BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O09 (954 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 25 0.87 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 4.6 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 8.1 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 25.0 bits (52), Expect = 0.87 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Frame = +1 Query: 121 KLKMVSKAELACVYSALILVDD--------DVAVIGEKISTILKAAAVDVEPYWPGLFAK 276 ++KM K EL C+ + ++ D +V ++ EKI +L+ P PG FAK Sbjct: 305 EMKM-DKTELGCLRAIILYNPDVRGIKSVQEVEMLREKIYGVLEEYTRTTHPNEPGRFAK 363 Query: 277 AL 282 L Sbjct: 364 LL 365 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 4.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 552 NXPPXPPPP 578 N PP PPPP Sbjct: 729 NAPPPPPPP 737 Score = 22.2 bits (45), Expect = 6.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 552 NXPPXPPPPP 581 N P PPPPP Sbjct: 728 NNAPPPPPPP 737 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 Query: 534 TDFINXNXPPXPPPPP 581 T F+ N PP P PP Sbjct: 167 TGFLCNNYPPLPQVPP 182 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,089 Number of Sequences: 336 Number of extensions: 3066 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 26892580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -