BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O14 (1001 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0059 - 394001-394708 32 0.62 05_01_0564 - 4919294-4919391,4919491-4919620,4919700-4919789,491... 32 0.83 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.4 09_02_0543 + 10427321-10428315,10428440-10429154 30 2.5 06_01_0486 - 3455030-3455770 30 2.5 02_01_0302 - 2021221-2023305 30 3.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 30 3.3 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 29 4.4 03_02_0445 - 8551912-8552047,8552729-8552896,8553785-8554068,855... 29 4.4 03_06_0451 + 34025048-34027099,34028210-34028242 29 5.8 02_05_0686 - 30900748-30902167,30903442-30904742 29 5.8 01_05_0687 + 24288648-24292746,24293737-24293844,24294333-242944... 29 5.8 11_01_0066 - 536281-537196,537397-537452 29 7.7 09_02_0357 + 7788946-7789326,7789620-7789997 29 7.7 >08_01_0059 - 394001-394708 Length = 235 Score = 32.3 bits (70), Expect = 0.62 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 3/38 (7%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXP---LSPSXPXGPXXTPXP 978 PP +P + PPPSH P +SP P P +P P Sbjct: 36 PPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSPPP 73 Score = 29.9 bits (64), Expect = 3.3 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 PP P R PPP+ P P P P P P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSPCXP 993 PP SP PPP+ P PS P P P SP P Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPPSHPLAP-PPPHISPPAP 64 >05_01_0564 - 4919294-4919391,4919491-4919620,4919700-4919789, 4919882-4919987,4920087-4920187,4920347-4920442, 4920549-4920648,4920761-4920897,4920980-4921111, 4921222-4921320,4921397-4921594,4921715-4921892, 4922020-4922075,4922168-4922320,4922422-4922514, 4922605-4922706,4922817-4922878,4922995-4923090, 4923354-4923453,4923546-4923617,4923728-4923775, 4923853-4923996 Length = 796 Score = 31.9 bits (69), Expect = 0.83 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = +3 Query: 213 EQKAKETLKNANVTKVLLAALDEVQLQSLPLGAGILIYHLPTKIKPQTMSXLNXICQYIA 392 ++ A+ L N VT L A + E + G L+Y + TK + + QYI Sbjct: 26 QRTAENALANRKVTANLTAVIAEAGVSGCDKSVGNLLYTVATKYPANALVHRPVVIQYIV 85 Query: 393 SGK 401 S K Sbjct: 86 SSK 88 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXP-LSPSXPXGPXXTPXPSPCXP 993 PP P PPP+ P LSPS P P P PS P Sbjct: 1154 PPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPP 1194 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 30.3 bits (65), Expect = 2.5 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 Query: 877 PTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 P P +PPP SP+ P P TP P P Sbjct: 35 PPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGP 70 >06_01_0486 - 3455030-3455770 Length = 246 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +1 Query: 868 IXPPTSPGRHXIPPPSHXTXXPL--SPSXPXGPXXTPXPSP 984 I PPT P +PPP+ + P P+ P P P PSP Sbjct: 116 IPPPTPP---YVPPPTPPSPPPYVPPPTPPSPPPYVPPPSP 153 Score = 29.1 bits (62), Expect = 5.8 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +1 Query: 868 IXPPTSPG-RHXIPPPSHXTXXPLSPSXPXGPXXTPXPSPCXP 993 I PPT P IPPP+ P P+ P P P P+P P Sbjct: 104 IPPPTPPYVPPYIPPPTPPYVPP--PTPPSPPPYVPPPTPPSP 144 >02_01_0302 - 2021221-2023305 Length = 694 Score = 29.9 bits (64), Expect = 3.3 Identities = 19/48 (39%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Frame = +1 Query: 874 PPTS----PGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP--CXPXS 999 PPT G PPSH P +P P GP P P+P C P S Sbjct: 603 PPTQHVPGAGTPTTTPPSHS--HPSTPPSPSGPSFHPPPTPHNCSPPS 648 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.9 bits (64), Expect = 3.3 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +1 Query: 886 PGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSPC 987 P R PPP H P P P P P P PC Sbjct: 116 PPRPPPPPPPHPPEDP-PPHPPHPPDHPPPPPPC 148 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 29.5 bits (63), Expect = 4.4 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +1 Query: 877 PTSPG-RHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 PT P +H PPPSH P P+ P P P Sbjct: 251 PTLPQPQHQAPPPSHPPALPALPAPNAPPPPAPQSQP 287 >03_02_0445 - 8551912-8552047,8552729-8552896,8553785-8554068, 8554143-8555386,8556901-8556967,8557059-8557150, 8557269-8557480,8558541-8558623,8559092-8559122, 8559770-8559951,8560557-8560616,8561092-8561289, 8561485-8561539,8562740-8562855,8563012-8563176, 8563310-8563483,8564134-8564333,8564778-8564882, 8565063-8565126,8566452-8566718 Length = 1300 Score = 29.5 bits (63), Expect = 4.4 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 389 CIRKXGFNVAEXTXPRTTFLAILMKLM*ILRNLK-KPVXLVXXSHPN 526 C R+ GFNV E P+T L + + L KP L SHP+ Sbjct: 458 CAREQGFNVIELNMPKTVVFPFLPHNKLLAQTLDLKPDKLHDSSHPS 504 >03_06_0451 + 34025048-34027099,34028210-34028242 Length = 694 Score = 29.1 bits (62), Expect = 5.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 327 GKSKCLHQVEATAIAPHLTPQAILW 253 G+S CL + EA ++ LTP ++W Sbjct: 488 GRSGCLDEAEALILSMPLTPDGVIW 512 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 29.1 bits (62), Expect = 5.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 PP P + PPP P P P GP P P P Sbjct: 336 PPPPPPKG--PPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 29.1 bits (62), Expect = 5.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 PP P + PPP P P P G P P P Sbjct: 345 PPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 >01_05_0687 + 24288648-24292746,24293737-24293844,24294333-24294442, 24295208-24295282 Length = 1463 Score = 29.1 bits (62), Expect = 5.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 874 PPTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPSP 984 PP S R PPPSH P P P P P P Sbjct: 10 PPES-ARMGSPPPSHSPSPPPLQGDPSLPTDAPPPEP 45 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 28.7 bits (61), Expect = 7.7 Identities = 16/42 (38%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +1 Query: 874 PPTSPGRHXI--PPPSHXTXXPLSPSXPXGPXXTPXPSPCXP 993 PP SP I PPPS + P S + P P TP + P Sbjct: 211 PPASPPPPSIATPPPSPASPPPPSTATPPPPSPTPTTTRASP 252 >09_02_0357 + 7788946-7789326,7789620-7789997 Length = 252 Score = 28.7 bits (61), Expect = 7.7 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +1 Query: 877 PTSPGRHXIPPPSHXTXXPLSPSXPXGPXXTPXPS 981 PT P H PP S P + + P P P P+ Sbjct: 139 PTPPRAHTTPPCSRSVAAPRASTSPLRPSPVPPPA 173 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,369,759 Number of Sequences: 37544 Number of extensions: 311302 Number of successful extensions: 2547 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2407 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2940399740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -