BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O08 (955 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 5.4 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 7.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 9.4 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 5.4 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 198 SRSRSSTGNLSIVPRVGHDQNHDQSQHEDSHHRTDP 305 S S S + +++I P + H++S +S DP Sbjct: 46 SSSNSDSLSMTIPPSIDRSSIHEESYLAESSRSIDP 81 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 7.1 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -2 Query: 474 SANHRMAYRNTQYVHNYEIILYRFQCRRCSLDSN 373 S ++R + N Y +NY Y C++ + N Sbjct: 84 SLSNRTIHNNNNYKYNYNNNNYNNNCKKLYYNIN 117 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 9.4 Identities = 9/38 (23%), Positives = 20/38 (52%) Frame = +3 Query: 453 MPFDDLHLYSFVFIFHIHMINLKFGLMLYSSVEYILQL 566 +PF+ + + + + + + F LML S + Y+ +L Sbjct: 296 IPFNGIQMPNLMVFYEKSLALAAFSLMLTSILRYLQEL 333 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,146 Number of Sequences: 438 Number of extensions: 4786 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31323201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -