BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O13 (970 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 87 3e-17 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 3e-17 SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 8e-16 SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 4e-14 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 7e-14 SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 66 4e-11 SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) 66 4e-11 SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) 63 3e-10 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 4e-09 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 56 3e-08 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 8e-08 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 55 1e-07 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 1e-07 SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 53 3e-07 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 53 4e-07 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 52 5e-07 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 51 2e-06 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 50 2e-06 SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) 50 2e-06 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 47 2e-05 SB_21487| Best HMM Match : MAM (HMM E-Value=0) 46 5e-05 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 44 2e-04 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 44 2e-04 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 44 2e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 43 3e-04 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 42 6e-04 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 41 0.001 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 41 0.001 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 41 0.001 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 41 0.001 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 41 0.001 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 41 0.001 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 41 0.001 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 41 0.001 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 41 0.001 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 0.001 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 41 0.001 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 41 0.001 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 41 0.001 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 41 0.001 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 41 0.001 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 41 0.001 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 41 0.001 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 41 0.001 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 41 0.001 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 41 0.001 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 41 0.001 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 41 0.001 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 41 0.001 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 41 0.001 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 41 0.001 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 41 0.001 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 41 0.001 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 41 0.001 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 41 0.001 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 41 0.001 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 41 0.001 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 41 0.001 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 41 0.001 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 41 0.001 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 41 0.001 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 41 0.001 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 41 0.001 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 41 0.001 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 41 0.001 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 41 0.001 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 41 0.001 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 41 0.001 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 41 0.001 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 41 0.001 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 41 0.001 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 41 0.001 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 41 0.001 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 41 0.001 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) 41 0.001 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 41 0.001 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.001 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 41 0.001 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 41 0.001 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 41 0.001 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 41 0.001 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 41 0.001 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 41 0.001 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 41 0.001 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 41 0.001 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 41 0.001 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 41 0.001 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 41 0.001 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 41 0.001 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 41 0.001 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 41 0.001 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 41 0.001 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 41 0.001 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 41 0.001 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 0.001 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 41 0.001 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 41 0.001 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 41 0.001 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31853| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 41 0.001 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 41 0.001 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 41 0.001 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26034| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 41 0.001 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 41 0.001 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 41 0.001 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 41 0.001 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 41 0.001 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 41 0.001 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18572| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 41 0.001 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 41 0.001 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 41 0.001 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 41 0.001 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 41 0.001 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 41 0.001 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 41 0.001 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 86.6 bits (205), Expect = 3e-17 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = +2 Query: 296 CINESANARGXAVCVLGALPLPRSLTRCARSFGXGERYXLTXRR 427 CINESANARG AVCVLGALPLPRSLTRCARSFG GERY LT RR Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 143 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 86.6 bits (205), Expect = 3e-17 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = +2 Query: 296 CINESANARGXAVCVLGALPLPRSLTRCARSFGXGERYXLTXRR 427 CINESANARG AVCVLGALPLPRSLTRCARSFG GERY LT RR Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRCARSFGCGERYQLTQRR 507 >SB_33595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 901 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 772 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 814 >SB_29737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 14 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_21722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 37 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 79 >SB_48113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 466 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 419 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 461 >SB_17601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 568 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 610 >SB_8730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 36 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 78 >SB_466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 81.8 bits (193), Expect = 8e-16 Identities = 36/43 (83%), Positives = 36/43 (83%) Frame = -1 Query: 511 FYXSWPFAGLLLTCSFLXYPLILWITVLPPXSEXIPLXXXERP 383 FY SWPFAGLLLTCSFL YPLILWITVLPP SE IPL ERP Sbjct: 14 FYGSWPFAGLLLTCSFLRYPLILWITVLPPLSELIPLAAAERP 56 >SB_39971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 77.0 bits (181), Expect = 2e-14 Identities = 34/47 (72%), Positives = 36/47 (76%) Frame = -3 Query: 557 QGGXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 Q G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 91 QAGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 137 >SB_28260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 76.2 bits (179), Expect = 4e-14 Identities = 35/45 (77%), Positives = 36/45 (80%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G PM K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 18 GAEPM-KNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 75.4 bits (177), Expect = 7e-14 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE*XD 408 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E D Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFEYGD 64 >SB_32025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 75.4 bits (177), Expect = 7e-14 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = -3 Query: 560 VQGGXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 + G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 56 LNSGGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 103 >SB_54556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_54315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_49553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_45413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_40025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_37523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_36248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_33172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_30123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_24881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_13466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_12912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_10334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_8826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_7776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_6431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_5382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_4800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_1110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_53281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_39403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_35631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_29245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_26817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_22420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_2684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFE 61 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 73.7 bits (173), Expect = 2e-13 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAFCWPFAHMFFPALSPDSVDNRITA + Sbjct: 17 GGRSLWKNASNAAFLRFLAFCWPFAHMFFPALSPDSVDNRITAFD 61 >SB_29741| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 45 Score = 72.9 bits (171), Expect = 4e-13 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -3 Query: 533 KRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 K + FLRFLAFCWPFAHMF+PALSPDSVDNRITA E Sbjct: 7 KNASNAAFLRFLAFCWPFAHMFYPALSPDSVDNRITAFE 45 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 66.1 bits (154), Expect = 4e-11 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 517 PXAWRFSIGLXPP*TSXXKIDAQVRGGETRPDYKDTRRFPL 639 P WRFSIG P TS KIDAQVRGGETR DYKDTRRFPL Sbjct: 109 PRCWRFSIGSAPL-TSITKIDAQVRGGETRQDYKDTRRFPL 148 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = +2 Query: 446 NQGIXQERTCEQKASKRPGXVKXAR 520 NQGI QERTCEQKASKRPG VK R Sbjct: 86 NQGITQERTCEQKASKRPGTVKRPR 110 >SB_39266| Best HMM Match : DCX (HMM E-Value=9.4e-15) Length = 347 Score = 66.1 bits (154), Expect = 4e-11 Identities = 32/41 (78%), Positives = 32/41 (78%) Frame = +1 Query: 517 PXAWRFSIGLXPP*TSXXKIDAQVRGGETRPDYKDTRRFPL 639 P WRFSIG P TS KIDAQVRGGETR DYKDTRRFPL Sbjct: 138 PRCWRFSIGSAPL-TSITKIDAQVRGGETRQDYKDTRRFPL 177 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +2 Query: 443 QNQGIXQERTCEQKASKRPGXVKXAR 520 +NQGI QERTCEQKASKRPG VK R Sbjct: 114 KNQGITQERTCEQKASKRPGTVKRPR 139 >SB_46297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 64.5 bits (150), Expect = 1e-10 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = -3 Query: 551 GXXPMEKRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE 417 G + K + FLRFLAF WPFAHMFF ALSPD VDNRITA E Sbjct: 17 GGRSLWKNASNAAFLRFLAFGWPFAHMFFRALSPDCVDNRITAFE 61 >SB_6221| Best HMM Match : DUF1289 (HMM E-Value=6) Length = 77 Score = 63.3 bits (147), Expect = 3e-10 Identities = 30/44 (68%), Positives = 31/44 (70%) Frame = -3 Query: 533 KRQAXGPFLRFLAFCWPFAHMFFPALSPDSVDNRITAXE*XDTA 402 K + FLRFLAFCWPF HMF PALSPDSVD ITA E D A Sbjct: 7 KNASNAAFLRFLAFCWPFDHMFSPALSPDSVDICITAFERDDIA 50 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 59.7 bits (138), Expect = 4e-09 Identities = 31/94 (32%), Positives = 33/94 (35%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP P PP P P P PPPP PP P Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN-----PPPPNAPYPPPPYPPPPNP 185 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 P PP P P PP P PP +PPP P+ Sbjct: 186 PYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPN 219 Score = 54.4 bits (125), Expect = 1e-07 Identities = 33/99 (33%), Positives = 37/99 (37%), Gaps = 6/99 (6%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPP-----PTXXALFXTXP 853 P PPP P PP P P P P PPP P+ A + P Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP 152 Query: 854 -PXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P + PP PP P P PP P PP +PPP P Sbjct: 153 NPPYPPPLYPP--PPNPPPPNAPYPP---PPYPPPPNPP 186 Score = 48.8 bits (111), Expect = 7e-06 Identities = 30/92 (32%), Positives = 31/92 (33%), Gaps = 1/92 (1%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPX 874 PP P PP P P P P PPPP PP PP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYP------PPPNPPYPPPPNAPYPPPPNPPYPPPPN 137 Query: 875 GP-PXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P P P P PP P PP +PPP P Sbjct: 138 APYPPSPNAPYPP-PPNPPYPPPLYPPPPNPP 168 Score = 48.4 bits (110), Expect = 9e-06 Identities = 28/94 (29%), Positives = 31/94 (32%), Gaps = 1/94 (1%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXP-PXFT 865 P PP P PP P P P P PP A + P + Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYP 149 Query: 866 PPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PP PP P PP P PP +PPP P Sbjct: 150 PPPNPPYPPPLYPPPPNPPPPNA--PYPPPPYPP 181 Score = 47.6 bits (108), Expect = 2e-05 Identities = 30/90 (33%), Positives = 31/90 (34%), Gaps = 1/90 (1%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP P P P P P P PPPP PP P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP-----NPPPPNP 209 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQ-XFPPP 955 P PP P P PP P PP +PPP Sbjct: 210 PYPPP--PNAPNPPYPP-PPNAPNPPYPPP 236 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/94 (29%), Positives = 31/94 (32%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P P P PP P P P P + PPPP PP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPN--APYPPPPYPPPPNPPYPPPPNPPYPPP 198 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 P P P P PP P P +PPP P+ Sbjct: 199 PNAP--NPPPPNPPYPPPPNAPNPPYPPPPNAPN 230 Score = 46.0 bits (104), Expect = 5e-05 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 4/96 (4%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P PP P P PP PPPP P P PP P Sbjct: 139 PYPPSPNAPYPP-----PPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP 193 Query: 870 PXXP----PXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 P P P P P PPP + PP P Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P PP P P PP PPP P P PP P Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPP-YPP 181 Query: 870 PXXPPXXPXXXXPXXPPP 923 P PP P P PPP Sbjct: 182 PPNPPYPPPPNPPYPPPP 199 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/96 (30%), Positives = 30/96 (31%), Gaps = 4/96 (4%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXX--GXXPPPP-PXLXPFXQPXPPX 860 P P P PP P P PP PPPP P P P PP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN 166 Query: 861 LXPPXXP-PXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PP P P P P P P + PP P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAP 202 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/93 (30%), Positives = 28/93 (30%), Gaps = 1/93 (1%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQ-PXPPXLX 866 P P P P P P PP PPP P P P PP Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 867 PPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PP PP P P PPP PP P Sbjct: 209 PPYPPP--PNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 43.2 bits (97), Expect = 3e-04 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 3/95 (3%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLX- 866 P P P PP P P P P PPP P P PP Sbjct: 115 PYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPY 174 Query: 867 --PPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PP PP P P PP +PP P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNP 209 Score = 39.9 bits (89), Expect = 0.003 Identities = 24/89 (26%), Positives = 25/89 (28%) Frame = +3 Query: 699 PXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXX 878 P + P PP P P PP P PP P P P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP 144 Query: 879 PPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 P P PPP PP P Sbjct: 145 NAPYPPPPNPPYPPPLYPPPPNPPPPNAP 173 Score = 35.9 bits (79), Expect = 0.049 Identities = 24/89 (26%), Positives = 25/89 (28%), Gaps = 3/89 (3%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P PP P PP P PPP P P P P Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPP 213 Query: 870 PXX---PPXXPXXXXPXXPPPXRXQXXFS 947 P PP P P P P F+ Sbjct: 214 PPNAPNPPYPPPPNAPNPPYPPPPNPQFA 242 Score = 28.7 bits (61), Expect = 7.5 Identities = 14/50 (28%), Positives = 16/50 (32%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXAL 838 P PPP P PP P P P + PPP A+ Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNPQFAI 243 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 56.8 bits (131), Expect = 2e-08 Identities = 31/51 (60%), Positives = 31/51 (60%) Frame = +1 Query: 322 GXGGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 G GGLRIG VVR AVS HS AVIRLSTESGD AGKNM Sbjct: 51 GPGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 101 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 56.4 bits (130), Expect = 3e-08 Identities = 31/55 (56%), Positives = 32/55 (58%) Frame = +1 Query: 310 GQRAGXGGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 G G GGLRIG VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 30 GTYTGGGGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 84 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 55.2 bits (127), Expect = 8e-08 Identities = 35/61 (57%), Positives = 35/61 (57%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM*AKGQQKARXR 507 GGLRIG VVR AVS HS AVIRLSTESGD AGKNM G KA R Sbjct: 7 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNMRLYG--KAIIR 64 Query: 508 K 510 K Sbjct: 65 K 65 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 54.8 bits (126), Expect = 1e-07 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKNM Sbjct: 575 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 623 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 54.8 bits (126), Expect = 1e-07 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKNM Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 50 >SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 54.8 bits (126), Expect = 1e-07 Identities = 30/49 (61%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKNM Sbjct: 140 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM 188 >SB_21539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 53.6 bits (123), Expect = 2e-07 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM*AK 483 GGLRIG VVR AVS HS AVIRLSTESGD AGKN+ A+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNIDAE 53 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 448 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 496 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 309 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 357 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 53.2 bits (122), Expect = 3e-07 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 263 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 311 >SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) Length = 302 Score = 52.8 bits (121), Expect = 4e-07 Identities = 29/48 (60%), Positives = 29/48 (60%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKN 471 GGLRIG VVR AVS HS AVIRLSTESGD AGKN Sbjct: 254 GGLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 301 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 52.4 bits (120), Expect = 5e-07 Identities = 27/80 (33%), Positives = 29/80 (36%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXP 893 P PP P P PP PPPPP P P PP PP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP---PPPPPPPPPPPPPAPP 421 Query: 894 XXXXPXXPPPXRXQXXFSPP 953 P PPP + +PP Sbjct: 422 PPPPPPPPPPPALRLACAPP 441 Score = 51.2 bits (117), Expect = 1e-06 Identities = 30/89 (33%), Positives = 30/89 (33%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP P PP P P P P PPPP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP---------PP---P 412 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P PP P P PP P PP PP Sbjct: 413 PPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 PP PPPPP P P PP PP PP P P PPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 954 XAXP 965 P Sbjct: 426 PPPP 429 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 PP PPPPP P P PP PP PP P P PPP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 954 XAXP 965 P Sbjct: 429 PPPP 432 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PPPP PP PP PP P P PP P PP PPP P+ Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP PP PP PP P P PP P PP PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 +PPPP PP PP PP P P PP P PP PPP P Sbjct: 377 SPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 46.0 bits (104), Expect = 5e-05 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P PP P P PP PPPPP P P PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPP---P 424 Query: 870 PXXPPXXPXXXXPXXPPPXR 929 P PP P PP R Sbjct: 425 PPPPPPPPALRLACAPPRLR 444 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = +3 Query: 699 PXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXX 878 P P PP P P PP PPPPP P P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 879 PPXXP 893 PP P Sbjct: 425 PPPPP 429 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP + PP PP P P P PP P PP PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP + PP P PP P P PP P PP PPP P Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/52 (40%), Positives = 22/52 (42%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP+ PP PP PP P P PP P PP PPP P Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP--PPPAPPP 422 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP PP P PP P P PP P PP PPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAP 420 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +2 Query: 851 PPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PP PP PP P P PP P PP Q PPP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/63 (36%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP-PXXPPXXPXXXXPXXPPPXRXQXXFSP 950 PP PPPPP P QP PP P P PP P P PP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 951 PXA 959 P A Sbjct: 431 PPA 433 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 +PPPP PP PP P P PP P PP PPP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 32.3 bits (70), Expect = 0.61 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPP 871 PPP P PP P P P P PPPP FT P Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPPRLRFTSP 448 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 3/54 (5%) Frame = +3 Query: 813 PPPPXLXPFXQPXPPXLXP---PXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPP P PP P P PP P P PPP PP P Sbjct: 365 PPPP-------PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 28.3 bits (60), Expect = 9.9 Identities = 12/35 (34%), Positives = 13/35 (37%) Frame = +3 Query: 861 LXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 + PP PP P P PPP PP P Sbjct: 363 MSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPP 397 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/49 (57%), Positives = 29/49 (59%) Frame = +1 Query: 328 GGLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GGLRIG VVR A S HS AVIRLSTESGD AGKN+ Sbjct: 2 GGLRIGRSSASSLTDSLRSVVRLRRAESAHSKAVIRLSTESGDNAGKNI 50 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 50.8 bits (116), Expect = 2e-06 Identities = 28/48 (58%), Positives = 29/48 (60%) Frame = +1 Query: 331 GLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 GLRIG VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 210 GLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNI 257 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/39 (66%), Positives = 27/39 (69%) Frame = +1 Query: 514 GPXAWRFSIGLXPP*TSXXKIDAQVRGGETRPDYKDTRR 630 GP RFSIG P TS K DAQ+ GGETR DYKDTRR Sbjct: 145 GPRQSRFSIGSAPL-TSITKSDAQISGGETRQDYKDTRR 182 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_4052| Best HMM Match : EGF (HMM E-Value=7.2e-05) Length = 117 Score = 50.4 bits (115), Expect = 2e-06 Identities = 28/47 (59%), Positives = 28/47 (59%) Frame = +1 Query: 331 GLRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKN 471 GLRIG VVR AVS HS AVIRLSTESGD AGKN Sbjct: 70 GLRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 116 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 553 P*TSXXKIDAQVRGGETRPDYKDTRRFPL 639 P TS K DAQ+ GGETR DYKDTRRFPL Sbjct: 119 PLTSITKSDAQISGGETRQDYKDTRRFPL 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_45385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/46 (56%), Positives = 27/46 (58%) Frame = +1 Query: 334 LRIGXXXXXXXXXXXXXVVRXXXAVSXHSXAVIRLSTESGDXAGKN 471 +RIG VVR AVS HS AVIRLSTESGD AGKN Sbjct: 1 MRIGRSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKN 46 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 47.2 bits (107), Expect = 2e-05 Identities = 32/95 (33%), Positives = 33/95 (34%), Gaps = 6/95 (6%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXP--PXF 862 P PPPT P P P P P + G PPPP A P P Sbjct: 126 PPPPPTS-PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLA 184 Query: 863 T----PPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP G P P P PP P PP PPP Sbjct: 185 AASPPPPSGGPPPPPPP-PPPPPPPPILELAAPPP 218 Score = 44.8 bits (101), Expect = 1e-04 Identities = 27/94 (28%), Positives = 29/94 (30%), Gaps = 3/94 (3%) Frame = +2 Query: 695 PPPTXXPXPPXX---PXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFT 865 PPP P P P P P P + G PPPP A PP Sbjct: 111 PPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPI 170 Query: 866 PPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P P P +P PP PPP P Sbjct: 171 APAATVPAPAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 37.1 bits (82), Expect = 0.021 Identities = 28/97 (28%), Positives = 29/97 (29%), Gaps = 4/97 (4%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P + P PP P P P P S PPPP A PP Sbjct: 100 PMVAQSVAPTPPPPPRA-PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIA 158 Query: 869 P--XGPPXXPXXPXPPXTPXP--PXTXQXFPPPXXXP 967 P GPP P P P P PPP P Sbjct: 159 PATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGP 195 Score = 36.7 bits (81), Expect = 0.028 Identities = 28/95 (29%), Positives = 28/95 (29%), Gaps = 7/95 (7%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPX--- 860 P P P PP P P PP G PPPPP P P Sbjct: 130 PTSPATRAPPPP-----PPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLA 184 Query: 861 -LXPPXX---PPXXPXXXXPXXPPPXRXQXXFSPP 953 PP PP P P PPP PP Sbjct: 185 AASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 35.5 bits (78), Expect = 0.065 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 P P ++ T PP PP P P PP P P T PPP P+ Sbjct: 98 PTPMVAQSVAPTPPP---PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPA 147 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/55 (36%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTP-XPPXTXQXFPPPXXXPS 970 +PPPP T P PP PP P PP P P T PPP P+ Sbjct: 125 SPPPPP------TSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPA 173 Score = 32.3 bits (70), Expect = 0.61 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PPPP + P PP P P PP P P T PPP P+ Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPP--PIAPATGGPPPPPPIAPA 160 Score = 31.5 bits (68), Expect = 1.1 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFX--QPXPPXLXPPXXPPX 887 P PP P P PP G PPPPP P PP + P P Sbjct: 124 PSPP----PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPP-IAPAATVPA 178 Query: 888 XPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPP PP P Sbjct: 179 PAVPLAAASPPPPSGGPPPPPPPPPP 204 Score = 28.3 bits (60), Expect = 9.9 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 854 PXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 P TP P P PP P P PPP P+ Sbjct: 96 PTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPA 134 >SB_21487| Best HMM Match : MAM (HMM E-Value=0) Length = 874 Score = 46.0 bits (104), Expect = 5e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 385 VVRXXXAVSXHSXAVIRLSTESGDXAGKNM 474 VVR AVS HS AVIRLSTESGD AGKN+ Sbjct: 80 VVRLRRAVSAHSKAVIRLSTESGDNAGKNI 109 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 45.2 bits (102), Expect = 8e-05 Identities = 24/63 (38%), Positives = 25/63 (39%), Gaps = 2/63 (3%) Frame = +2 Query: 788 SXXXGXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXT--PXPPXTXQXFPPPXX 961 S G PPPPT P TPP PP P PP T P PP PPP Sbjct: 339 SGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Query: 962 XPS 970 P+ Sbjct: 399 PPT 401 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/80 (33%), Positives = 27/80 (33%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPPT P P P P G PPPPT PP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNG-----PPPPPPP 400 Query: 869 PXGPPXXPXXPXPPXTPXPP 928 GPP P PP T PP Sbjct: 401 TNGPP-----PPPPPTNGPP 415 Score = 41.9 bits (94), Expect = 8e-04 Identities = 24/71 (33%), Positives = 24/71 (33%) Frame = +3 Query: 753 PXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRX 932 P PP PPPPP P P PP PP PP P P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKP-PPPPPPTNGPPPPPP--PTNGPPPPPPPTNG 403 Query: 933 QXXFSPPXAXP 965 PP P Sbjct: 404 PPPPPPPTNGP 414 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P + P PP P P PP G PPPPP P P PP P Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTN-GPPPPPPPTNGP-PPPPPPTNGP 404 Query: 870 PXXPP 884 P PP Sbjct: 405 PPPPP 409 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/56 (35%), Positives = 22/56 (39%), Gaps = 2/56 (3%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXX--PXXPXPPXTPXPPXTXQXFPPPXXXPS 970 +PPPPT P PP PP P P P P PP PPP P+ Sbjct: 356 SPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPT 411 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 44.0 bits (99), Expect = 2e-04 Identities = 28/90 (31%), Positives = 28/90 (31%), Gaps = 1/90 (1%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PP P PP P P P S PP P L P F P Sbjct: 204 PTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMP-ETPLPPATPNPFIP 262 Query: 869 PXGP-PXXPXXPXPPXTPXPPXTXQXFPPP 955 P P P P P P P PP PP Sbjct: 263 PASPNPSIPPAPPNPSIPAPPNPSIPLAPP 292 Score = 42.3 bits (95), Expect = 6e-04 Identities = 27/91 (29%), Positives = 29/91 (31%), Gaps = 2/91 (2%) Frame = +2 Query: 689 PXPPPTXXPXPPXX--PXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXF 862 P PP P PP P P P S PP P + T PP Sbjct: 272 PAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYI-PTAPPNP 330 Query: 863 TPPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 + P PP P PP PP F PP Sbjct: 331 SIPPAPPNPSIPPAPPNPSIPPAPPNLFIPP 361 Score = 36.3 bits (80), Expect = 0.037 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGP-PXXPXXPXPPXTPXPPXTXQXFPPP 955 PP P + T P PP P P P P P TP PP + P P Sbjct: 176 PPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAP 224 Score = 34.7 bits (76), Expect = 0.11 Identities = 28/100 (28%), Positives = 29/100 (29%), Gaps = 6/100 (6%) Frame = +2 Query: 689 PXPPPTXXPX-PPXXPXXX----PXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXP 853 P PP T P PP P P P P PP P + P Sbjct: 251 PLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPP 310 Query: 854 PXFTPPXGP-PXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PP P P P P P P P PP PS Sbjct: 311 NPHIPPAPPNPYIPTAPPNPSIPPAPPNPS-IPPAPPNPS 349 Score = 32.7 bits (71), Expect = 0.46 Identities = 23/88 (26%), Positives = 24/88 (27%), Gaps = 2/88 (2%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXA--LFXTXPPXF 862 P PP P P P P P P PT PP Sbjct: 280 PAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNP 339 Query: 863 TPPXGPPXXPXXPXPPXTPXPPXTXQXF 946 + P PP P PP PP T F Sbjct: 340 SIPPAPPNPSIPPAPPNLFIPPATPNAF 367 Score = 32.3 bits (70), Expect = 0.61 Identities = 24/90 (26%), Positives = 25/90 (27%) Frame = +2 Query: 698 PPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXG 877 P T P PP P P P P + P P PP P Sbjct: 172 PETKPPKPPA-PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGS-PHIPPAPLHPHI 229 Query: 878 PPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PP P TP PP PP P Sbjct: 230 PPAPPNPSKAIATPNPPMPETPLPPATPNP 259 Score = 30.7 bits (66), Expect = 1.9 Identities = 22/90 (24%), Positives = 25/90 (27%), Gaps = 3/90 (3%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXX-GXXAPPPPTXXALFXTXPPXFTP- 868 P P+ P PP P P P P P + P + P Sbjct: 266 PNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPT 325 Query: 869 -PXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P P P P P P PP PP Sbjct: 326 APPNPSIPPAPPNPSIPPAPPNPSIPPAPP 355 Score = 28.3 bits (60), Expect = 9.9 Identities = 24/88 (27%), Positives = 24/88 (27%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P P P P P PP G PP L P P PP Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPP-------GSPHIPPAPLHPHIPPAPPN--- 235 Query: 870 PXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 P P P P P F PP Sbjct: 236 PSKAIATPNPPMPETPLPPATPNPFIPP 263 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 44.0 bits (99), Expect = 2e-04 Identities = 32/98 (32%), Positives = 32/98 (32%), Gaps = 3/98 (3%) Frame = -2 Query: 966 GXXXGGGKXWXVXGGXGVXGGXGXXGXXGGPXGG---VKXGGXVXKRAXXVGGGGAXXPX 796 G GGG GG GG G G GG GG GG A VGGG Sbjct: 265 GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG---GATGVGGGATGGGG 321 Query: 795 XXEXXXXXGXXXXXGXXGXXXGXXGGXGXCVGGGXGXG 682 G G G GG G GGG G G Sbjct: 322 GATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPG 359 Score = 37.9 bits (84), Expect = 0.012 Identities = 32/94 (34%), Positives = 32/94 (34%), Gaps = 1/94 (1%) Frame = -2 Query: 966 GXXXGGGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXE 787 G GG GG G GG G G GG GG GG GGGGA Sbjct: 243 GGGATGGGGGATGGGGGATGGGG--GATGG-GGGATGGGG----GATGGGGGATGGGGGA 295 Query: 786 XXXXXG-XXXXXGXXGXXXGXXGGXGXCVGGGXG 688 G G G G GG G GGG G Sbjct: 296 TGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Score = 37.5 bits (83), Expect = 0.016 Identities = 32/97 (32%), Positives = 32/97 (32%), Gaps = 4/97 (4%) Frame = -2 Query: 966 GXXXGGGKXWXVXGGXGVX--GGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXX 793 G GGG GG G GG G G GG GG GG GGGG Sbjct: 252 GATGGGG---GATGGGGGATGGGGGATGGGGGATGG--GGGATGGGGGATGGGGGATGGG 306 Query: 792 XEXXXXXG--XXXXXGXXGXXXGXXGGXGXCVGGGXG 688 G G G G GG G GGG G Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -1 Query: 928 RXGGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGX 749 R GGG G GG G GG G GGGG GG G Sbjct: 240 RLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 299 Query: 748 XGXXXXXXGGXG 713 G G G Sbjct: 300 GGATGGGGGATG 311 Score = 33.1 bits (72), Expect = 0.35 Identities = 28/80 (35%), Positives = 28/80 (35%) Frame = -2 Query: 927 GGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXEXXXXXGXXXXXGX 748 GG G GG G G GG GG GG GGGG G G Sbjct: 242 GGGGATGGGG--GATGG-GGGATGGG-----GGATGGGGGATGGGGGATGGGG-----GA 288 Query: 747 XGXXXGXXGGXGXCVGGGXG 688 G G GG G GGG G Sbjct: 289 TGGGGGATGGGGGATGGGGG 308 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G GG G GG G GGGG GG G G Sbjct: 249 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGG 308 Query: 742 XXXXXXGGXG 713 G G Sbjct: 309 ATGVGGGATG 318 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G GG G GG G GGGG GG G G Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Query: 742 XXXXXXGGXG 713 G G Sbjct: 330 ATGGGGGATG 339 Score = 31.9 bits (69), Expect = 0.80 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G GG G GG G GGGG GG G G Sbjct: 284 GGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGG 343 Query: 742 XXXXXXGGXG 713 G G Sbjct: 344 VTGGGGGATG 353 Score = 31.5 bits (68), Expect = 1.1 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 2/80 (2%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXK--KGXXCGGGGGXXPXXXXXXXGGXXXXXXGX 749 GGG G G GG GG G G GGGGG GG G Sbjct: 283 GGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG-----GGA 337 Query: 748 XGXXXXXXGGXGXXCXGXXG 689 G GG G G G Sbjct: 338 TGGGGGVTGGGGGATGGGGG 357 Score = 29.9 bits (64), Expect = 3.2 Identities = 27/90 (30%), Positives = 27/90 (30%) Frame = -2 Query: 951 GGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXEXXXXX 772 GG G GG G G GG GG GG GGGG Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGG--GGGATGGGGGATGGGGGAT---------G 276 Query: 771 GXXXXXGXXGXXXGXXGGXGXCVGGGXGXG 682 G G G G GG GG G G Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGG 306 Score = 28.7 bits (61), Expect = 7.5 Identities = 21/74 (28%), Positives = 21/74 (28%) Frame = -1 Query: 964 GXAXGGEXLXCXRXGGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXX 785 G A GG GG G GG G G G G GGGG Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVT 345 Query: 784 XXGGXXXXXXGXXG 743 GG G G Sbjct: 346 GGGGGATGGGGGPG 359 Score = 28.7 bits (61), Expect = 7.5 Identities = 21/78 (26%), Positives = 21/78 (26%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G G GG G G G GGG G G G Sbjct: 290 GGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGG 349 Query: 742 XXXXXXGGXGXXCXGXXG 689 GG G G G Sbjct: 350 GATGGGGGPGSGGCGEDG 367 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 43.6 bits (98), Expect = 2e-04 Identities = 31/91 (34%), Positives = 32/91 (35%) Frame = -2 Query: 954 GGGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXEXXXX 775 GGG GG G GG G G GG GG GG GGGG + Sbjct: 771 GGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG--- 827 Query: 774 XGXXXXXGXXGXXXGXXGGXGXCVGGGXGXG 682 G G G G G G GGG G G Sbjct: 828 -GGYGDGGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/93 (31%), Positives = 29/93 (31%) Frame = -2 Query: 966 GXXXGGGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXE 787 G GGG GG G G G G G GG GG G GG Sbjct: 783 GDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGY 842 Query: 786 XXXXXGXXXXXGXXGXXXGXXGGXGXCVGGGXG 688 G G G G GG G GGG G Sbjct: 843 ADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 875 Score = 40.7 bits (91), Expect = 0.002 Identities = 27/88 (30%), Positives = 28/88 (31%) Frame = -1 Query: 952 GGEXLXCXRXGGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGG 773 GG+ GGG G G GG G GG G G G GGG GG Sbjct: 782 GGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGG 841 Query: 772 XXXXXXGXXGXXXXXXGGXGXXCXGXXG 689 G G GG G G G Sbjct: 842 YADGDGGGGGGGGGGGGGGGGGGGGGGG 869 Score = 39.5 bits (88), Expect = 0.004 Identities = 25/78 (32%), Positives = 25/78 (32%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G G GG GG G G G GGGGG G G G Sbjct: 781 GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGG 840 Query: 742 XXXXXXGGXGXXCXGXXG 689 GG G G G Sbjct: 841 GYADGDGGGGGGGGGGGG 858 Score = 39.1 bits (87), Expect = 0.005 Identities = 28/89 (31%), Positives = 28/89 (31%) Frame = -2 Query: 954 GGGKXWXVXGGXGVXGGXGXXGXXGGPXGGVKXGGXVXKRAXXVGGGGAXXPXXXEXXXX 775 GGG GG G G G GG GG GG GGG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Query: 774 XGXXXXXGXXGXXXGXXGGXGXCVGGGXG 688 G G G G GG G GGG G Sbjct: 848 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 876 Score = 37.9 bits (84), Expect = 0.012 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -1 Query: 922 GGGXXGXXXXGXXGGXXGGXKXGGXGXKKGXXCGGGGGXXPXXXXXXXGGXXXXXXGXXG 743 GGG G G GG GG GG G G GG GG GG G G Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGG-GGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 742 XXXXXXGGXG 713 GG G Sbjct: 828 GGYGDGGGFG 837 Score = 30.3 bits (65), Expect = 2.5 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 954 GGGKXWXVXGGXGVXGGXGXXGXXGGPXGGV 862 GGG GG G GG G G GG GGV Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGV 877 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/75 (33%), Positives = 27/75 (36%), Gaps = 2/75 (2%) Frame = +3 Query: 705 HXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPP--XX 878 H P PP P PP G PPPPP + P P PP + PP Sbjct: 1219 HSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGL-PPPPPGMRPM-PPQPPFMPPPPRMQ 1276 Query: 879 PPXXPXXXXPXXPPP 923 PP P P P P Sbjct: 1277 PPGPPGPPGPPGPQP 1291 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 2/77 (2%) Frame = +2 Query: 743 PXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPP--XT 916 P P P + PPP + PP PP GPP P PP Sbjct: 1201 PNRPPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMR 1260 Query: 917 PXPPXTXQXFPPPXXXP 967 P PP PPP P Sbjct: 1261 PMPPQPPFMPPPPRMQP 1277 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFT--PPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP A+ PP F PP P P P PP P PP PP P Sbjct: 1235 PPPPP--AMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP + P P L PP P PPP R Q P P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXP 925 PPPP PP F PP P P PP P P Sbjct: 1253 PPPPPGMRPMPPQPP-FMPPPPRMQPPGPPGPPGPPGP 1289 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 43.6 bits (98), Expect = 2e-04 Identities = 23/51 (45%), Positives = 23/51 (45%) Frame = +2 Query: 800 GXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPP 952 G PPPPT T PP PP PP P P PP TP PP PP Sbjct: 119 GYVPPPPPTG-----TLPP---PPVTPPPGPETPPPPDTPAPPVPPTEAPP 161 Score = 39.5 bits (88), Expect = 0.004 Identities = 21/52 (40%), Positives = 21/52 (40%) Frame = +2 Query: 800 GXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 G PPPP L PP TPP GP P P P P PP PP Sbjct: 118 GGYVPPPPPTGTL---PPPPVTPPPGPETPPP-PDTPAPPVPPTEAPPTAPP 165 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +2 Query: 689 PXPPPTXX-PXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPP 817 P PPPT P PP P P P P APP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/91 (28%), Positives = 29/91 (31%), Gaps = 2/91 (2%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP+ PP P P APPPP+ P Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPP 364 Query: 869 PXGPPXX--PXXPXPPXTPXPPXTXQXFPPP 955 P PP P P PP PP + PPP Sbjct: 365 PPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Score = 37.5 bits (83), Expect = 0.016 Identities = 27/94 (28%), Positives = 30/94 (31%), Gaps = 5/94 (5%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP+ PP P P + G PPPP + PP Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARM-GTAPPPPPPSRSSQRPPPPSRGA 345 Query: 869 PXGPPXXPXXPXP-----PXTPXPPXTXQXFPPP 955 P PP P P P P PP PPP Sbjct: 346 PP-PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP 378 Score = 35.9 bits (79), Expect = 0.049 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 2/74 (2%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXX--GXXPPPPPXLXPFXQPXPPXLXPPXXPPX 887 P PP P P PP G PPPP P P PP P P Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPP-PPIEGRPP 386 Query: 888 XPXXXXPXXPPPXR 929 P PPP R Sbjct: 387 SSLGNPPPPPPPGR 400 Score = 34.3 bits (75), Expect = 0.15 Identities = 22/92 (23%), Positives = 22/92 (23%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXP 869 P P PP P P PP PPPP P P Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPP 347 Query: 870 PXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 P P PPP PP P Sbjct: 348 PPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 3/83 (3%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP+ P P P P G APPPP + PP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPP-----PSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPI 381 Query: 869 PXGPPXX---PXXPXPPXTPXPP 928 PP P P PP PP Sbjct: 382 EGRPPSSLGNPPPPPPPGRGAPP 404 Score = 33.1 bits (72), Expect = 0.35 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 4/72 (5%) Frame = +3 Query: 690 PXXPXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPP--XLXPFXQPXPPXL 863 P P P PP P P PP G PPPPP P PP Sbjct: 338 PPPPSRGAPPPPSMGMAPP--PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Query: 864 XPP--XXPPXXP 893 PP PP P Sbjct: 396 PPPGRGAPPPGP 407 Score = 29.5 bits (63), Expect = 4.3 Identities = 20/57 (35%), Positives = 21/57 (36%) Frame = +2 Query: 800 GXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 G PPPP+ A PP P G P P P P PP PP PS Sbjct: 284 GIQPPPPPSRGA---APPP---PSRGAPPPP--PSRGSAPPPPPARMGTAPPPPPPS 332 >SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/31 (64%), Positives = 22/31 (70%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLTXR 424 +C G +PLPRSLTR ARSF GER LT R Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLTNR 104 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 42.7 bits (96), Expect = 4e-04 Identities = 31/98 (31%), Positives = 32/98 (32%), Gaps = 4/98 (4%) Frame = +2 Query: 689 PXPPP----TXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPP 856 P PPP P PP P P P PPPPT AL P Sbjct: 906 PAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTS-ALPPPIPA 964 Query: 857 XFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXPS 970 PP PP P P PP P T PP P+ Sbjct: 965 TQVPP--PPLPPLPPPPP--PVQTTTAPTLPPASCMPT 998 Score = 31.5 bits (68), Expect = 1.1 Identities = 29/94 (30%), Positives = 29/94 (30%), Gaps = 5/94 (5%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXX-PXXXXXSXXXGXXAPPPPTXXALFXTXPPXFT 865 P P T P P P P P P P PT A T P Sbjct: 895 PTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQA--STTRPTPP 952 Query: 866 PPXG--PPXXPXX--PXPPXTPXPPXTXQXFPPP 955 PP PP P P PP P PP PPP Sbjct: 953 PPTSALPPPIPATQVPPPPLPPLPPP-----PPP 981 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +2 Query: 845 TXPPXFTPPXGPPXXPXXPXP-PXTPXPPXTXQXFPPP 955 T P TP P P P P P P PP PPP Sbjct: 891 TTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPPPPP 928 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 PP P PPP L +P PP L PP P P P +PP Sbjct: 894 PPTTPTTPKPTTPAPPPPLPLAPEPPPP-LPPPPPPIQTTRPTVPTTPTTQASTTRPTPP 952 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/53 (39%), Positives = 21/53 (39%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 APPPP A PP PP PP P P PP P P PP P Sbjct: 64 APPPPA--AAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPPHFLP 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 1/54 (1%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXP-XPPXTPXPPXTXQXFPPPXXXPS 970 PPPP+ A PP PP P P P PP P PP PPP P+ Sbjct: 52 PPPPSPPAAAPAAPP---PPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPA 102 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 744 PXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPP 920 P P P PPPP P P PP L P PP P P PP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 PP PPPP P P PP P PP P P P Q +PP Sbjct: 52 PPPPSPPAAAPAAPPPPAAAP-AAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Query: 954 XAXP 965 P Sbjct: 111 HFLP 114 Score = 37.1 bits (82), Expect = 0.021 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +3 Query: 810 PPPPPXLXPFXQP--XPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP P P PP P PP P P PPP PP A P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPP--PPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 35.1 bits (77), Expect = 0.086 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 699 PXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXX 878 P P PP P P PP PPPP P PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP-----LPAPPPPPAQPAPQ 104 Query: 879 PPXXPXXXXP 908 PP P P Sbjct: 105 PPPAPPHFLP 114 Score = 29.5 bits (63), Expect = 4.3 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 845 TXPPXFTPPXGPPXXPXXPXP-PXTPXPPXTXQXFPPPXXXP 967 T P F PP P P P P PP PPP P Sbjct: 40 TYYPHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAP 81 Score = 29.1 bits (62), Expect = 5.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +2 Query: 839 FXTXPPXFTPPXGPPXXPXXPXP----PXTPXPPXTXQXFPPP 955 F + P PP P P P P P P PP PPP Sbjct: 45 FISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPP 87 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PPPP L T P PP PP P PP +P P PPP P Sbjct: 697 PPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 PP P + PP PP P P PP P PP PPP P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 35.9 bits (79), Expect = 0.049 Identities = 26/87 (29%), Positives = 26/87 (29%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPX 874 PPP P P P P S PPPP PP PP Sbjct: 678 PPPPPLPVIEGSSLSVPPPPPPPPPPLL---SGTLPMPPPPPPPPPGCAGLPPP---PPS 731 Query: 875 GPPXXPXXPXPPXTPXPPXTXQXFPPP 955 P P PP P PP PPP Sbjct: 732 PQPGCAGLPPPP--PPPPPGCAGLPPP 756 Score = 34.7 bits (76), Expect = 0.11 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +3 Query: 699 PXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXX 878 P P PPL P P PP PPPPP QP L PP Sbjct: 695 PPPPPPPPPLLSGTLPMPP------PPPPPPPGCAGLPPPPPS----PQPGCAGLPPP-- 742 Query: 879 PPXXPXXXXPXXPPPXRXQXXFSP 950 PP P PPP P Sbjct: 743 PPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP P P PP PP P P P PP P Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPP 746 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 8/83 (9%) Frame = +3 Query: 699 PXHXXPXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPP------- 857 P P P + P PP PPPPP P PP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 858 -XLXPPXXPPXXPXXXXPXXPPP 923 L PP PP P PPP Sbjct: 737 AGLPPPPPPPPPGCAGLPPPPPP 759 Score = 32.3 bits (70), Expect = 0.61 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPP 953 PP G P PPP P P L PP P P PPP PP Sbjct: 698 PPPPPPLLSGTLPMPPPPPPP--PPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPP 755 Query: 954 XAXP 965 P Sbjct: 756 PPPP 759 Score = 31.5 bits (68), Expect = 1.1 Identities = 19/57 (33%), Positives = 21/57 (36%), Gaps = 5/57 (8%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXP-----XXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP L P + + PP PP P P PPP PP P Sbjct: 677 PPPPPPL-PVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 Score = 31.5 bits (68), Expect = 1.1 Identities = 16/52 (30%), Positives = 18/52 (34%) Frame = +3 Query: 810 PPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPPXRXQXXFSPPXAXP 965 PPPPP P + PP PP P PP + PP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPP 745 Score = 30.3 bits (65), Expect = 2.5 Identities = 22/80 (27%), Positives = 22/80 (27%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTP 868 P PPP P P P P P PPP PP P Sbjct: 699 PPPPPLLSGTLPMPPPPPPPPPGCAGLP------------PPPPSPQPGCAGLPPPPPPP 746 Query: 869 PXGPPXXPXXPXPPXTPXPP 928 P G P P P P P Sbjct: 747 PPGCAGLPPPPPPIDVPMKP 766 Score = 28.7 bits (61), Expect = 7.5 Identities = 21/72 (29%), Positives = 21/72 (29%), Gaps = 4/72 (5%) Frame = +2 Query: 689 PXPPPT----XXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPP 856 P PPP P PP P P P G PPPP PP Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPG-CAGLPPPPPPPPPGCAGLPPP 756 Query: 857 XFTPPXGPPXXP 892 PP P P Sbjct: 757 --PPPIDVPMKP 766 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 172 ICDTGYIPLPRSLTRYARSFDCGERKWLT 200 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 296 ICDTGYIPLPRSLTRYARSFDCGERKWLT 324 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 146 ICDTGYIPLPRSLTRYARSFDCGERKWLT 174 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 103 ICDTGYIPLPRSLTRYARSFDCGERKWLT 131 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 251 ICDTGYIPLPRSLTRYARSFDCGERKWLT 279 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 393 ICDTGYIPLPRSLTRYARSFDCGERKWLT 421 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 341 AALMNRPTRGERRFAYW 357 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 8/47 (17%) Frame = +2 Query: 812 PPPPTXXAL------FXTXPPXF--TPPXGPPXXPXXPXPPXTPXPP 928 PPPPT A + PP TPP PP P P P P P Sbjct: 780 PPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 29.1 bits (62), Expect = 5.7 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +2 Query: 800 GXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPP 952 G PPPP PP P P P P PP T PP Sbjct: 775 GAPPPPPPPTKPATPRVPPNI-PSRPPGARPTPPPPPPGKPTKPTKPSLPP 824 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +2 Query: 866 PPXGPPXXPXXPX-PPXTPXPPXTXQXFPPP 955 PP PP P P PP P P + PPP Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARPTPPP 808 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 248 ICDTGYIPLPRSLTRYARSFDCGERKWLT 276 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 148 ICDTGYIPLPRSLTRYARSFDCGERKWLT 176 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 134 ICDTGYIPLPRSLTRYARSFDCGERKWLT 162 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 611 ICDTGYIPLPRSLTRYARSFDCGERKWLT 639 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 367 ICDTGYIPLPRSLTRYARSFDCGERKWLT 395 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 210 ICDTGYIPLPRSLTRYARSFDCGERKWLT 238 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 168 ICDTGYIPLPRSLTRYARSFDCGERKWLT 196 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 801 GXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPP 923 G PPPPP P PP PP PP P P PPP Sbjct: 461 GQAPPPPP-------PPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = +2 Query: 809 APPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXT 934 APPPP PP PP PP P P PP P PP T Sbjct: 463 APPPP---------PPPPPPPPPPPPPPPPPPPPFPPPPPPT 495 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 Score = 35.5 bits (78), Expect = 0.065 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 866 PPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP PP P P PP P PP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 35.1 bits (77), Expect = 0.086 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 Query: 866 PPXGPPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP PP P P PP P PP FPPP Sbjct: 464 PPPPPPPPPPPPPPP--PPPPPPPPPFPPP 491 Score = 34.3 bits (75), Expect = 0.15 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 869 PXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P PP P P PP P PP PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 818 PPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXPPXTXQXFPPPXXXP 967 P LF T G P P PP P PP PPP P Sbjct: 442 PKHDPRLFSQDEDGDTEGVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 774 PPXXXXXXXGXXPPPPPXLXPFXQPXPP 857 PP PPPPP PF P PP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXP 772 P PPP P PP P P P P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXP 772 P PPP P PP P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPP 492 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXP 772 P PPP P PP P P P P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 28.3 bits (60), Expect = 9.9 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +2 Query: 689 PXPPPTXXPXPPXXPXXXPXXPXXXXXP 772 P PPP P PP P P P P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 94 ICDTGYIPLPRSLTRYARSFDCGERKWLT 122 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 133 ICDTGYIPLPRSLTRYARSFDCGERKWLT 161 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 179 ICDTGYIPLPRSLTRYARSFDCGERKWLT 207 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 137 ICDTGYIPLPRSLTRYARSFDCGERKWLT 165 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 63 ICDTGYIPLPRSLTRYARSFDCGERKWLT 91 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 11 AALMNRPTRGERRFAYW 27 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 600 ICDTGYIPLPRSLTRYARSFDCGERKWLT 628 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/87 (31%), Positives = 27/87 (31%) Frame = +2 Query: 695 PPPTXXPXPPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPX 874 PP P PP P P G APPPP P PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPL 973 Query: 875 GPPXXPXXPXPPXTPXPPXTXQXFPPP 955 PP P PP P PP PPP Sbjct: 974 PPP--PGGSAPPPPPPPPPP----PPP 994 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +3 Query: 714 PXPPLXXXXXPXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXP 893 P PP P P P G PPPPP P PP P PP Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP--PPGGSAPPPGGGAPPLPPPPG 978 Query: 894 XXXXPXXPPP 923 P PPP Sbjct: 979 GSAPPPPPPP 988 Score = 38.3 bits (85), Expect = 0.009 Identities = 24/83 (28%), Positives = 25/83 (30%) Frame = +2 Query: 719 PPXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXX 898 PP P P P PPPP A PP PP G P Sbjct: 914 PPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNA-----PPPPPPPGGSAPPPGG 968 Query: 899 PXPPXTPXPPXTXQXFPPPXXXP 967 PP P P + PPP P Sbjct: 969 GAPPLPPPPGGSAPPPPPPPPPP 991 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/74 (27%), Positives = 20/74 (27%) Frame = +3 Query: 744 PXXPXXXXXXPPXXXXXXXGXXPPPPPXLXPFXQPXPPXLXPPXXPPXXPXXXXPXXPPP 923 P P P G P PP P PP PP P P PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPP---PPGGSAPPPGGGAPPLPPP 976 Query: 924 XRXQXXFSPPXAXP 965 PP P Sbjct: 977 PGGSAPPPPPPPPP 990 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 96 ICDTGYIPLPRSLTRYARSFDCGERKWLT 124 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 117 ICDTGYIPLPRSLTRYARSFDCGERKWLT 145 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 139 ICDTGYIPLPRSLTRYARSFDCGERKWLT 167 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 116 ICDTGYIPLPRSLTRYARSFDCGERKWLT 144 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 99 ICDTGYIPLPRSLTRYARSFDCGERKWLT 127 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 237 ICDTGYIPLPRSLTRYARSFDCGERKWLT 265 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 628 ICDTGYIPLPRSLTRYARSFDCGERKWLT 656 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 350 ICDTGYIPLPRSLTRYARSFDCGERKWLT 378 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 854 ICDTGYIPLPRSLTRYARSFDCGERKWLT 882 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 239 ICDTGYIPLPRSLTRYARSFDCGERKWLT 267 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 138 ICDTGYIPLPRSLTRYARSFDCGERKWLT 166 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 539 ICDTGYIPLPRSLTRYARSFDCGERKWLT 567 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 84 ICDTGYIPLPRSLTRYARSFDCGERKWLT 112 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 984 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1012 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 110 ICDTGYIPLPRSLTRYARSFDCGERKWLT 138 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 489 ICDTGYIPLPRSLTRYARSFDCGERKWLT 517 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 285 ICDTGYIPLPRSLTRYARSFDCGERKWLT 313 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 104 ICDTGYIPLPRSLTRYARSFDCGERKWLT 132 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 22 AALMNRPTRGERRFAYW 38 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 194 ICDTGYIPLPRSLTRYARSFDCGERKWLT 222 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 279 ICDTGYIPLPRSLTRYARSFDCGERKWLT 307 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 105 ICDTGYIPLPRSLTRYARSFDCGERKWLT 133 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 153 ICDTGYIPLPRSLTRYARSFDCGERKWLT 181 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 113 ICDTGYIPLPRSLTRYARSFDCGERKWLT 141 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 155 ICDTGYIPLPRSLTRYARSFDCGERKWLT 183 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 123 ICDTGYIPLPRSLTRYARSFDCGERKWLT 151 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_18781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 125 ICDTGYIPLPRSLTRYARSFDCGERKWLT 153 Score = 28.7 bits (61), Expect = 7.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNR TRG RFA W Sbjct: 73 AALMNRATRGERRFADW 89 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 92 ICDTGYIPLPRSLTRYARSFDCGERKWLT 120 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 132 ICDTGYIPLPRSLTRYARSFDCGERKWLT 160 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 995 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1023 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 943 AALMNRPTRGERRFAYW 959 Score = 28.7 bits (61), Expect = 7.5 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 812 PPPPTXXALFXTXPPXFTPPXGPPXXPXXPXPPXTPXP 925 PPPP P P GP P PP P P Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGP 1702 Score = 28.7 bits (61), Expect = 7.5 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +2 Query: 722 PXXPXXXPXXPXXXXXPXXXXXSXXXGXXAPPPPTXXALFXTXPPXFTPPXGPPXXPXXP 901 P P P P P G A PP PP P GP P P Sbjct: 1790 PQGPKGMPGPPGPPGPPGAIGWKGNPGNPAGPPGLDG------PPGPPGPQGPKGWPGVP 1843 Query: 902 XPPXTP 919 PP P Sbjct: 1844 GPPGPP 1849 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 142 ICDTGYIPLPRSLTRYARSFDCGERKWLT 170 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 475 ICDTGYIPLPRSLTRYARSFDCGERKWLT 503 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 157 ICDTGYIPLPRSLTRYARSFDCGERKWLT 185 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 523 ICDTGYIPLPRSLTRYARSFDCGERKWLT 551 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 521 ICDTGYIPLPRSLTRYARSFDCGERKWLT 549 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 469 AALMNRPTRGERRFAYW 485 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 143 ICDTGYIPLPRSLTRYARSFDCGERKWLT 171 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 101 ICDTGYIPLPRSLTRYARSFDCGERKWLT 129 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 145 ICDTGYIPLPRSLTRYARSFDCGERKWLT 173 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 152 ICDTGYIPLPRSLTRYARSFDCGERKWLT 180 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 291 ICDTGYIPLPRSLTRYARSFDCGERKWLT 319 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 171 ICDTGYIPLPRSLTRYARSFDCGERKWLT 199 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 1206 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1234 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 102 ICDTGYIPLPRSLTRYARSFDCGERKWLT 130 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 122 ICDTGYIPLPRSLTRYARSFDCGERKWLT 150 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 107 ICDTGYIPLPRSLTRYARSFDCGERKWLT 135 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 100 ICDTGYIPLPRSLTRYARSFDCGERKWLT 128 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 130 ICDTGYIPLPRSLTRYARSFDCGERKWLT 158 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 121 ICDTGYIPLPRSLTRYARSFDCGERKWLT 149 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 98 ICDTGYIPLPRSLTRYARSFDCGERKWLT 126 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 1476 ICDTGYIPLPRSLTRYARSFDCGERKWLT 1504 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 629 ICDTGYIPLPRSLTRYARSFDCGERKWLT 657 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 89 ICDTGYIPLPRSLTRYARSFDCGERKWLT 117 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 326 ICDTGYIPLPRSLTRYARSFDCGERKWLT 354 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 174 ICDTGYIPLPRSLTRYARSFDCGERKWLT 202 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 122 AALMNRPTRGERRFAYW 138 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 538 ICDTGYIPLPRSLTRYARSFDCGERKWLT 566 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 91 ICDTGYIPLPRSLTRYARSFDCGERKWLT 119 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 160 ICDTGYIPLPRSLTRYARSFDCGERKWLT 188 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 97 ICDTGYIPLPRSLTRYARSFDCGERKWLT 125 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 144 ICDTGYIPLPRSLTRYARSFDCGERKWLT 172 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 182 ICDTGYIPLPRSLTRYARSFDCGERKWLT 210 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 154 ICDTGYIPLPRSLTRYARSFDCGERKWLT 182 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 119 ICDTGYIPLPRSLTRYARSFDCGERKWLT 147 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 115 ICDTGYIPLPRSLTRYARSFDCGERKWLT 143 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 545 ICDTGYIPLPRSLTRYARSFDCGERKWLT 573 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 440 ICDTGYIPLPRSLTRYARSFDCGERKWLT 468 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 93 ICDTGYIPLPRSLTRYARSFDCGERKWLT 121 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 77 ICDTGYIPLPRSLTRYARSFDCGERKWLT 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/41 (48%), Positives = 24/41 (58%) Frame = +3 Query: 222 INKLTTTIAFILCFRFRGXVWEVFSALMNRPTRGXXRFAYW 344 +++LT L RF V +ALMNRPTRG RFAYW Sbjct: 1 MSELTHINCVALTARFPVGKPVVPAALMNRPTRGERRFAYW 41 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 227 ICDTGYIPLPRSLTRYARSFDCGERKWLT 255 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 112 ICDTGYIPLPRSLTRYARSFDCGERKWLT 140 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_56405| Best HMM Match : Fels1 (HMM E-Value=6.5) Length = 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 74 ICDTGYIPLPRSLTRYARSFDCGERKWLT 102 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 95 ICDTGYIPLPRSLTRYARSFDCGERKWLT 123 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.1 bits (92), Expect = 0.001 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +2 Query: 332 VCVLGALPLPRSLTRCARSFGXGERYXLT 418 +C G +PLPRSLTR ARSF GER LT Sbjct: 60 ICDTGYIPLPRSLTRYARSFDCGERKWLT 88 Score = 35.9 bits (79), Expect = 0.049 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 294 SALMNRPTRGXXRFAYW 344 +ALMNRPTRG RFAYW Sbjct: 8 AALMNRPTRGERRFAYW 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,063,852 Number of Sequences: 59808 Number of extensions: 353921 Number of successful extensions: 6731 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3736 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2860128240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -