BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O09 (954 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-89... 86 3e-17 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 27 0.12 06_03_0696 + 23617687-23617851,23618838-23619536 25 0.19 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 27 0.26 07_03_1771 - 29404972-29405175,29405282-29405677 25 0.65 11_06_0016 - 19284810-19284926,19285527-19286879 25 1.0 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.0 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 31 1.0 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 25 1.3 01_01_0761 - 5874953-5876803 25 1.3 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 25 1.3 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 1.4 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.4 11_06_0081 + 19886848-19888050,19888243-19888896 25 1.7 04_04_0887 + 29095087-29096166 25 1.8 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 26 1.8 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.8 10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951,726... 25 1.9 01_06_1321 + 36280691-36281269 25 1.9 07_03_0559 + 19475893-19476783 30 2.4 10_08_0214 - 15915156-15915713 30 3.1 05_04_0347 + 20479682-20479753,20480136-20480813,20481143-204821... 25 3.6 12_02_0299 - 17051570-17052474,17053542-17053755 25 3.8 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 4.1 01_06_1330 - 36361275-36361448,36361778-36361973,36362248-363623... 29 4.1 07_01_0080 + 587674-588510 29 5.1 10_03_0023 - 7151465-7152111,7152222-7152405 25 5.1 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 24 5.7 10_08_0534 + 18595520-18595828,18595917-18597149 25 6.3 02_05_0789 + 31766300-31767056,31767316-31767659 25 6.5 02_04_0520 - 23628183-23628195,23629354-23630036 25 6.8 07_03_0890 - 22332768-22333382 24 6.9 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 25 7.2 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 24 7.4 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 23 7.6 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 25 7.8 04_04_0951 + 29614196-29615275 24 8.4 10_06_0179 - 11508235-11508245,11508555-11508942 28 9.5 09_02_0252 - 6315834-6315959,6316074-6317018 28 9.5 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 28 9.5 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 28 9.5 04_01_0354 - 4646826-4647314 28 9.5 >08_01_0113 + 897970-898038,898148-898271,898811-898896,898996-899049 Length = 110 Score = 86.2 bits (204), Expect = 3e-17 Identities = 40/70 (57%), Positives = 53/70 (75%) Frame = +1 Query: 133 VSKAELACVYSALILVDDDVAVIGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 312 +S +E+AC +ALIL DD + + EKI+T++KAA + VE YWPGLFAK LE +V DLI Sbjct: 1 MSSSEVACTLAALILHDDGIPITSEKIATLVKAANIKVEAYWPGLFAKLLEHRSVDDLIL 60 Query: 313 NIGSGVGAAP 342 ++GSG GAAP Sbjct: 61 SVGSGGGAAP 70 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 27.5 bits (58), Expect(2) = 0.12 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 552 NXPPXPPPPPXXP 590 N PP PPPPP P Sbjct: 347 NAPPPPPPPPPPP 359 Score = 26.2 bits (55), Expect(2) = 6.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 546 NXNXPPXPPPPPXXP 590 N PP PPPPP P Sbjct: 347 NAPPPPPPPPPPPPP 361 Score = 25.8 bits (54), Expect(2) = 0.12 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNP 749 PP P + PPPP P P P Sbjct: 358 PPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 25.4 bits (53), Expect(2) = 6.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 374 PPPPPPPPSVP 384 Score = 21.8 bits (44), Expect(2) = 6.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 543 INXNXPPXPPPPP 581 +N P PPPPP Sbjct: 367 LNTAPKPPPPPPP 379 Score = 21.0 bits (42), Expect(2) = 6.0 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXP 737 PP P + PPP P P Sbjct: 357 PPPPPPPPPKLNTAPKPPPPPPP 379 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 25.4 bits (53), Expect(3) = 0.19 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 77 PPPPPPPPPPP 87 Score = 25.0 bits (52), Expect(3) = 0.19 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 537 DFINXNXPPXPPPPP 581 + I PP PPPPP Sbjct: 71 ELIKQTPPPPPPPPP 85 Score = 20.6 bits (41), Expect(3) = 0.19 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPP 725 PP + P+ PPPP Sbjct: 83 PPPPPSPPATHDVGQPPPP 101 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 27.5 bits (58), Expect(2) = 0.26 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 552 NXPPXPPPPPXXP 590 N PP PPPPP P Sbjct: 326 NPPPAPPPPPPPP 338 Score = 24.6 bits (51), Expect(2) = 0.26 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNPV 752 PP + PPPP P P PV Sbjct: 335 PPPPSRFNNTTPKPPPPPPPPEPPTGPV 362 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 25.4 bits (53), Expect(2) = 0.65 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 537 DFINXNXPPXPPPPP 581 D + PP PPPPP Sbjct: 9 DIVKSPLPPPPPPPP 23 Score = 25.4 bits (53), Expect(2) = 0.65 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 17 PPPPPPPPPLP 27 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 25.4 bits (53), Expect(3) = 1.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 84 PPSPPPPPPPP 94 Score = 22.2 bits (45), Expect(3) = 1.0 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 714 PPPPXPXPXXNP 749 PPPP P P P Sbjct: 88 PPPPPPPPPPRP 99 Score = 20.6 bits (41), Expect(3) = 1.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 705 SXHPPPPXPXP 737 S PPPP P P Sbjct: 86 SPPPPPPPPPP 96 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSXHPPPPXPXP 737 PP PPP P P + PP P S PPPP P P Sbjct: 55 PPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP-PYGVNSSQPPPPPPPP 113 Query: 738 XXNP 749 P Sbjct: 114 PSPP 117 Score = 28.7 bits (61), Expect = 7.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 543 INXNXPPXPPPPPXXP 590 +N + PP PPPPP P Sbjct: 101 VNSSQPPPPPPPPPSP 116 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 31.5 bits (68), Expect = 1.0 Identities = 21/95 (22%), Positives = 32/95 (33%), Gaps = 4/95 (4%) Frame = +3 Query: 477 YEEXKIFHFVYCKAF-ML*ETDFINXNXPPXPPPP---PXXPXXXXXXXXXXXXXXXXXX 644 ++ K+ + CKA ++ E + ++ PP PP P P P Sbjct: 145 FDPDKLADKLCCKACKIIKEIEIVDLPPPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEP 204 Query: 645 XXEGLXXDPPXXXTXPSXXXSXHPPPPXPXPXXNP 749 + +PP P PPP P P P Sbjct: 205 PPAVIIVEPPAPAPEPEPEPPKKEPPPPPPPKQEP 239 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 340 PPPPPPPPPPP 350 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 546 NXNXPPXPPPPP 581 N PP PPPPP Sbjct: 337 NPPPPPPPPPPP 348 >01_01_0761 - 5874953-5876803 Length = 616 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 46 PPPPPPPPDTP 56 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 531 ETDFINXNXPPXPPPPP 581 E + + PP PPPPP Sbjct: 36 EVAALEAHAPPPPPPPP 52 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 25.4 bits (53), Expect(2) = 1.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 147 PPPPPPPPQAP 157 Score = 24.2 bits (50), Expect(2) = 1.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 543 INXNXPPXPPPPP 581 + + PP PPPPP Sbjct: 141 VRCSPPPPPPPPP 153 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEG-LXXDPPXXXTXPSXXXSXHPPPPXPX 734 PP PPPPP P L PP P + PPP P Sbjct: 564 PPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 Query: 735 PXXNP 749 P P Sbjct: 624 PPPLP 628 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/69 (23%), Positives = 23/69 (33%) Frame = +3 Query: 531 ETDFINXNXPPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSX 710 ++++ + PP PPPPP + PP P+ Sbjct: 577 QSNYASSQPPPPPPPPPL--PNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLP 634 Query: 711 HPPPPXPXP 737 PPPP P P Sbjct: 635 PPPPPPPPP 643 Score = 29.5 bits (63), Expect = 4.1 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +3 Query: 558 PPXPPPPPXXP--XXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPS--XXXSXHPPPP 725 PP PPPPP P L PP P S PPPP Sbjct: 563 PPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPP 622 Query: 726 XPXPXXN 746 P P N Sbjct: 623 PPPPLPN 629 Score = 29.5 bits (63), Expect = 4.1 Identities = 18/64 (28%), Positives = 20/64 (31%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSXHPPPPXPXP 737 PP PPPPP P + PP P+ PPPP P P Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPN-RSVPPPPPPPPPLPNHSVLP-PPPPPPPP 642 Query: 738 XXNP 749 P Sbjct: 643 PSLP 646 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 546 NXNXPPXPPPPP 581 N PP PPPPP Sbjct: 743 NKRNPPAPPPPP 754 Score = 22.2 bits (45), Expect(2) = 5.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 558 PPXPPPPPXXP 590 P PPPPP P Sbjct: 762 PAPPPPPPQAP 772 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSXHPPPPXPXP 737 P PPPPP P +G PP P PPP P P Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 >11_06_0081 + 19886848-19888050,19888243-19888896 Length = 618 Score = 25.4 bits (53), Expect(2) = 1.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 263 PPPPPPPPAAP 273 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 537 DFINXNXPPXPPPPP 581 D PP PPPPP Sbjct: 255 DVSQLRSPPPPPPPP 269 >04_04_0887 + 29095087-29096166 Length = 359 Score = 25.4 bits (53), Expect(2) = 1.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 133 PPPPPPPPPLP 143 Score = 23.8 bits (49), Expect(2) = 1.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 546 NXNXPPXPPPPP 581 N PP PPPPP Sbjct: 128 NHFSPPPPPPPP 139 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 25.8 bits (54), Expect(2) = 1.8 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXP 731 PP P HPPPP P Sbjct: 70 PPTKPKHPKPKQQQHPPPPPP 90 Score = 23.4 bits (48), Expect(2) = 1.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 55 PPPPPPPP 62 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNPVXXXXXSRAA 779 PP P S PPPP P P +P S+AA Sbjct: 64 PPLPSATPPLAASPPPPPPPPPPRNSPSPPKPPSQAA 100 >10_03_0035 - 7265037-7265455,7265684-7265812,7265909-7265951, 7266321-7266344 Length = 204 Score = 25.4 bits (53), Expect(2) = 1.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 120 PPPPPPPPPQP 130 Score = 23.8 bits (49), Expect(2) = 1.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 546 NXNXPPXPPPPP 581 N PP PPPPP Sbjct: 117 NRVPPPPPPPPP 128 >01_06_1321 + 36280691-36281269 Length = 192 Score = 25.4 bits (53), Expect(3) = 1.9 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 144 PPSPPPPPPPP 154 Score = 21.4 bits (43), Expect(3) = 1.9 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 714 PPPPXPXPXXNP 749 PPPP P P P Sbjct: 148 PPPPPPPPPLPP 159 Score = 20.6 bits (41), Expect(3) = 1.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 705 SXHPPPPXPXP 737 S PPPP P P Sbjct: 146 SPPPPPPPPPP 156 >07_03_0559 + 19475893-19476783 Length = 296 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = -3 Query: 751 TGXXXGXGXGGGGWXEXXXEGXVIXXGGSXXXPSXXXXXXXXXXXXXXXXGXXXGXXGGG 572 +G G G GGGG G + GG G GGG Sbjct: 155 SGTGGGLGGGGGGGFGGGGGGGIGGGGGKGGGFGAGGGVGGAAGGGGGMGSGGGGGFGGG 214 Query: 571 GGXGGXF 551 GG GG F Sbjct: 215 GGKGGGF 221 >10_08_0214 - 15915156-15915713 Length = 185 Score = 29.9 bits (64), Expect = 3.1 Identities = 19/60 (31%), Positives = 19/60 (31%) Frame = -3 Query: 736 GXGXGGGGWXEXXXEGXVIXXGGSXXXPSXXXXXXXXXXXXXXXXGXXXGXXGGGGGXGG 557 G G GGGG EG GGS G GGGGG GG Sbjct: 28 GYGPGGGGGGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGGGYGRGGGGGGGGGEGG 87 >05_04_0347 + 20479682-20479753,20480136-20480813,20481143-20482195, 20482345-20482406,20482491-20482541,20482635-20482719, 20483253-20483342,20483472-20483563,20483704-20483728 Length = 735 Score = 25.4 bits (53), Expect(2) = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 698 PPPPPPPPRRP 708 Score = 22.6 bits (46), Expect(2) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 552 NXPPXPPPP 578 N PP PPPP Sbjct: 697 NPPPPPPPP 705 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 24.6 bits (51), Expect(2) = 3.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 672 PXXXTXPSXXXSXHPPPPXPXP 737 P PS S PPPP P P Sbjct: 308 PHFPPLPSFYPSPPPPPPPPPP 329 Score = 23.4 bits (48), Expect(2) = 3.8 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 286 PPSPPPPP 293 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSXHPPPPXP 731 PP PPPPP P G PP P PPPP P Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPG----PPPREIVPGQTLLPPPPPPRP 280 >01_06_1330 - 36361275-36361448,36361778-36361973,36362248-36362325, 36362685-36362807,36363206-36363463,36363914-36364073, 36364702-36364812,36365159-36365429,36365514-36365663, 36366383-36367090 Length = 742 Score = 29.5 bits (63), Expect = 4.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 664 ATPPPXXXHPPXXXRPTPHPLXLG 735 A+PPP PP RP P P LG Sbjct: 97 ASPPPSLPPPPPPLRPPPPPARLG 120 >07_01_0080 + 587674-588510 Length = 278 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 651 EGLXXDPPXXXTXPSXXXSXHPPPPXPXPXXNP 749 +G+ PP P S PPPP P P P Sbjct: 85 DGMFRRPPPPPPPPPSSGSPPPPPPPPPPPPPP 117 Score = 24.2 bits (50), Expect(2) = 5.1 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNPV 752 PP + S PPPP P P P+ Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPPL 122 Score = 23.4 bits (48), Expect(2) = 5.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 92 PPPPPPPP 99 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 25.4 bits (53), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 552 NXPPXPPPPP 581 N PP PPPPP Sbjct: 236 NPPPPPPPPP 245 Score = 22.2 bits (45), Expect(2) = 5.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPP P Sbjct: 239 PPPPPPPSLLP 249 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 23.8 bits (49), Expect(2) = 5.7 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = +3 Query: 672 PXXXTXPSXXXSXHPPPPXPXPXXNP 749 P + P PPPP P P P Sbjct: 41 PAPPSTPQLRGEASPPPPPPPPVGPP 66 Score = 23.4 bits (48), Expect(2) = 5.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 30 PPHPPPPP 37 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 24.6 bits (51), Expect(2) = 6.3 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 543 INXNXPPXPPPPP 581 ++ + PP PPPPP Sbjct: 31 VSPSPPPPPPPPP 43 Score = 22.6 bits (46), Expect(2) = 6.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 561 PXPPPPPXXP 590 P PPPPP P Sbjct: 35 PPPPPPPPPP 44 >02_05_0789 + 31766300-31767056,31767316-31767659 Length = 366 Score = 25.0 bits (52), Expect(2) = 6.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 540 FINXNXPPXPPPPP 581 F++ PP PPPPP Sbjct: 64 FLSVLSPPPPPPPP 77 Score = 22.2 bits (45), Expect(2) = 6.5 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPP P Sbjct: 71 PPPPPPPALAP 81 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 25.0 bits (52), Expect(2) = 6.8 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 522 ML*ETDFINXNXPPXPPPPP 581 ML + D PP PPPPP Sbjct: 182 MLVDFDLSTTLPPPPPPPPP 201 Score = 22.2 bits (45), Expect(2) = 6.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPP P Sbjct: 195 PPPPPPPDTAP 205 >07_03_0890 - 22332768-22333382 Length = 204 Score = 23.8 bits (49), Expect(2) = 6.9 Identities = 9/27 (33%), Positives = 10/27 (37%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNP 749 PP P + PPPP P P Sbjct: 91 PPPERAVPEAADTPPPPPPPTAPTPTP 117 Score = 23.4 bits (48), Expect(2) = 6.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 86 PPPPPPPP 93 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 25.4 bits (53), Expect(2) = 7.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 428 PPLPPPPPPPP 438 Score = 25.4 bits (53), Expect(2) = 9.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 431 PPPPPPPPPPP 441 Score = 21.4 bits (43), Expect(2) = 7.2 Identities = 10/27 (37%), Positives = 11/27 (40%), Gaps = 1/27 (3%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPP-PPXPXPXXN 746 PP P + PP PP P P N Sbjct: 435 PPPPPPPPPLPPNMPPPLPPPPEPELN 461 Score = 21.0 bits (42), Expect(2) = 9.2 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXP 737 PP P + PPP P P Sbjct: 433 PPPPPPPPPPPLPPNMPPPLPPP 455 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 24.2 bits (50), Expect(2) = 7.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 543 INXNXPPXPPPPP 581 ++ + PP PPPPP Sbjct: 1175 LSPSLPPPPPPPP 1187 Score = 22.6 bits (46), Expect(2) = 7.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 561 PXPPPPPXXP 590 P PPPPP P Sbjct: 1180 PPPPPPPPLP 1189 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 23.4 bits (48), Expect(2) = 7.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 558 PPXPPPPP 581 PP PPPPP Sbjct: 964 PPPPPPPP 971 Score = 23.4 bits (48), Expect(2) = 7.6 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXP 737 PP P PPPP P P Sbjct: 970 PPNVAPPPFTRQDIPPPPPSPPP 992 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 25.4 bits (53), Expect(2) = 7.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 558 PPXPPPPPXXP 590 PP PPPPP P Sbjct: 354 PPPPPPPPPPP 364 Score = 21.4 bits (43), Expect(2) = 7.8 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNP 749 PP P PPPP P P Sbjct: 359 PPPPPPPPPPPPPRPPPPPPPIKKGAP 385 >04_04_0951 + 29614196-29615275 Length = 359 Score = 24.2 bits (50), Expect(2) = 8.4 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 543 INXNXPPXPPPPP 581 ++ + PP PPPPP Sbjct: 54 LSRSSPPPPPPPP 66 Score = 22.6 bits (46), Expect(2) = 8.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 561 PXPPPPPXXP 590 P PPPPP P Sbjct: 59 PPPPPPPPLP 68 >10_06_0179 - 11508235-11508245,11508555-11508942 Length = 132 Score = 28.3 bits (60), Expect = 9.5 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +1 Query: 835 PNPXLXXHXXPXPRRXXPTXLSPXXXXXXPPPAPPHNP 948 P P P P PT +P PPAPP +P Sbjct: 37 PPPPKMAPLPPPPAAKAPTASAPSPVTAASPPAPPMSP 74 >09_02_0252 - 6315834-6315959,6316074-6317018 Length = 356 Score = 28.3 bits (60), Expect = 9.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 534 TDFINXNXPPXPPPP 578 T F N N PP PPPP Sbjct: 70 TPFANENHPPPPPPP 84 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.3 bits (60), Expect = 9.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 669 PPXXXTXPSXXXSXHPPPPXPXPXXNPV 752 PP T P PPPP P P PV Sbjct: 48 PPPQPTLPPPPPRTLPPPPPPPPPQPPV 75 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.3 bits (60), Expect = 9.5 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 3/67 (4%) Frame = +3 Query: 558 PPXPPPPPXXPXXXXXXXXXXXXXXXXXXXXEGLXXDPPXXXTXPSXXXSXH---PPPPX 728 PP PPPPP P PP P S PP P Sbjct: 367 PPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPPLLAPKQQSSGGPILPPAPA 426 Query: 729 PXPXXNP 749 P P P Sbjct: 427 PPPLFRP 433 >04_01_0354 - 4646826-4647314 Length = 162 Score = 28.3 bits (60), Expect = 9.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 543 INXNXPPXPPPPPXXP 590 +N + PP PPPPP P Sbjct: 89 LNLSPPPPPPPPPPPP 104 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,960,321 Number of Sequences: 37544 Number of extensions: 476674 Number of successful extensions: 5429 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 2108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4361 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2752963900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -