PPP PP P P PPP P Sbjct: 258 LPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPPP 291 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/93 (25%), Positives = 27/93 (29%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P + PP I P P PT Sbjct: 173 HKPPTPTYSPPIKPPVHK---PPTPIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPT 229 Query: 866 XXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P P PP P Sbjct: 230 YSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTP 262 Score = 33.1 bits (72), Expect = 0.28 Identities = 24/93 (25%), Positives = 26/93 (27%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P PP P L P PT Sbjct: 627 HKPPTPTYSPPIKPPPVH--KPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPT 684 Query: 866 XXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P P PP P Sbjct: 685 YSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTP 717 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/93 (24%), Positives = 27/93 (29%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P + PP P + P PT Sbjct: 644 HKPPTPTYSPPIKPPPVQ--KPPTPTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPT 701 Query: 866 XXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P P PP P Sbjct: 702 YSPPVKPPPVQVPPTPTYSPPIKPPPVQVPPTP 734 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTP 497 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 328 PTPTYSPPIKPPPVKPPTPIYSPPVKPPPVHKPPTP 363 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPPIKPPPVHKPPTP 547 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 125 PTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTP 161 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/93 (26%), Positives = 28/93 (30%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P + PP I P P PT Sbjct: 257 HKPPTPIYSPPVKPPPVQ--TPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPT 314 Query: 866 XXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P PP PP P Sbjct: 315 YSPPIKPPPVQKPPTP-TYSPPIKPPPVKPPTP 346 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 478 PTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 91 PTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 127 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 108 PTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 144 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P PP PP P Sbjct: 495 PTPTYSPPVKPPPIQKPPTP-TYSPPIKPPPVKPPTP 530 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 545 PTPTYSPPIKPPPIHKPPTPTYSPPIKPPPVHKPPTP 581 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 562 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 598 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 579 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 615 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 596 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 632 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 613 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVHKPPTP 649 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PT P PPP PP P P P PP P Sbjct: 528 PTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPPTP 564 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P+ P PPP PP P P P PP P Sbjct: 142 PTPSYSPPVKPPPVQMPPTPTYSPPIKPPPVHKPPTP 178 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/93 (24%), Positives = 25/93 (26%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P PP I P P P Sbjct: 189 HKPPTPIYSPPIKPPPVH--KPPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPI 246 Query: 866 XXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P P P PP P Sbjct: 247 YSPPIKPPPVHKPPTPIYSPPVKPPPVQTPPTP 279 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/92 (25%), Positives = 25/92 (27%), Gaps = 1/92 (1%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H+PP P + P PP I P P PT Sbjct: 358 HKPPTPIYSPPVKPPPVH--KPPTPIYSPPVKPPPIQKPPTPTYSPPIKPPPLQKPPTPT 415 Query: 866 XXPX-PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PP PP P P P PP P Sbjct: 416 YSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTP 447 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P P PP P Sbjct: 344 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P P PP P Sbjct: 428 PTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 464 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 860 PTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 PT P PPP PP P P P PP P Sbjct: 76 PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTP 110 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P P PP PP P Sbjct: 445 PTPIYSPPVKPPPVHKPPTP-TYSPPIKPPPVKPPTP 480 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 33.5 bits (73), Expect = 0.21 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P PPP PP P P PPP PP P Sbjct: 44 PSPSSVHRPYPPP-PPLP-DFAPQPLLPPPSPPPP 76 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 33.5 bits (73), Expect = 0.21 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 843 PPXXLCQPXXPX--PXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP PP P PP P PP+ Sbjct: 568 PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSPPPPV 606 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPL--XPPXXXXPXPPXXXXPXPP 950 PP + P P P PP+ PP PP P PP Sbjct: 575 PPPPVASPPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP 612 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P PPP PP P P PP P Sbjct: 524 PPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPP 555 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P+ P PP PP P PPP P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.5 bits (73), Expect = 0.21 Identities = 31/135 (22%), Positives = 35/135 (25%), Gaps = 1/135 (0%) Frame = +2 Query: 551 PVSXPPKGVXRLSPXXXGXPX-EXXFXPKGXXKAXXRKKAXLLAFXHRPPPPDHXXKXXX 727 P S PP V +P P + P + PPPP Sbjct: 534 PESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVY--YP 591 Query: 728 PXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXPPPXPPXP 907 P P PP P + S P P P P P PP P Sbjct: 592 PVTYSPPPPS----PVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 647 Query: 908 XXXXPXXXXPPPXPP 952 P PPP P Sbjct: 648 VYYPPVTPSPPPPSP 662 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP P P P P PP P Sbjct: 615 PSPLYYPPVTPSPPPPSPVYYPPVT--PSPPPPSP 647 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPP 943 PPP PP P P PPP Sbjct: 522 PPPPPPSPPPPCPESSPPPP 541 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G GRG Sbjct: 93 GRGGFGGGRGGGRGSGGGYGGGGGGYGGRGGGGRG 127 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G G G Sbjct: 150 GYGGGGGGYGGGGGYGGGGGGYGGG-GRGGGGGGG 183 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G GRG Sbjct: 147 GGGGYGGGGGGYG----GGGGYGGGGGGYGGGGRG 177 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P P P PPP P P Sbjct: 589 PSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P+ P PPP PP P PPP PP Sbjct: 4 PSKRRPPPPPPPPPRLLVLPPLPPPPPPPPP 34 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP PP P PPP PP P Sbjct: 9 PPPPPPPPPRLLVLPPLPPPPPPPP 33 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP PP P PPP PP P Sbjct: 10 PPPPPPPPRLLVLPPLPPPPPPPPP 34 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P P PP P P PPP P P Sbjct: 120 PAPTSPP-PTPASPPPAPASPPPAPASPPPAPVSP 153 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P P PPP P P Sbjct: 114 PPVSPPPAPTSPPPTPASPPPAPASPPPAPASP 146 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 860 PTXXPXPXPPP--XPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP P P PPP P P Sbjct: 105 PASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASP 139 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P PPP P P Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASP 132 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 33.1 bits (72), Expect = 0.28 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G +G G Sbjct: 150 GGNGGGGPGYGSGGGGIGG-GGGIGGGVIIGGG 181 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G G Sbjct: 105 GGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGG 137 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG G G G G Sbjct: 168 GGGGIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHG 202 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -2 Query: 957 GXGGX---GGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G G +G Sbjct: 171 GIGGGVIIGGGGGGCGGSCSGGGGGGGGYGHGGVSTKG 208 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G G G G G G G Sbjct: 120 GPGGGGGGVVIGGGFGGG-AGYGSGGGLGWDGGNG 153 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 33.1 bits (72), Expect = 0.28 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PPP PP P PPP PP P Sbjct: 68 PPPNQPPNTTPPPTPPSSP---PPSITPPPSPPQP 99 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP P PP P PP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITP-PPSPPQPQPP 102 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXG-GXGGGXGXGXXVGRG 853 G GG G G G G G G GGG G G GRG Sbjct: 34 GSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRG 69 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G G GGG G G G G Sbjct: 116 GRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEG 150 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GG G G GG GGG G G G G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G G GGG G GG GGG G G Sbjct: 132 GGGRGGGGGSGNGEGYGEGGGYGGGYGGG 160 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GG G G GG GGG G VG G Sbjct: 48 GVGAGAGGGASGGIGVGGGGGGGGGIGGSGGVGAG 82 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG G G G GG GG G G VG G Sbjct: 311 GGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGG 345 Score = 31.5 bits (68), Expect = 0.86 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G G G Sbjct: 99 GGAGGGGKGRGRK--GGGGAGGGVGGGVGAGGG 129 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GG G G GG GG G G G Sbjct: 209 GSGGASGGGGTVGAGGRGSGGASGGVGVGGGAG 241 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GG G G G G G G G VG G Sbjct: 150 GGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAG 182 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG G G G VG G Sbjct: 239 GAGGSGGG--SVGGGGRGSGGVGASGGAGGNVGAG 271 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGX--GGGXGXGXXVGRGXR 847 G G GGG G G GG GG G G VG G R Sbjct: 187 GSVGAGGGIGSGGGGTVGAGGRGSGGASGGGGTVGAGGR 225 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXG-GGXGXGXXVGRG 853 G GG G G G G GG G GG G VG G Sbjct: 204 GAGGRGSGGASGGGGTVGAGGRGSGGASGGVGVGGG 239 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GG G GG G G G G VG G Sbjct: 95 GGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAG 127 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GG G G +G G Sbjct: 112 GGGGAGGGV---GGGVGAGGGAGGSVGAGGGIGGG 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GGG G G GG GGG G G G Sbjct: 449 GGAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGG 483 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXG-GXGGGXGXGXXVGRG 853 G GG GGG G G G G GGG G G G G Sbjct: 466 GSGGAGGGTG--GSVGAGGGVGVGGGGGIGGGAGGG 499 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXG 877 G GG GGG G G GG GGG G Sbjct: 65 GGGGGGGGIGGSGGVGAG-GGVGGGAG 90 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GG G GG GGG G G Sbjct: 411 GVGGAGGAGGSVGAGGGVGGGVGGGVGGG 439 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G G Sbjct: 476 GSVGAGGGVGVGGGGGIG-GGAGGGVGGGVGGGVG 509 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRGXR 847 G GG G G G GG G G GRG + Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRK 111 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G G G G G GG GG G G +G G Sbjct: 165 GKSGGGAGGGVGGGVGAG-GGAGGSVGAGGGIGSG 198 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = -2 Query: 948 GXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG G GG GGG G VG G Sbjct: 530 GSGGASGGAGAGGGAGGGVGGGANVGVGVGAG 561 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 L P PPP PP P P PPP PP P Sbjct: 88 LQNIPPPSPPPPSPPPPSQACP----PPPLPPSP 117 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP PP P P PP PP P Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPP 84 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P PPP P P P PPP P Sbjct: 60 PPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 P + P P P PP PP P PP P P Sbjct: 53 PSCIQNPPPPSPPPP-SPPPPACPPPPALPPPPP 85 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP P P P PPP P P Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPP 83 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GG GGG G VG G Sbjct: 398 GCGGGGGGGDGGGGQGTGIGGGGGGE-QGTGVGGG 431 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G Sbjct: 49 GGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSG 83 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRGXR 847 GG GGG G G GGG G G G G + Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQK 64 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 2/91 (2%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP + P P PP + P P Sbjct: 44 PPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTT 103 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P P P PP P P PPP PP P Sbjct: 104 PPPPPAITPPPPPAITPPLSPPPPAITPPPP 134 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXP--PXXXXPXPPXXXXPXPP 950 P +C P P P P P P P PP P PP Sbjct: 35 PCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPP 72 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +2 Query: 854 PLPTXXPXPXPP----PXPPXPXXXXPXXXXPPPXPP 952 P PT P P PP P PP P PP PP Sbjct: 256 PSPTISPPPLPPQTLKPPPPQTTPPPPPAITPPLSPP 292 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 P C P PP PP P PP P PP Sbjct: 248 PQGFSCPGPSPTISPPPLPPQTLKPPPPQTTPPPPP 283 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 864 PXXPXPXPPLXPPXXXXPXPPXXXXP-XPPL 953 P P P PPL PP P PP P PPL Sbjct: 143 PPKPLP-PPLSPPQTTPPPPPAITPPLSPPL 172 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P PPL PP PP P L Sbjct: 106 PPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPAL 142 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP P P Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSP 124 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 854 PLPTXXPXPXPPPX---PPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P P P P PP Sbjct: 114 PPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +2 Query: 860 PTXXPXPXPPP-XPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PP PP Sbjct: 140 PALPPKPLPPPLSPPQTTPPPPPAITPPLSPP 171 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 842 SXLXPLPTXXPXPXPPPXPPXPXXXXPXXXXPP---PXPPXP 958 S P+PT PPP P P P PP P PP P Sbjct: 164 SPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTP 205 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPP-PXPPXPXXXXPXXXXPPPXPPXP 958 P PT P PP P P P P P P PP P Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXX-PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P PP PP P P P P PP P Sbjct: 138 PTPTPSVPSPTPPVSPPPP---TPTPSVPSPTPPVP 170 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPX-PXP-PPXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P P PP P P P PPP P P Sbjct: 154 PPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTP 190 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P PP+ P P PP P PP Sbjct: 153 PPPPTPTPSVPSPTPPV--PTDPMPSPPPPVSPPPP 186 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXX-PXPXPP--PXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P PP P PP P P PP PP P Sbjct: 102 PTPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 138 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXX-PXPXPP--PXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P PP P PP P P PP PP P Sbjct: 120 PTPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 156 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PP PP P P PP PP P Sbjct: 75 PAPVPPVSPPPPTPSVP-SPTPPVSPPPP 102 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P+ P PPP P P P PP PP P Sbjct: 90 VPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTP 122 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P+ P PPP P P P PP PP P Sbjct: 108 VPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTP 140 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P+ P PPP P P P PP PP P Sbjct: 126 VPSPTPPVSPPPPTPTPSVPSPTPPVSPP-PPTP 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P P + P P PP P PP Sbjct: 177 PPPPV-SPPPPTPTPSVPSPPDVTPTPPTPSVPSPP 211 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXX-PXPXPP--PXPPXPXXXXPXXXXPPPXPPXP 958 P PT P P PP P PP P P PP PP P Sbjct: 84 PPPTPSVPSPTPPVSPPPPTPTPSVPSPT-PPVSPPPP 120 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXP-PXXXXPXPPL 953 PP P P P PP+ PP P P P P PP+ Sbjct: 99 PPPPTPTPSVPSPTPPVSPP---PPTPTPSVPSPTPPV 133 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXP-PXXXXPXPPL 953 PP P P P PP+ PP P P P P PP+ Sbjct: 117 PPPPTPTPSVPSPTPPVSPP---PPTPTPSVPSPTPPV 151 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXP-PXXXXPXPPL 953 PP P P P PP+ PP P P P P PP+ Sbjct: 135 PPPPTPTPSVPSPTPPVSPP---PPTPTPSVPSPTPPV 169 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +2 Query: 842 SXLXPLPTXXPXPXPP-PXPPXPXXXXPXXXXPPPXPPXP 958 S P+ P P P P P P P PPP P P Sbjct: 146 SPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPP 185 Score = 28.7 bits (61), Expect(2) = 1.4 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXP-PPXPP 952 P P+ P P PP P P P PP PP Sbjct: 203 PTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPP 236 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = +2 Query: 854 PLPTXXPX-PXPP---PXPPXPXXXXPXXXXP-PPXPPXP 958 P PT P P PP P PP P P P PP P P Sbjct: 184 PPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVP 223 Score = 20.6 bits (41), Expect(2) = 1.4 Identities = 8/21 (38%), Positives = 8/21 (38%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPP 754 PPPP P P PP Sbjct: 183 PPPPTPTPSVPSPPDVTPTPP 203 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G G GGG G G GG GGG G G G Sbjct: 585 GGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYG 617 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G Sbjct: 591 GGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYG 625 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 958 GXRGGXGXXXXGGXGXXXXGGXRGGXGXGXXGWQRXXGG 842 G +GG G GG G GG +GG G G GG Sbjct: 12 GGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGG 50 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 GG GG G G GG GGG G G G Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGGGGG 32 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G GGG G G V G Sbjct: 24 GRGGGGGGGAKGGCGGGGKSGGGGGGG-GYMVAPG 57 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GG G G GG GGG G G G Sbjct: 103 GGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSG 135 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRGXR 847 G G GGG G G G GGG G G G + Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGK 42 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G G Sbjct: 111 GGGGGGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G GG GGG G G G G Sbjct: 92 GGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGG 126 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -1 Query: 958 GXRGGXGXXXXGGXGXXXXGGXRGGXGXG 872 G GG G GG G GG GG G G Sbjct: 115 GGHGGGGHYGGGGGGYGGGGGHHGGGGHG 143 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 30.3 bits (65), Expect(2) = 0.51 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXP---PPXPPXPXXXXPXXXXPPPXPPXP 958 PLP P P P PP P PPP PP P Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLP 65 Score = 20.6 bits (41), Expect(2) = 0.51 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPP 754 PPPP + P P PP Sbjct: 16 PPPPPPLMRRRAPLPPPPPPP 36 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP P PP Sbjct: 137 PPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPPP 172 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/91 (25%), Positives = 25/91 (27%), Gaps = 5/91 (5%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP + P P PP + P P PT Sbjct: 108 PPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVT 167 Query: 872 PXPXPP-----PXPPXPXXXXPXXXXPPPXP 949 P PP P PP P PPP P Sbjct: 168 RPPPPPTITRSPPPPRPQAAAYYKKTPPPPP 198 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 56 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPP 91 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 65 PPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP 100 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 74 PPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPP 109 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 92 PPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPP 127 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 101 PPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPP 136 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 128 PPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPP 163 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P PP P PP PP Sbjct: 47 PPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPP 82 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 83 PPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPP 118 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 110 PPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPP 145 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L P P P PP P PP PP Sbjct: 119 PPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPP 154 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/89 (25%), Positives = 25/89 (28%), Gaps = 3/89 (3%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP + P P PP + P P P Sbjct: 72 PPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVL 131 Query: 872 PXPXPPP---XPPXPXXXXPXXXXPPPXP 949 P PPP PP P P PPP P Sbjct: 132 LSPPPPPVNLSPPPP----PVLLSPPPPP 156 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 4/39 (10%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP----PXPXXXXPXXXXPPPXPPXP 958 P + P P PPP P P P PPP PP P Sbjct: 305 PQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 6/39 (15%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXX------PPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 +P+ P P PPP P P PP P P Sbjct: 24 MPSPLPLPPPPPPPLKPPSSGSATTKPPINPSKP 57 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPL----XPPXXXXPXPPXXXXPXPP 950 PP P P P PPL PP PP P PP Sbjct: 304 PPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 846 PXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 P + P P P PPL PP P P P P Sbjct: 405 PPIVALPPPPPPSPPLPPPVYSPPPSPPVFSPPP 438 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP PP P P PPP PP Sbjct: 412 PPPPPSPPLP----PPVYSPPPSPP 432 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P PP PP P PP PP Sbjct: 422 PPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPP 457 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 31.9 bits (69), Expect = 0.65 Identities = 25/93 (26%), Positives = 29/93 (31%), Gaps = 2/93 (2%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP H P P PP ++ P S P+ + Sbjct: 711 HSPPPPVHSPP---PPVHSPPPP--VQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHS 765 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P P P PP P PPP PP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 798 Score = 31.5 bits (68), Expect = 0.86 Identities = 25/95 (26%), Positives = 26/95 (27%), Gaps = 6/95 (6%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP P P PP P + P P Sbjct: 645 HSPPPPPPVHSPPPPVFS-PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPV 703 Query: 866 XXPXPX----PPPX--PPXPXXXXPXXXXPPPXPP 952 P P PPP PP P P PP PP Sbjct: 704 HSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P P P PP P PP P PP+ Sbjct: 735 PPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPV 771 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P P PPP PP P PPP PP P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPP 673 Score = 29.9 bits (64), Expect = 2.6 Identities = 28/134 (20%), Positives = 30/134 (22%) Frame = +2 Query: 551 PVSXPPKGVXRLSPXXXGXPXEXXFXPKGXXKAXXRKKAXLLAFXHRPPPPDHXXKXXXP 730 PV PP V P P P ++ PPPP P Sbjct: 695 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP 754 Query: 731 XQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXPPPXPPXPX 910 P PP P P P P P P P P Sbjct: 755 PVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPP 814 Query: 911 XXXPXXXXPPPXPP 952 P P PP Sbjct: 815 VFSPPPKPVTPLPP 828 Score = 29.5 bits (63), Expect = 3.5 Identities = 31/138 (22%), Positives = 32/138 (23%), Gaps = 2/138 (1%) Frame = +2 Query: 551 PVSXPPKGVXRLSPXXXGXPXEXXFXPKGXXKAXXRKKAXLLAFXHRPPPPDHXXKXXXP 730 PV PP V P P P + PPPP P Sbjct: 688 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAP 747 Query: 731 XQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXP-PPXPPXP 907 P PP P P P P P P PP P Sbjct: 748 IYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSP 807 Query: 908 XXXXPXXXX-PPPXPPXP 958 P PPP P P Sbjct: 808 IYSPPPPVFSPPPKPVTP 825 Score = 28.3 bits (60), Expect = 8.0 Identities = 23/91 (25%), Positives = 24/91 (26%) Frame = +2 Query: 686 HRPPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPT 865 H PPPP + P P PP P P P Sbjct: 668 HSPPPPVYSPP---PPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPV 724 Query: 866 XXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP P P P PP P Sbjct: 725 HSPPP-PVQSPPPPPVFSPPPPAPIYSPPPP 754 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP P P PPP PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P PPP P P PPP PP Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPP 219 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 3/32 (9%) Frame = +2 Query: 872 PXPXP---PPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P P PPP PP P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPP 40 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PPP P P PPP PP Sbjct: 11 PAPGNYPQGPPPPVGVPPQYYPPPPPPPPPPPP 43 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 L P P P P PPP P P P P P P P Sbjct: 163 LPPPPPPYPSPLPPPPSPSP-TPGPDSPLPSPGPDSP 198 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 842 SXLXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 S L P P+ P P P P P P PP P P Sbjct: 172 SPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSP 210 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXP-XXXXPXXXXPPPXPP 952 PLP P P P P P P P P P PP Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGPP 233 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P P P P P PP P P Sbjct: 178 PSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTP 212 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P P P P P PP P P Sbjct: 206 PSPSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTP 240 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPX-PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PLP+ P P P P PP P P P P P Sbjct: 217 PLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPP 252 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXP-PXP 958 PLP+ P P P P P P P P P P P P Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDP 281 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G GG GG G G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G GG GG G G Sbjct: 574 GGGGGGGGSDYYGGGGYGGGGYGGAPSGGYGAG 606 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPP---XPXXXXPXXXXPPPXPP 952 P PT P P P P PP P P P P PP Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPP 193 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP C P P P PP+ P P PP P P Sbjct: 158 PPPTPCPPPTPTPTPPVVTP--PTPTPPVITPPTP 190 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +2 Query: 860 PTXXPXPXP-PPXPPXPXXXXPXXXXPPPXPPXP 958 PT P P PP P P P PPP P P Sbjct: 120 PTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKP 153 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PT P PP P P P P PP P Sbjct: 166 PTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +2 Query: 860 PTXXPX--PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PT P P PP P P P PPP P P Sbjct: 131 PTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 PT P P PP P P P P P PP Sbjct: 86 PTVKPHPKPPTVKP-PHPKPPTKPHPHPKPP 115 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P P PP P P P P PP Sbjct: 154 PHHKPPPTPCP-PPTPTPTPPVVTPPTPTPP 183 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P P P P P PP P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTP 190 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 31.5 bits (68), Expect = 0.86 Identities = 34/147 (23%), Positives = 39/147 (26%), Gaps = 6/147 (4%) Frame = +2 Query: 536 FGCGXPVSXPPKGVXRLSPXXX---GXPXEXXFXPKGXXKAXXRKKAXLLAFXHRPPPPD 706 FGC S PP ++SP P P +F PPPP Sbjct: 417 FGCNNFFSPPPPSF-KMSPTVRVLPPPPPSSKMSPTFRATPPPPSSKMSPSFRATPPPPS 475 Query: 707 HXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXXPXPXP 886 P R PP K+ S + P P P P Sbjct: 476 SKMS---PSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPP 532 Query: 887 ---PPXPPXPXXXXPXXXXPPPXPPXP 958 PP P P P P PP P Sbjct: 533 LSPPPPSPPPPYIYSSPPPPSPSPPPP 559 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP QP P PP+ PP PP PP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPP 57 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP + P PP PP P P P PP+ Sbjct: 56 PPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPV 92 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P PP P P P P P P P Sbjct: 133 PPPKPSPSPPGETPSPPGETPSPPKPSPSTPTP 165 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +2 Query: 854 PLPTXXPXPXPPPX----PPXPXXXXPXXXXPPPXP 949 P PT P PPP PP P PPP P Sbjct: 163 PTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTP 198 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRGXR 847 GG GG G G GG GGG G G G+G + Sbjct: 78 GGNSGGSGGLGGSGGGGGGSGGGGGDGSD-GKGKK 111 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 103 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G Sbjct: 133 GSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGG 167 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G G GGG G GG GGG G G Sbjct: 116 GYSGGGGGGYERRSGGYGSGGGGGGRGYG 144 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXP-PPXPPXP 958 PL P P PPP P P P PP PP P Sbjct: 35 PLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP L + P PP PP P PP P PP Sbjct: 81 PPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPPL 953 PP P P P P L PP P PP P PPL Sbjct: 46 PPSPSSPPRLPPPFPALFPP--EPPLPPRFELP-PPL 79 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP P P PPL PP P P P P Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP PPP PP P Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPP 110 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PLP P PPP P P PP PP P Sbjct: 84 PLPRLPPPLLPPPEEPP--REPPPPPPPPEEPPPP 116 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 958 GXRGGXGXXXXGGXGXXXXGGXRGGXGXGXXGWQRXXGG 842 G GG G G G GG GG G G G+ GG Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGG 83 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P PPP PP P PPP P Sbjct: 215 PVLLPLQPPPPPPPSQPLPRPLLLPPPPPP 244 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPP 952 P PP PP P P PP PP Sbjct: 219 PLQPPPPPPPSQPLPRPLLLPPPPP 243 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 27.9 bits (59), Expect(2) = 1.4 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 1/33 (3%) Frame = +2 Query: 863 TXXPXPXPPPX-PPXPXXXXPXXXXPPPXPPXP 958 T P PPP P P P PPP P P Sbjct: 360 TQEKSPVPPPRRSPPPLQTPPPPPPPPPLAPPP 392 Score = 21.4 bits (43), Expect(2) = 1.4 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = +2 Query: 680 FXHRPPPPDHXXKXXXPXQRWPXPP 754 F PPPP+ ++ P PP Sbjct: 344 FSQPPPPPNRAAFQAITQEKSPVPP 368 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P PP PP P P PPP PP Sbjct: 166 PFSPSIPPPSPPYFPPEPPSIPP---PPPPSPP 195 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXG 877 GG GGG G G GG GGG G Sbjct: 300 GGGGGGYNRGGYSMGGGGGYGGGPG 324 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G GG GGG G G G Sbjct: 360 GMGGAGGGGYRGGGGYD-MGGVGGGGAGGYGAGGG 393 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PP P P PPP P P Sbjct: 63 PVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYP 95 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPX-PPPX--PPXPXXXXPXXXXPPPXPPXP 958 P+ + P P PPP PP P P PPP P P Sbjct: 71 PIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP +P P PP+ P PP P PP Sbjct: 56 PPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXP 947 PP P P PP+ PP P PP P P Sbjct: 77 PPPIYPPPIYSPPPPPIYPPPIYSP-PPTPISPPP 110 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 PLP P P PP PP P PP PP P Sbjct: 415 PLPQLPPLPKFPPLPP-KYIHHPKFGKWPPLPPHP 448 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/36 (36%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXP-XXXXPXXXXPPPXPPXP 958 P+P P P PP P P PPP P P Sbjct: 210 PVPVYDPPPKKEVPPPVPVYKPPPKVELPPPIPKKP 245 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G GGG G G +G G Sbjct: 70 GFGGAGGGLGG-GLGGGAGSGLGGGLGGGSGIGAG 103 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 951 GGXGGGXXXXG--XXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G GG GGG G G G G Sbjct: 53 GGVGGGVSGPGGNLGYGGFGGAGGGLGGGLGGGAG 87 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXG 877 GG GGG G G GG GGG G Sbjct: 110 GGRGGGSYGGGYGGRGSGGRGGGGG 134 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GG G GG GGG G GRG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRG 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG G G G GGG G GRG Sbjct: 98 GRGGFGGGGGRGGGR--GGGSYGGGYGGRGSGGRG 130 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPP---PXPPXPXXXXPXXXXPPPXPPXP 958 P PT P PP PP P P PPP P P Sbjct: 61 PPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP 98 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP P P P P + PP P P P PP Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P P PPP P P PPP P Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 PLP PPP PP P PPP PP Sbjct: 250 PLPPPGTAALPPP-PPLPMAAGKGVAAPPPPPP 281 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 27.9 bits (59), Expect(2) = 1.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 Query: 896 PPXPXXXXPXXXXPPPXPPXP 958 PP P P PPP PP P Sbjct: 66 PPHPMMFSPPPPQPPPPPPRP 86 Score = 21.0 bits (42), Expect(2) = 1.8 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXP 922 T P PPP PP P Sbjct: 35 TPPPPQLPPPLPPSSYGLSP 54 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 L P P PP PP P PPP P P Sbjct: 193 LSASLPLPPLPPLPPTTGLTLPHSPFPPPPPGPP 226 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP-XXXXPPPXPPXP 958 P P P P PP P P P P P PP P Sbjct: 29 PKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKP 64 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP-XXXXPPPXPPXP 958 P P P P PP P P P P P PP P Sbjct: 40 PKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKP 75 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP-XXXXPPPXPPXP 958 P P P P PP P P P P P PP P Sbjct: 51 PKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKP 86 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP-XXXXPPPXPPXP 958 P P P P PP P P P P P PP P Sbjct: 62 PKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXP-XXXXPPPXPPXP 958 P P P P PP P P P P P PP P Sbjct: 73 PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKP 108 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 T P P PPP PP P PPP PP P Sbjct: 95 TRIPPPQPPP-PPQPLNL--FSPPPPPPPPDP 123 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG GG GGG G G G G Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -2 Query: 957 GXGGXGGG----XXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G GG GGG G G G Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G GG GGG GG GGG G G G G Sbjct: 105 GGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXG 871 GG GGG G G GG GG G G Sbjct: 324 GGPGGGGGNMGNQNQGGGGKNGGKGGG 350 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 4/37 (10%) Frame = -2 Query: 957 GXGGXGGG----XXXXGXXXXGXGGXGGGXGXGXXVG 859 G GG GGG G G GG GGG G G G Sbjct: 103 GKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGGGGG 139 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G GG GGG G G GGG G G Sbjct: 388 GGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 842 SXLXPLPTXXPXPXPPPXPPXPXXXXPXXXXPPP 943 S L P P PPP P P P PPP Sbjct: 18 SALAQAPAPTPTATPPPATPPPVATPPPVATPPP 51 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPX--PPXPXXXXPXXXXPPPXPPXP 958 P PT P P PP P P P P P P P Sbjct: 26 PTPTATPPPATPPPVATPPPVATPPPAATPAPATPPP 62 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXX-GXGGXGGGXGXGXXVGRG 853 G GG GG G G GG GGG G GRG Sbjct: 17 GRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRG 52 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 942 GGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GGG G G GG GGG G G G G Sbjct: 123 GGGGYSYGGGGGGYGGGGGGYGGGGDGGGG 152 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P PPP PP PP PP P Sbjct: 34 PPPPPPPFPPHYDYNYSNYHLSPPLPPQP 62 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 25.4 bits (53), Expect(2) = 2.5 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPX-PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P T P P PP PP P P PP P Sbjct: 143 PSKTHEPSRPNTPPPPPPPSKTHEPSRRITPSPPPP 178 Score = 23.0 bits (47), Expect(2) = 2.5 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 Query: 674 LAFXHRPPPPDHXXKXXXPXQRWPXPP 754 LA PPPP + P P PP Sbjct: 117 LAITPSPPPPSKTHERSRPITPSPPPP 143 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P P P PPP PP PPP P Sbjct: 45 PPISPPPPPPPPPPQSHAAAYKRYSPPPPP 74 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P P PP P P PPP P P Sbjct: 58 PTPVYSPPPADLPPPPTP-YYSPPADLPPPTPIYP 91 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P P+ P P P PP P P P PP P Sbjct: 79 PPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPP 113 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 LP P P P PP P PPP P P Sbjct: 78 LPPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPP 111 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 LP P PPP PP P P P P PP P Sbjct: 60 LPLPPPPQTPPP-PPPPQSLPPPSPSPEPEHYPPPP 94 >At2g43800.1 68415.m05445 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 894 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 6/33 (18%) Frame = +2 Query: 878 PXPPPXPPXPXXXXP------XXXXPPPXPPXP 958 P PPP PP P P PPP PP P Sbjct: 88 PPPPPSPPHPNPFFPSSDPTSTASHPPPAPPPP 120 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPX---PPPXPPXPXXXXPXXXXPPPXPPXP 958 P T P P PPP P P P PPP P P Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ + P PP PP P PPP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P+ T P PPP P P PPP PP P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPX--PPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP P P P PPP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPX---PPPXPPXPXXXXPXXXXPPPXPPXP 958 P T P P PPP P P P PPP P P Sbjct: 52 PPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P+ + P PP PP P PPP P P Sbjct: 73 PVSSPPPASPPPATPPPVASPPPPVASPPPATPPP 107 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPP--XPPXP 958 P+ T P PPP P P PPP PP P Sbjct: 60 PVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPPP 96 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPX--PPPXPPXPXXXXPXXXXPPPXPPXP 958 P P P P PPP P P P PPP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPP 101 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GG GGG G G G G G G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGR 856 G GG GGG G G G G G G GR Sbjct: 100 GGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGR 133 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 4/33 (12%) Frame = +2 Query: 863 TXXPXPXPP----PXPPXPXXXXPXXXXPPPXP 949 T P P PP P PP P P PPP P Sbjct: 382 TSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPP 414 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +2 Query: 854 PLPTXXPXPXPPP---XPPXPXXXXPXXXXPPPXPP 952 P P P PPP PP P PPP PP Sbjct: 378 PANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/37 (48%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGG--XGXGXXVGRG 853 G GG GGG G G GG GGG G G VG G Sbjct: 113 GGGGGGGGDTGAGA---GGGGYGGGGDTGAGGGVGSG 146 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 942 GGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 GGG G G G GGG G G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGGGGGGDTGAG 125 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G GG GGG G G G Sbjct: 96 GGGDVGGGGGGYGGGTPGGGG-GGGGDTGAGAGGG 129 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXP 949 P PT P PPP P P P PPP P Sbjct: 398 PSPTSPPLSTPPPARPCPPVYSP----PPPPP 425 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 861 QPXXPXPXP---PLXPPXXXXPXPPXXXXPXPP 950 QP P P P PL P P PP P PP Sbjct: 392 QPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPP 424 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXG 871 GG GGG G G GG GGG G Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGGPPRG 86 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 942 GGGXXXXGXXXXGXGGXGGGXGXGXXVG 859 GGG G G GG GGG G G G Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGGGPPRG 86 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +2 Query: 857 LPTXXPXPXPPPXPP---XPXXXXPXXXXPPPXPPXP 958 + T P PPP PP P PPP PP P Sbjct: 1 METFGTIPPPPPLPPRLELRRQRAPPPQPPPPPPPPP 37 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPP 943 P P P P PPP PP PPP Sbjct: 27 PQPPPPPPPPPPPPPPRLGPRLRLRLLPPP 56 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXP 907 P P P P PPP PP P Sbjct: 25 PPPQPPPPPPPPPPPPPP 42 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 29.5 bits (63), Expect = 3.5 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -1 Query: 958 GXRGGXGXXXXGGXGXXXXGGXRGGXGXGXXGWQRXXGG 842 G GG GG G GG +GG G G R GG Sbjct: 45 GDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGG 83 >At5g42860.1 68418.m05224 expressed protein Length = 320 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +2 Query: 863 TXXPXPXPPPXPPXPXXXXPXXXXPPPXPPXP 958 T P P P P P P PP PP P Sbjct: 235 TLVPPPPPAPIPKPKKKKGPIVIVEPPAPPAP 266 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 3/38 (7%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP---PXPXXXXPXXXXPPPXPPXP 958 P+ P P PPP P P PPP PP P Sbjct: 16 PMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 10/39 (25%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXX----------PPPXPPXP 958 P P PPP PP P P PPP PP P Sbjct: 120 PPPPPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPP 158 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 8/35 (22%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXP--------XXXXPPPXPP 952 P P PPP PP P P PPP PP Sbjct: 151 PPPPPPPPPPPPTITPPVTTTTTGHHHHRPPPPPP 185 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXP-XXXXPXXXXPPP 943 P P P P PPP P P P PPP Sbjct: 27 PSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 860 PTXXPXPXPPPXP-PXPXXXXPXXXXPPPXPPXP 958 P P P PPP P P P P P P P Sbjct: 23 PEKPPSPEPPPSPEPPPSPEKPTSPEQPSSPEPP 56 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 843 PPXXLCQPXXPXPXPPLXPPXXXXPXPPXXXXPXPP 950 PP + P P P P PP P P PP Sbjct: 101 PPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPP 136 >At3g03776.1 68416.m00385 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 177 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPP 943 P PPP PP P P PPP Sbjct: 120 PTICPPPPPPYPRQVHPQPPAPPP 143 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/88 (25%), Positives = 25/88 (28%), Gaps = 1/88 (1%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQR-WPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTX 868 PPPP + K P + PP P + S P P Sbjct: 100 PPPPPYVYKSPPPPPYVYSSPPPP---PYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYV 156 Query: 869 XPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP P P PP PP Sbjct: 157 YKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/87 (24%), Positives = 23/87 (26%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP P + PP P + S P P Sbjct: 91 PPPPYVYSSPPPPPYVYKSPPPP---PYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVY 147 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P PPP P PPP PP Sbjct: 148 SSPPPPPYVYKSPPPPPYVYSPPPPPP 174 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Frame = +2 Query: 860 PTXXPXPXPP-----PXPPXPXXXXPXXXXPPPXPP 952 P P P PP P P P P PPP PP Sbjct: 94 PPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPP 129 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/87 (26%), Positives = 24/87 (27%) Frame = +2 Query: 692 PPPPDHXXKXXXPXQRWPXPPXXIKIPXXFXXXXXXXXXXXXXXXXXXXXSXLXPLPTXX 871 PPPP H P +R PP K P L P P Sbjct: 219 PPPPGH------PKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPP-PKPS 271 Query: 872 PXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P P PP PP Sbjct: 272 PDPLPSNSSSPPTLLPPSSVVSPPSPP 298 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXP-PPXPPXP 958 P T P PP PP P P P PP P P Sbjct: 133 PPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLP 168 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/39 (35%), Positives = 15/39 (38%), Gaps = 2/39 (5%) Frame = +3 Query: 843 PPXXLCQPXXPX--PXPPLXPPXXXXPXPPXXXXPXPPL 953 P + P P P PP PP P PP P P L Sbjct: 134 PTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKL 172 >At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly identical to RNA helicase [Arabidopsis thaliana] GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 671 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRGXR 847 GG G G G GG GGG G G GRG R Sbjct: 637 GGGGRGNRFGGGGGNRFGG-GGGRGRGGSGGRGQR 670 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 873 PXPXPPLXPPXXXXPXPPXXXXPXPP 950 P P PP PP P PP P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGP 411 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +3 Query: 873 PXPXPPLXPPXXXXPXPPXXXXPXPP 950 P P PP PP P PP P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGP 411 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPP--XPXXXXPXXXXPPPXP 949 PLP P P PPP PP P P P P P Sbjct: 1127 PLPHESP-PSPPPQPPSSPPPPSSPPQLAPAPPP 1159 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPP 952 PPP PP P P PPP PP Sbjct: 325 PPPPPPSPEHKAP---APPPPPP 344 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 Query: 857 LPTXXPXPXPPPXPPXPXXXXPXXXXPPP 943 +P P P PPP PP PPP Sbjct: 421 VPNSQPRPPPPPPPPQQLQVAGINKTPPP 449 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXGXG 871 GG GGG G G GG GGG G G Sbjct: 64 GGDGGG-DGGGGGCGGGGGCGGGGGGG 89 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGG 883 GG GGG G G GG GGG Sbjct: 793 GGGGGGCGGCGGGGCGGGGDGGG 815 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPPXP 958 PPP PP P P PP PP P Sbjct: 21 PPPAPP-PESSSPPTPPEPPDPPDP 44 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXGXXVGRG 853 G G GGG G G G GGG G G G Sbjct: 48 GTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGG 82 >At1g11130.1 68414.m01274 leucine-rich repeat family protein / protein kinase family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to leucine-rich repeat transmembrane protein kinase 2 [Zea mays] gi|3360291|gb|AAC27895 Length = 768 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P+P P PP P P PPP PP Sbjct: 266 PVPRIPPVSGVPPAPFAPFAPLQPQQHPPPSPP 298 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = -2 Query: 957 GXGGXGGGXXXXG--XXXXGXGGXGGGXGXGXXVGR 856 G GG GGG G G GG GGG G +G+ Sbjct: 152 GVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGK 187 >At5g65630.1 68418.m08256 DNA-binding bromodomain-containing protein similar to 5.9 kb fsh membrane protein [Drosophila melanogaster] GI:157455; contains Pfam profile PF00439: Bromodomain Length = 590 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 860 PTXXPXPXPPPXPPXPXXXXPXXXXPPP 943 P+ P PPP PP P PPP Sbjct: 341 PSRVQSPSPPPPPPVIQPELPQPQPPPP 368 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPP 943 PPP PP P P PPP Sbjct: 135 PPPPPPPPPPRSPNSASPPP 154 >At4g24390.2 68417.m03498 F-box family protein (FBX14) similar to transport inhibitor response 1 protein GI:8777429 from [Arabidopsis thaliana] Length = 623 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 116 YKLIDGGLHRPATTTGLPRNDGLPKILRN 30 ++L G HRP TG P +DG I++N Sbjct: 448 FRLCIMGRHRPDHVTGKPMDDGFGAIVKN 476 >At4g24390.1 68417.m03497 F-box family protein (FBX14) similar to transport inhibitor response 1 protein GI:8777429 from [Arabidopsis thaliana] Length = 623 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 116 YKLIDGGLHRPATTTGLPRNDGLPKILRN 30 ++L G HRP TG P +DG I++N Sbjct: 448 FRLCIMGRHRPDHVTGKPMDDGFGAIVKN 476 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGX-GGGXGXG 871 GG GGG G G GG GGG G G Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGGHG 39 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P P P P P P P PP Sbjct: 44 PKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPP 76 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 854 PLPTXXPXPXPPPXPPXPXXXXPXXXXPPPXPP 952 P P P P P PP P P P PP Sbjct: 36 PKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPP 68 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 884 PPPXPPXPXXXXPXXXXPPPXPP 952 PPP PP P P PPP PP Sbjct: 217 PPPKPPSP----PRKPPPPPPPP 235 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXG 877 GG GGG G GG GGG G Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGGFG 85 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Frame = +2 Query: 884 PPPXPP-XPXXXXPXXXXPPPXPPXP 958 PPP PP P P PPP P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 942 GGGXXXXGXXXXGXGGXGGGXGXG 871 GGG G G GG GGG G G Sbjct: 126 GGGGSYGGGRREGGGGYGGGEGGG 149 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 Query: 942 GGGXXXXGXXXXGXGGXGGGXGXG 871 GGG G G GG GGG G G Sbjct: 143 GGGGSYGGGRREGGGGYGGGEGGG 166 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGXGGGXGXG 871 G G GGG G GG GGG G G Sbjct: 78 GGGHYGGGGGHYGGGGGHYGGGGGGYGGG 106 >At1g53620.1 68414.m06094 glycine-rich protein Length = 143 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -2 Query: 951 GGXGGGXXXXGXXXXGXGGXGGGXG 877 GG GGG G GG GGG G Sbjct: 70 GGCGGGGDGGGCDGDAGGGDGGGCG 94 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXP-PXP 958 PLP P P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTP 327 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +2 Query: 854 PLPTXXPXPXPPPXP-PXPXXXXPXXXXPPPXP-PXP 958 PLP P P P P P P P P P P P P Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTP 327 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 957 GXGGXGGGXXXXGXXXXGXGGX-GGGXGXGXXVG 859 G GG G G G G GG GGG G G G Sbjct: 64 GGGGFGAGGGWIGGSVGGFGGGIGGGFGGGGFGG 97 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 23.8 bits (49), Expect(2) = 8.2 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 878 PXPPPXPPXPXXXXPXXXXPPPXPPXP 958 P PPP PP P PP P Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLP 627 Score = 22.6 bits (46), Expect(2) = 8.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 848 LXPLPTXXPXPXPPPXPP 901 L PL P PPP PP Sbjct: 562 LKPLRILSRPPPPPPPPP 579 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,106,887 Number of Sequences: 28952 Number of extensions: 215101 Number of successful extensions: 6514 Number of sequences better than 10.0: 144 Number of HSP's better than 10.0 without gapping: 778 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3602 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2304931176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -