BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O15 (957 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 39 0.005 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 38 0.012 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 36 0.049 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 36 0.049 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.085 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.15 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 34 0.20 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.20 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 33 0.34 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 33 0.45 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.45 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 32 0.60 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.60 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 32 0.60 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 32 0.60 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 32 0.79 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 32 0.79 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.79 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 32 0.79 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 31 1.0 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.0 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 31 1.0 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 31 1.0 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 31 1.8 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 30 2.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 30 2.4 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 2.4 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) 30 3.2 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 30 3.2 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 29 5.6 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 5.6 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 5.6 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 29 5.6 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 29 7.4 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 29 7.4 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 29 7.4 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 28 9.7 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 28 9.7 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 28 9.7 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 9.7 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 28 9.7 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 28 9.7 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.1 bits (87), Expect = 0.005 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPP 402 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP+PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PSP PP P PP P P P PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPP 406 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PSP P P PP PPP P PP PP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +3 Query: 690 HLGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 ++ P P PP PP PPP P PP PP Sbjct: 362 NMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPP 396 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP P PP PPP P PP P Sbjct: 403 PPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP+ P PP PP P PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP 399 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP+ P P PPP P PP PP Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP P PP PPP P PP P Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 35.1 bits (77), Expect = 0.085 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP PP PPP P PP PP Sbjct: 383 PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P P PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPP 398 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P P PPP P PP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P P PPP P PP PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P P PPP P PP PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP PPP P PP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP PPP P PP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP P P P PP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PP P PP PP Sbjct: 402 PPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP P P P PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 735 PXXPPGPPPVXXPXGPPSPPN 797 P PP PPP P PP PP+ Sbjct: 368 PPPPPPPPPSPPPPPPPPPPS 388 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPS 788 P P PP P P PPP P PP+ Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPP 785 P P PP P PP PP + PP Sbjct: 414 PPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P PP P PP PPP P PP PP Sbjct: 460 VGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP P PP PPP P PP+P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 36.3 bits (80), Expect = 0.037 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PPT P PP PP P PP+PP Sbjct: 1023 PPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PPT P PP PPP P PP+ P Sbjct: 1027 PPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PPT P PP PP P PP+ P Sbjct: 1031 PPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 723 PTXXPXXPPGPPPVXXPXGPPSPP 794 PT P PP PP P PP+PP Sbjct: 1020 PTDPPTEPPTDPPTPPPTEPPTPP 1043 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 35.9 bits (79), Expect = 0.049 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 LG P P P PPGPP + P GP PP Sbjct: 106 LGDMGPPGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 LG P LP P PPGPP + GP PP Sbjct: 361 LGDVGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 394 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 LG P LP P PPGPP + GP PP Sbjct: 446 LGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 479 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 LG P LP P PPGPP + GP PP Sbjct: 531 LGDVGPPGLPGPPGPQMPPGPPGLPGAPGPNGPP 564 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P LP P PPGPP + GP PP Sbjct: 192 GDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P LP P PPGPP + GP PP Sbjct: 277 GDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGPP 309 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P LP P PP PP P GP PP Sbjct: 616 IGEIGPAGLPGPPGPASPPSPPGPPGPPGPKGPP 649 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P LP P PP PP P GP PP Sbjct: 701 IGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 +G P P P PPGPP P GPP P Sbjct: 704 MGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P LP P PP PP P GP PP Sbjct: 786 VGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 +G P P P PPGPP P GPP P Sbjct: 789 MGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P LP P PP PP P GP PP Sbjct: 871 VGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 +G P P P PPGPP P GPP P Sbjct: 874 MGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P P PPGP P GP PP Sbjct: 626 GPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P P PPGP P GP PP Sbjct: 796 GPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P P PPGP P GP PP Sbjct: 711 GPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P LP P PPGPP P G P P Sbjct: 171 GIQGPNGLPGPNGPLGPPGPPGDMGPPGLPGP 202 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 +P PP P PPGPP P G P P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPPGFPGP 56 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P LP PPGPP P G P PP Sbjct: 256 GPQGPNGLPGPNGILGPPGPPGDMGPPGLPGPP 288 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P P P PPGPP P GP P Sbjct: 623 GLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P P P PPGPP P GP P Sbjct: 708 GLPGPPGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P P P PPGPP P GP P Sbjct: 793 GLPGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPP 785 G P P P P GPP + P GPP Sbjct: 46 GPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 LG P P P P PGPP P GPP P Sbjct: 270 LGPPGP---PGDMGPPGLPGPPGPQMPPGPPGLP 300 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 PP PPP P PP PP Sbjct: 29 PPPPPPYEAPPPPPGPP 45 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P + P GPP + P GP PP Sbjct: 347 GQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 379 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P + P GPP + P GP PP Sbjct: 432 GQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 464 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P + P GPP + P GP PP Sbjct: 517 GQPGPPGINGPPGPLGDVGPPGLPGPPGPQMPP 549 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P P PPGP P G PP Sbjct: 881 GPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPP 913 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PPG P P GP PP Sbjct: 38 PPPPPGPP--GPDGPPGFPGPQGPNGPKGPP 66 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P P P GP GPP PP Sbjct: 43 GPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P + P GPP + P GP PP Sbjct: 262 GLPGPNGILGPPGPPGDMGPPGLPGPPGPQMPP 294 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 G P P + GPP + P GP SPP+ Sbjct: 687 GQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPS 720 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 G P P + GPP + P GP SPP+ Sbjct: 772 GQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPS 805 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 G P P + GPP + P GP SPP+ Sbjct: 857 GQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPS 890 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 35.9 bits (79), Expect = 0.049 Identities = 18/34 (52%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXV---GGRXXGEG 701 GG GGP G GGG GG GF GGR G G Sbjct: 46 GGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRG 79 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 35.1 bits (77), Expect = 0.085 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLP--PTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P P PP PPP P PP+PP Sbjct: 162 PQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPP 194 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +P PP P PP PP P PP PP Sbjct: 177 APPAPPPPGAPAAPPAPPFGGPPSAPPPPP 206 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 736 PXAPPAPPXXXXPXXPXLPP 795 P APPAPP P P PP Sbjct: 175 PAAPPAPPPPGAPAAPPAPP 194 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 736 PXAPPAPPXXXXPXXPXLPP 795 P APPAPP P P PP Sbjct: 187 PAAPPAPPFGGPPSAPPPPP 206 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PP P PP PPP P PP PP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPP 710 Score = 33.9 bits (74), Expect = 0.20 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 L P +PP P PP PPP P P +PP Sbjct: 674 LPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPP 707 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP P P P PPS P Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P PP P PP PPP PP PP+ Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPPS 712 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXP---XGPPSPP 794 P P PP P PP PPP P G P P Sbjct: 692 PPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSP 725 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P + P PP PPP P PP P+ Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPS 704 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P L PT P P PPP PP PP Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPPPPPP 246 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXP 773 P+P PP P PP PPPV P Sbjct: 231 PAPPP-PPAAAPPPPPPPPPVKKP 253 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 G P P PPT P PP PPP P PP P N Sbjct: 383 GPPPPP--PPTNGP--PPPPPPTNGPPPPPPPTN 412 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 +P PPT P PP PPP P PP P N Sbjct: 364 TPPPPPPTNKP--PPPPPPTNGPPPPPPPTN 392 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P PPT P PP PPP P PP P N Sbjct: 375 PPPPPPTNGP--PPPPPPTNGPPPPPPPTN 402 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 702 PSPXXLPPTXXPXX---PPGPPPVXXPXGPPSPPN 797 P P PP+ P PP PPP P PP P N Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTN 382 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PPP GPP PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PP PP PPP PP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPP 370 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PP P P PPP GPP PP Sbjct: 359 PPTNNTPPPPPPTNKP-PPPPPPTNGPPPPP 388 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLPPTXXPXX--PPGPPPVXXPXGPPSPP 794 P P PP P PP PPP PP PP Sbjct: 378 PPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+ PP PP PPP PP PP Sbjct: 360 PTNNTPPPPPPTNKPPPPPPPTNGPPPPPPP 390 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 690 HLGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 H PS PP P PP PPP P PSPP Sbjct: 194 HPTSPSQITQPPPPPPRPPPSPPPPPPPPS-PSPP 227 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP PP Sbjct: 205 PPPPPRPPPSPP--PPPPPPSPSPPRPPPPP 233 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLPPTXXP-XXPPGP-PPVXXPXGPPSPP 794 P P PP+ P PP P PP P PPSPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 PSP PP P P PPP P PP P Sbjct: 213 PSPPPPPPPPSPSPPRPPPP--PPPSPPRP 240 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 726 TXXPXXPPGPPPVXXPXGPPSPPN 797 T P PP PPP P PP P+ Sbjct: 202 TQPPPPPPRPPPSPPPPPPPPSPS 225 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PP P PP Sbjct: 220 PPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.9 bits (74), Expect = 0.20 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PP P PP PPP+ P PP+ P Sbjct: 77 PPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP-PSPP 794 P P PP P PP P P P P P PP Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXX-PXGPPSPPN 797 +P PP P P PPP P PP+PP+ Sbjct: 80 APPAAPPPPPPLPAPPPPPAQPAPQPPPAPPH 111 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP P P PPP P PP P Sbjct: 51 PPPPPSPPAAAPAAP--PPPAAAPAAPPPP 78 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 33.9 bits (74), Expect = 0.20 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPP--PVXXPXGPPSPP 794 P PPT P PP PP P P PP+PP Sbjct: 221 PPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPP 253 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 33.9 bits (74), Expect = 0.20 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P PP P PP PP P P+PP Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPP 221 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P+P PP P PP PP P P PP+ Sbjct: 112 PNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PP P P+PP Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P PP P PP PPP P PP PP Sbjct: 90 PNPPY-PPPPYPPYPP-PPPYPPPPNPPYPP 118 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 PSP P P PP PPP+ P P PPN Sbjct: 142 PSPNA--PYPPPPNPPYPPPLYPPPPNPPPPN 171 Score = 32.3 bits (70), Expect = 0.60 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP-PSPPN 797 P+P PP P PP PPP P P P PPN Sbjct: 207 PNPPYPPPPNAPN-PPYPPPPNAPNPPYPPPPN 238 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGP-PPVXXPXGPPSPP 794 P P PP P PP P P P PP PP Sbjct: 103 PPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPP 134 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P P PP P PP PP P PP PPN Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPP-PPN 192 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP PP P PP PP Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPP 197 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P PP P PP P P PP PP Sbjct: 183 PNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/35 (45%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP---PSPPN 797 P+P PP P PP PPP P P P PPN Sbjct: 152 PNPPYPPPLYPP--PPNPPPPNAPYPPPPYPPPPN 184 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PP P PP PPP P PP P Sbjct: 181 PPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSP 791 PPT PP PPP P PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPP 107 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/74 (25%), Positives = 22/74 (29%) Frame = +1 Query: 736 PXAPPAPPXXXXPXXPXLPPTXXXXXXXXXXXXXXXXXXXXXXXXXXPXQRAPKPPXNXP 915 P PP PP P P PP P AP PP P Sbjct: 151 PPNPPYPPPLYPPP-PNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Query: 916 RFGXXXHSPXPPPP 957 + ++P PP P Sbjct: 210 PYPPPPNAPNPPYP 223 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXXP-XGPPSPPN 797 +P PP P PP PPP P PP+ PN Sbjct: 172 APYPPPPYPPPPNPPYPPPPNPPYPPPPNAPN 203 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP PP PPP P PP P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGP-PSPPN 797 P P P PP PPP P P P PPN Sbjct: 197 PPPNAPNPPPPNPPYPPPPNAPNPPYPPPPN 227 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP-PSPPN 797 P P PP PP PP P P P PPN Sbjct: 176 PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P PP P P P P PP PP Sbjct: 128 PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPP 158 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP-PSPPN 797 P P PP P PP PP P P P PPN Sbjct: 98 PYPPYPPPPPYP-PPPNPPYPPPPNAPYPPPPN 129 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +3 Query: 708 PXXLPPTXXPXXPPG---PPPVXXPXGPPSPP 794 P PP P P PPP P PP PP Sbjct: 158 PPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXP-XGPPSPPN 797 P PP P P PPP P PP+ PN Sbjct: 189 PPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN 219 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PPT P PP PP P PP+ P Sbjct: 26 PPTDPPTDPPTDPPTDPPTDPPTDPPTDP 54 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPS 788 P PPT P PP PP P PP+ Sbjct: 30 PPTDPPTDPPTDPPTDPPTDPPTDPPT 56 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 6/37 (16%) Frame = +3 Query: 702 PSPXX-LPPTXXPXXPPG-----PPPVXXPXGPPSPP 794 PSP +PP P PPG PPP P G P PP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P LPP+ P PP PPP PP PP Sbjct: 560 GVDIPPPLPPSEDPKPPP-PPPEPPEECPPPPP 591 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PS PP PP PP P PP PP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPPP 580 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP P P PPP P PP+P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVXXPXGPPSPP 794 +PP P PP PPP P PP PP Sbjct: 1156 IPP---PPPPPPPPPPSSPSPPPPPP 1178 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PP P P PPP P PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 PS LPP P PP P+ P P PP+ Sbjct: 1036 PSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPS 1067 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 PSP P P PP PP P PP P+ Sbjct: 1062 PSPPPSEPAPPPRQPP-PPSTSQPVPPPRQPD 1092 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PSP P + PP PPP+ G P PP Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPP 154 Score = 31.9 bits (69), Expect = 0.79 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP P PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P T P PP PP GPP PP Sbjct: 140 PPPPIAPATGGP--PPPPPIAPATGGPPPPP 168 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P T P PP PP GPP PP Sbjct: 127 PPPPTSPATRAP--PPPPPIAPATGGPPPPP 155 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P P P G PP P PP PP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPP 207 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.3 bits (70), Expect = 0.60 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P+P +P P PP PP P PP+PP Sbjct: 180 PAPSTIPTPPTPPAPPSPP---IPTAPPTPP 207 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P+P P P PP PP P PP+PPN Sbjct: 328 PNPSIPPAPPNPSIPPAPP---NPSIPPAPPN 356 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 PS PP P PP PP + P PP+P Sbjct: 285 PSIPLAPPN--PYIPPAPPNLFIPSAPPNP 312 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 723 PTXXPXXPPGPPPVXXPXGPPSPPN 797 P P PP P + P PP+PP+ Sbjct: 172 PETKPPKPPAPSTIPTPPTPPAPPS 196 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPG----PPPVXXPXGPPSPPN 797 P+ PP PPG PP P PP+PPN Sbjct: 200 PTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPN 235 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P+P P + P PP PP P PP+P Sbjct: 257 PNPFIPPASPNPSIPPAPPNPSIP-APPNP 285 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P+P P P P PP P PP+P Sbjct: 310 PNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P+P P PP PP P PP+P Sbjct: 319 PNPYIPTAPPNPSIPPAPPNPSIPPAPPNP 348 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVXXPXGPPSPPN 797 +PPT P PP PPP+ P PPS N Sbjct: 63 IPPTLPPPPPPPPPPLPPP--PPSGGN 87 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPP 761 P P LPP P PP PPP Sbjct: 62 PIPPTLPPPPPPPPPPLPPP 81 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVXXPXGPPSPPN 797 +PPT P PP PPP+ P PPS N Sbjct: 287 IPPTLPPPPPPPPPPLPPP--PPSGGN 311 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPP 761 P P LPP P PP PPP Sbjct: 286 PIPPTLPPPPPPPPPPLPPP 305 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 32.3 bits (70), Expect = 0.60 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G GG G G Sbjct: 680 GGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G GG G+G Sbjct: 138 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.9 bits (69), Expect = 0.79 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G GG G+G Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDG 812 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G GG G+G Sbjct: 776 GGDGG--GGGDGGGGGGGGGGGGGGGGGGDG 804 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 723 PTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP PPP P PP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXP 773 P P PP P PP PPP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP PPP P PP P Sbjct: 862 PRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 PP PPP P PP PP Sbjct: 868 PPPPPPPPPPPPPPPPP 884 Score = 28.3 bits (60), Expect = 9.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 PP PPP P PP PP Sbjct: 869 PPPPPPPPPPPPPPPPP 885 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PP PP PPP P PP PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 705 SPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 +P P P PP PPP P PP P Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPPPPP 120 Score = 25.8 bits (54), Expect(2) = 5.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPV 764 P PP P PP PPP+ Sbjct: 103 PPPPPPPPPPPPPPPPPPI 121 Score = 21.8 bits (44), Expect(2) = 5.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 P PPP P P PP Sbjct: 136 PAPPPPPPPPPAPCMPP 152 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 31.9 bits (69), Expect = 0.79 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSP 791 PP P PP PPP P PP+P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P P +P P P GPP P GPP P Sbjct: 1698 GLPGPQGIP--GYPGAPAGPPGRDGPMGPPGP 1727 Score = 29.1 bits (62), Expect = 5.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSP 791 P P PP PPP P GP P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGP 1678 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 702 PSPXXLPP-TXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PGP P GPP PP Sbjct: 1666 PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPP 1697 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 735 PXXPPGPPPVXXPXGPPSP 791 P P GPP + P GPP P Sbjct: 1815 PGNPAGPPGLDGPPGPPGP 1833 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 690 HLGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 H P P PP P P GP + P GP P Sbjct: 1658 HYPAPPPPP-PPAPGPPGPDGPMGLPGPQGPDGP 1690 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P PP PP PPP+ PP PP Sbjct: 674 GAPPPPP-PPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXG--PPSPP 794 G P P PP P PPP P G PP PP Sbjct: 659 GPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPP 693 Score = 28.3 bits (60), Expect = 9.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 723 PTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP PPP G P PP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPP 679 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVXXPXGPPSPP 794 +PP P PP PPPV P PP Sbjct: 967 VPPPPLPPLPPPPPPVQTTTAPTLPP 992 Score = 28.7 bits (61), Expect = 7.4 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPV--XXPXGPPSP 791 P P L P P PP PPP+ P P +P Sbjct: 909 PPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTP 940 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 696 GXPSPXXLPPTXX-PXXPPGPPPVXXPXGPPSPP 794 G P P P P PP PPP P PP PP Sbjct: 288 GAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPP 321 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP P PP PPP PP PP Sbjct: 308 PPPGGAPP---PPPPPPPPPPGDGGAPPPPP 335 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP PPP G P PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPP 334 Score = 26.6 bits (56), Expect(2) = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 889 APKPPXNXPRFGXXXHSPXPPPP 957 AP PP P G P PPPP Sbjct: 301 APAPPPPPPPGGAPPPPPPPPPP 323 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 892 PKPPXNXPRFGXXXHSPXPPPP 957 P PP P G P PPPP Sbjct: 316 PPPPPPPPPPGDGGAPPPPPPP 337 Score = 24.2 bits (50), Expect(2) = 2.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 Query: 736 PXAPPAPPXXXXPXXPXLPP 795 P PP PP P P PP Sbjct: 302 PAPPPPPPPGGAPPPPPPPP 321 Score = 21.0 bits (42), Expect(2) = 5.1 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +1 Query: 736 PXAPPAPPXXXXPXXPXLPP 795 P PP P P P PP Sbjct: 290 PVPPPPPADGSAPAPPPPPP 309 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PPT P PP PPP P PP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 L P P P P P PPP P GPP PP Sbjct: 1252 LPPPPPGMRPMPPQPPFMP-PPPRMQPPGPPGPP 1284 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P P +PP PPGPP P GPP P Sbjct: 1264 PQPPFMPPPPR-MQPPGPP---GPPGPPGP 1289 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 3/33 (9%) Frame = +3 Query: 702 PSPXXLPPTXXPXX---PPGPPPVXXPXGPPSP 791 PSP PP+ P P GPPP+ P P P Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPP-PVXXPXGPPSPP 794 P P + P P P GPP P P GP PP Sbjct: 394 PGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPP 425 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PP P PP PPP P PS P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPPN 797 PP PPP P PP PP+ Sbjct: 55 PPPPPPPPPPPPPPPPPS 72 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGP 782 G P P PP PP PPP+ P P Sbjct: 738 GLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 P P L T PP PPP PP PP+ Sbjct: 700 PPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPS 731 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P L P PP PPP G P PP Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP 729 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/33 (45%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGP--PSPP 794 P P PP P PP PP P GP P+PP Sbjct: 96 PPPATPPPPTMPPTPP-PPQTPAPPGPDTPAPP 127 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 P+P P + P P PPP P PP+P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 702 PSPXXLPPTXX-PXXPPGPPPVXXPXGPPSPP 794 P+P L T P PP PPP P P S P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPPN 797 G P +PP P PPGP P G PP+ Sbjct: 226 GGMPPGRMPPQGLPFPPPGPIPPPPGAGGMRPPH 259 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXP---XGPPSPP 794 P P PPT PP PPP P GPP PP Sbjct: 343 PPPISKPPTSTRSAPP-PPPGRAPQPLGGPPPPP 375 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVX-XPXGPPSPP 794 +PP P PPGPPP P GP PP Sbjct: 1 MPP---PPPPPGPPPPPSAPSGPVKPP 24 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXP---XGPPSPP 794 P P PPT PP PPP P GPP PP Sbjct: 255 PPPISKPPTSTRSAPP-PPPGRAPQPLGGPPPPP 287 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEGXP 695 GG GG G GGG GG G G G G P Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPP 374 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 P P PP PPP PP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPP 101 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 690 HLGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 ++G + PP P P PPPV P P +P Sbjct: 1568 YIGSTTLPITPPPPTPSPPQTPPPVNTPPRPETP 1601 >SB_24012| Best HMM Match : RRM_1 (HMM E-Value=0.69) Length = 166 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPP 785 G P P PP P PPG P P PP Sbjct: 2 GGPGPLGHPPGYAPGYPPGYAPGHPPGYPP 31 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PS PP PP PPP PP PP Sbjct: 349 PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Frame = +3 Query: 696 GXPSPXXL----PPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P + PP PP PPP PP PP Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPP 380 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 G P P P PGPP P GPP PP Sbjct: 3808 GPPGPQG--PPGQASQIPGPPGPQGPPGPPGPP 3838 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 29.1 bits (62), Expect = 5.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G P +P P PGPP P GP P Sbjct: 648 GTPGSQGMPGMSGPPGRPGPPGPPGPPGPSGP 679 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.1 bits (62), Expect = 5.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 PP PPP P PP PP Sbjct: 425 PPPPPPAPLPPPPPPPP 441 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G G G+G Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDG 93 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P P P P PP P V P PP PP Sbjct: 292 PPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 702 PSPXXLPPTXXPXXP-PGPPPVXXPXGPPSPPN 797 PSP LP P P PPP P P PP+ Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPS 958 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.1 bits (62), Expect = 5.6 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG G G GGR G G Sbjct: 198 GGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 29.1 bits (62), Expect = 5.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG G G GG G G Sbjct: 1765 GGMGGGGGMAGGGGGMGGGGMAAGGGEFGGG 1795 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 4/25 (16%) Frame = +3 Query: 735 PXXPPGPPPVXX----PXGPPSPPN 797 P PP PPP+ P PP PPN Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPN 29 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 28.7 bits (61), Expect = 7.4 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 720 PPTXXPXXPPGPPPVXXPXGPPSPP 794 PPT P PP PP P P PP Sbjct: 232 PPTAPPNTPP-PPVTPPPPNTPGPP 255 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 735 PXXPPGPPPVXXPXGPPSPP 794 P PP PPPV P P S P Sbjct: 293 PSCPPCPPPVICPKAPKSTP 312 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.7 bits (61), Expect = 7.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 717 LPPTXXPXXPPGPPPVXXPXGPPSPP 794 +P T P PP PP + P PP P Sbjct: 780 IPTTPPPEYPPPPPGLARPNPPPPNP 805 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG G GGG GG G+ GGR G G Sbjct: 94 GGRRERGGRGGGGGYGGGGGYGGGGRSYGGG 124 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 28.7 bits (61), Expect = 7.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 744 PPGPPPVXXPXGPPSPP 794 PP PPPV PP+PP Sbjct: 1166 PPQPPPVPSVQAPPAPP 1182 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGP--PPVXXPXGPPSPP 794 P LPP P P P PP P G P PP Sbjct: 2622 PPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 28.3 bits (60), Expect = 9.7 Identities = 16/33 (48%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXV--GGRXXGEG 701 GG G G GGG GG G GGR GEG Sbjct: 145 GGIGRGGGRGRGGGEGGWGGRGGNGGGRGGGEG 177 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 28.3 bits (60), Expect = 9.7 Identities = 23/79 (29%), Positives = 24/79 (30%) Frame = -3 Query: 955 GGGAXGSEXXARXGXRXXGVLGPFGXGXXXXXXXXXXXXXXXXXXXXAXXXXXLGGXGGP 776 GGG G G G GP G G GG GG Sbjct: 180 GGGGGGFYTDGSSGSNFGGAYGPGGEGGKAFLNGGVGGRSVWNGVPGG-----FGGGGGV 234 Query: 775 XGXXTGGGPGGXXGFXVGG 719 G GGG GG G+ GG Sbjct: 235 WGN--GGGGGGGGGYSGGG 251 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 696 GXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSP 791 G SP PP PP PP P PP P Sbjct: 906 GSESPSASPPGGSVPPPPPPPGGNAPLPPPPP 937 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Frame = +3 Query: 693 LGXPSPXXLPPTXXP-XXPPGPPPVXXPXGPPSPPN 797 +G P +PP P PPG P PP PP+ Sbjct: 266 MGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPPS 301 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -3 Query: 793 GGXGGPXGXXTGGGPGGXXGFXVGGRXXGEG 701 GG GG G GGG GG G GG G+G Sbjct: 308 GGGGGDGGG--GGGGGGGGGGDGGGDGDGDG 336 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P LPP P P PP P PP PP Sbjct: 476 PLPLPPEL-PGSPGDSPPATSPKQPPLPP 503 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 28.3 bits (60), Expect = 9.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 702 PSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 PS P P PP PPP P P SPP Sbjct: 515 PSCCGSYPAPQPPSPPAPPPKPAPP-PRSPP 544 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 708 PXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 P PPT PP P P PP PP Sbjct: 301 PPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 >SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1271 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +3 Query: 693 LGXPSPXXLPPTXXPXXPPGPPPVXXPXGPPSPP 794 +G P +P P PPG P GP PP Sbjct: 1060 IGAPGADGVPGPKGPPGPPGYPGFKGYRGPQGPP 1093 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,155,953 Number of Sequences: 59808 Number of extensions: 284513 Number of successful extensions: 3159 Number of sequences better than 10.0: 72 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2280 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2812459436 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -