BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O13 (970 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 39 0.001 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 36 0.006 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 36 0.009 SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 31 0.18 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 31 0.24 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 31 0.24 SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr... 29 0.75 SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex p... 29 0.98 SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 28 1.7 SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family ... 27 4.0 SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1... 27 4.0 SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Sc... 27 5.3 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 6.9 SPAC26A3.02 |myh1|myh|adenine DNA glycosylase |Schizosaccharomyc... 26 9.2 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 38.7 bits (86), Expect = 0.001 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 +PPPP + T P P PP P PP P PP PPP P Sbjct: 731 SPPPPPPAVIVPTPAP--APIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 33.9 bits (74), Expect = 0.035 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP P P P PP P P PPP PP P Sbjct: 732 PPPPPPAVIVPTPAP---APIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 Score = 30.3 bits (65), Expect = 0.43 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPP + P P P + PP P P PPP PP P Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPP---PPPPPPGVAGAGPPPPPPPP 782 Score = 29.5 bits (63), Expect = 0.75 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P PP P PP PPPPP + P PP P Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 27.9 bits (59), Expect = 2.3 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPP 923 PP P P P P P PP PP P PPP Sbjct: 732 PPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPP 781 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/51 (29%), Positives = 15/51 (29%) Frame = +2 Query: 719 PPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPP 871 PP P P P G PPPP A PP PP Sbjct: 733 PPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPPPPPP 783 Score = 26.6 bits (56), Expect = 5.3 Identities = 14/46 (30%), Positives = 14/46 (30%), Gaps = 1/46 (2%) Frame = +2 Query: 689 PXPPPTXXPXPPXXP-XXXPXXPXXXXXPXXXXXSXXXGXXAPPPP 823 P PP P P P P P P G PPPP Sbjct: 734 PPPPAVIVPTPAPAPIPVPPPAPIMGGPPPPPPPPGVAGAGPPPPP 779 Score = 26.2 bits (55), Expect = 6.9 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPP 928 AP P A PP PP PP PP P PP Sbjct: 747 APIPVPPPAPIMGGPP---PPPPPPGVAGAGPPPPPPPPP 783 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 36.3 bits (80), Expect = 0.006 Identities = 26/93 (27%), Positives = 28/93 (30%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P P P+ P P P P P S APP P + PP P Sbjct: 1132 PVPVPSGAPPVPKPSVAAPPVPAPSGAPPVPKPSVA----APPVPAPSS---GIPPVPKP 1184 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 G P P P P P PPP P Sbjct: 1185 AAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAP 1217 Score = 32.3 bits (70), Expect = 0.11 Identities = 22/89 (24%), Positives = 25/89 (28%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P P P+ P P P P P S PP P + + P Sbjct: 1023 PVPLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPA---- 1078 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P G P P P P P P P Sbjct: 1079 PSGAPPVPAPSGIPPVPKPSVAAPPVPKP 1107 Score = 29.1 bits (62), Expect = 0.98 Identities = 22/95 (23%), Positives = 23/95 (24%), Gaps = 1/95 (1%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P P P+ P P P P P P P P Sbjct: 1033 PIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIP 1092 Query: 869 PXGPPXXPXXPXP-PXTPXPPXTXQXFPPPXXXPS 970 P P P P P PP PP PS Sbjct: 1093 PVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPS 1127 Score = 28.3 bits (60), Expect = 1.7 Identities = 25/105 (23%), Positives = 26/105 (24%), Gaps = 11/105 (10%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFT- 865 P P PT P P P P P S APP P + P Sbjct: 1042 PVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAA 1101 Query: 866 ----------PPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PP P P PP PP PS Sbjct: 1102 PPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPKPS 1146 Score = 27.5 bits (58), Expect = 3.0 Identities = 20/74 (27%), Positives = 21/74 (28%), Gaps = 4/74 (5%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQP---XPPXLXPPXXPP 884 P P P P PP PPP P +P PP P PP Sbjct: 1159 PPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPVPPPSTAPP 1218 Query: 885 -XXPXXXXPXXPPP 923 P P P P Sbjct: 1219 VPTPSAGLPPVPVP 1232 Score = 27.1 bits (57), Expect = 4.0 Identities = 25/93 (26%), Positives = 25/93 (26%), Gaps = 3/93 (3%) Frame = +2 Query: 701 PTXXPX---PPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPP 871 PT P PP P P APP P A PP P Sbjct: 982 PTSEPPKDHPPSAPLSKPVSTSPAAPLARVPPVPKLSSKAPPVPLPSA---DAPPIPVPS 1038 Query: 872 XGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PP P P P PPP PS Sbjct: 1039 TAPP-VPIPTSTPPVPKSSSGAPSAPPPVPAPS 1070 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 APP P P TPP PP P P P P P Sbjct: 1031 APPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAP 1083 Score = 26.2 bits (55), Expect = 6.9 Identities = 21/92 (22%), Positives = 22/92 (23%), Gaps = 3/92 (3%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPP---PTXXALFXTXPPX 859 P P P+ P P P P PPP P PP Sbjct: 1151 PVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPSVGVPPV 1210 Query: 860 FTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P PP P P P P P Sbjct: 1211 PPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAP 1242 Score = 25.8 bits (54), Expect = 9.2 Identities = 21/97 (21%), Positives = 21/97 (21%), Gaps = 6/97 (6%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXP------P 856 PPP P P P APP P P P Sbjct: 1063 PPPVPAPSSEIPSIPAPSGAPPVPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPP 1122 Query: 857 XFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P P P P P P P P P Sbjct: 1123 VPKPSVAAPPVPVPSGAPPVPKPSVAAPPVPAPSGAP 1159 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 35.9 bits (79), Expect = 0.009 Identities = 25/92 (27%), Positives = 28/92 (30%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPX 874 PPP P P P PP PT +L + PP PP Sbjct: 376 PPPLSSSRAVSNPPAPPPAIPGRSAPALPPLGNASRTSTPPVPTPPSLPPSAPPSL-PPS 434 Query: 875 GPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PP P P P PP P P P+ Sbjct: 435 APPSLPMG-APAAPPLPPSAPIAPPLPAGMPA 465 Score = 33.9 bits (74), Expect = 0.035 Identities = 26/89 (29%), Positives = 27/89 (30%), Gaps = 1/89 (1%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPP-PPTXXALFXTXPPXFT 865 P PPP P P P G AP PP A + PP T Sbjct: 362 PPPPPRSAPSTGRQPPPLSSSRAVSNPPAPPPA--IPGRSAPALPPLGNASRTSTPPVPT 419 Query: 866 PPXGPPXXPXXPXPPXTPXPPXTXQXFPP 952 PP PP P P P P PP Sbjct: 420 PPSLPPSAPPSLPPSAPPSLPMGAPAAPP 448 Score = 33.1 bits (72), Expect = 0.060 Identities = 23/75 (30%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +2 Query: 704 TXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPP-PTXXALFXTXPPXFTPPXGP 880 T P P P P P P S G A PP P + P P P Sbjct: 412 TSTPPVPTPPSLPPSAPPSL--PPSAPPSLPMGAPAAPPLPPSAPIAPPLPAGM--PAAP 467 Query: 881 PXXPXXPXPPXTPXP 925 P P P PP P P Sbjct: 468 PLPPAAPAPPPAPAP 482 Score = 27.5 bits (58), Expect = 3.0 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 1/50 (2%) Frame = +3 Query: 774 PPXXXXXXXGXXP-PPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPP 920 PP P P PP L P P P PP P P P PP Sbjct: 404 PPLGNASRTSTPPVPTPPSLPPSAPPSLPPSAPPSLPMGAP--AAPPLPP 451 Score = 26.2 bits (55), Expect = 6.9 Identities = 15/53 (28%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +3 Query: 810 PPPPPXLXPFXQPXP-PXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PP PP + P P L P PP P PP +P P Sbjct: 230 PPIPPSIPSSRPPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNP 282 Score = 26.2 bits (55), Expect = 6.9 Identities = 15/51 (29%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +2 Query: 815 PPPTXXALFXTXPPXFTPPXG-----PPXXPXXPXPPXTPXPPXTXQXFPP 952 PP +L PP PP PP P P P + P PP Sbjct: 241 PPERVPSLSAPAPPPIPPPSNGTVSSPPNSPPRPIAPVSMNPAINSTSKPP 291 Score = 25.8 bits (54), Expect = 9.2 Identities = 18/60 (30%), Positives = 20/60 (33%), Gaps = 8/60 (13%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPX--------LXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP + PP L PP PP PP R PP + P Sbjct: 311 PPPPPPPSRRNRGKPPIGNGSSNSSLPPPPPPPRSNAAGSIPLPPQGRSAPPPPPPRSAP 370 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 31.5 bits (68), Expect = 0.18 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 Query: 851 PPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP + P PP P PP P P PPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPP 1733 Score = 30.3 bits (65), Expect = 0.43 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 818 PPTXXALFXTXPPXFTPPXGPPXXPXXP-XPPXTPXPPXTXQXFP 949 PP A PP PP PP P P PP P PP P Sbjct: 1699 PPQMSAPTPPPPPMSVPP--PPSAPPMPAGPPSAPPPPLPASSAP 1741 Score = 29.5 bits (63), Expect = 0.75 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPX-LXPPXXP-PXXPXXXXPXXPPP 923 PPPPP P PP PP P P P P P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 27.9 bits (59), Expect = 2.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +3 Query: 816 PPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPP 923 PP P P P + PP P P PPP Sbjct: 1699 PPQMSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPP 1734 Score = 27.1 bits (57), Expect = 4.0 Identities = 13/36 (36%), Positives = 13/36 (36%), Gaps = 2/36 (5%) Frame = +2 Query: 866 PPXGPPXXPXXPXPPX--TPXPPXTXQXFPPPXXXP 967 P PP P PP P PP PPP P Sbjct: 1686 PVSTPPVRPQSAAPPQMSAPTPPPPPMSVPPPPSAP 1721 Score = 26.6 bits (56), Expect = 5.3 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = +3 Query: 801 GXXPPPPPXLXPFXQPX---PPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 G P P P +P PP + P PP P P PPP PP A P Sbjct: 1679 GGMAPAHPVSTPPVRPQSAAPPQMSAPTPPP--PPMSVP--PPPSAPPMPAGPPSAPP 1732 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 31.1 bits (67), Expect = 0.24 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G GG G GG G G G GGG P GG G G Sbjct: 194 GGGSGGPPP--GPGGFGGFGGFGGEGHHHGGHGGFGGG--PGGFEGGPGGFGGGPGGFGG 249 Query: 742 XXXXXXGGXGXXCXGXXG 689 GG G G G Sbjct: 250 GLGGFGGGPGGFGGGPGG 267 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 31.1 bits (67), Expect = 0.24 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXP--PXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PP P L P QP P PP P P P PPP Q + + P Sbjct: 165 PPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRP 218 Score = 28.3 bits (60), Expect = 1.7 Identities = 16/61 (26%), Positives = 17/61 (27%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P P P PP PP P L P PP + P Sbjct: 144 PPRPSIPPPSPASAPPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSAVPPMPPKVPP 203 Query: 870 P 872 P Sbjct: 204 P 204 Score = 26.6 bits (56), Expect = 5.3 Identities = 16/53 (30%), Positives = 18/53 (33%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 AP PPT + PP P P P P PP + P P P Sbjct: 127 APAPPTPQS-------ELRPPTSAPPRPSIPPPSPASAPPIPSKAPPIPSSLP 172 Score = 26.2 bits (55), Expect = 6.9 Identities = 22/92 (23%), Positives = 27/92 (29%), Gaps = 1/92 (1%) Frame = +2 Query: 698 PPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXG 877 PPT P P P P P + PPP A + P + P Sbjct: 139 PPTSAPPRPSIPPPSPASA-----PPIPSKAPPIPSSLPPPAQPAAPVKSPPSAPSLPSA 193 Query: 878 PPXXPXX-PXPPXTPXPPXTXQXFPPPXXXPS 970 P P P PP + P P P+ Sbjct: 194 VPPMPPKVPPPPLSQAPVANTSSRPSSFAPPA 225 >SPBC2D10.10c |fib1|fib|fibrillarin|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 29.5 bits (63), Expect = 0.75 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = -2 Query: 927 GGXGVXGGX-GXXGXXGGPXGGVKXGGXVXKRAXXVGGGGA 808 G G GG G G GG GG + GG R G GGA Sbjct: 13 GSRGGRGGFNGGRGGFGGGRGGARGGGRGGARGGRGGRGGA 53 Score = 28.7 bits (61), Expect = 1.3 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -2 Query: 966 GXXXGGGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXV 844 G GGG+ G G G G G G GG K G V Sbjct: 33 GGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGGAKV 73 Score = 27.1 bits (57), Expect = 4.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = -1 Query: 919 GGXXGXXXXGXXGGXXG-GXKXGGXGXKKGXXCGGGGG 809 GG G G GG G G GG G G G GG Sbjct: 33 GGARGGGRGGARGGRGGRGGARGGRGGSSGGRGGAKGG 70 >SPBC20F10.01 |gar1|SPBC25H2.01c|snoRNP pseudouridylase complex protein Gar1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 194 Score = 29.1 bits (62), Expect = 0.98 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = -1 Query: 964 GXAXGGEXLXCXRXGGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGG 809 G GG GG G G GG GG + G G +G GG G Sbjct: 141 GGFRGGRGGSRGGFGGNSRGGFGGGSRGGFGGGSRGGSRGGFRGGSRGGFRG 192 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 28.3 bits (60), Expect = 1.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPP 857 PPPPP P QP PP Sbjct: 12 PPPPPGFEPPSQPPPP 27 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 851 PPXFTPPXGPPXXPXXPXPPXTPXPP 928 PP PP PP P P P PP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 6.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 878 PPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP P P PP PP PPP Sbjct: 5 PPGNPPPPPPPPGFEPPSQPPPPPPP 30 Score = 26.2 bits (55), Expect = 6.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 801 GXXPPPPPXLXPFXQPXPPXLXPPXXPPXXP 893 G PPPPP PP PP PP P Sbjct: 7 GNPPPPPP---------PPGFEPPSQPPPPP 28 Score = 26.2 bits (55), Expect = 6.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPP 884 PPPPP F P P PP PP Sbjct: 9 PPPPPPPPGFEPPSQP---PPPPPP 30 >SPAC16E8.01 |||cytoskeletal protein binding protein Sla1 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 1420 Score = 27.1 bits (57), Expect = 4.0 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 Query: 851 PPXFTPPXGPPXXPXXPXPPXTPXPPXT 934 PP +TP P P PP T P T Sbjct: 224 PPTYTPKQADPLPAPPPPPPPTLPPQST 251 >SPAPJ760.02c |app1||App1 protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 857 Score = 27.1 bits (57), Expect = 4.0 Identities = 21/87 (24%), Positives = 22/87 (25%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPX 874 P P PP P P P P PP + P P Sbjct: 599 PEAPSVPQPPVAPVA-PEVPSVPQRPAVPVVPEAPSVPQPPAAPVVPEVPSVPQRPAVPV 657 Query: 875 GPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P P P PP P P PP Sbjct: 658 -VPEAPSVPQPPAAPVVPEVPSVPQPP 683 >SPAC29B12.07 |sec16||multidomain vesicle coat component Sec16|Schizosaccharomyces pombe|chr 1|||Manual Length = 1995 Score = 26.6 bits (56), Expect = 5.3 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 5/30 (16%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFT-----PPXGPP 883 APPPP AL PP PP GPP Sbjct: 1881 APPPPPPMALPKAGPPSAAPTSALPPAGPP 1910 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 26.2 bits (55), Expect = 6.9 Identities = 22/88 (25%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = +2 Query: 701 PTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXGP 880 P P P P P + PPPPT ++ + P +PP P Sbjct: 872 PMRRAAPSMAPVRSPFPGASSAQPAAMSRTSSVSTLPPPPPT-ASMTASAPAIASPP--P 928 Query: 881 PXXPXXPXPP---XTPXPPXTXQXFPPP 955 P PP T PP P P Sbjct: 929 PKVGETYHPPTASGTRVPPVQQPSHPNP 956 >SPAC26A3.02 |myh1|myh|adenine DNA glycosylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 461 Score = 25.8 bits (54), Expect = 9.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 539 MEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDN 435 ++K Q+ G +L + +H+F+ SPD V N Sbjct: 369 IKKYQSRGRYLHIFSHIRKTSHVFYAIASPDIVTN 403 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,405,428 Number of Sequences: 5004 Number of extensions: 36255 Number of successful extensions: 295 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 73 effective length of database: 1,997,186 effective search space used: 497299314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -