BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O07 (1128 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 35 0.14 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.9 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 34.7 bits (76), Expect = 0.14 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -3 Query: 1045 GXENXGREXXPXGGXGXGXXXVGRRGRGXGX*GGXGXXXAXIGXXXXXEGXGGGXXXGAX 866 G GR GG G G G G G G GG G G G GGG G Sbjct: 160 GYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGY 219 Query: 865 MG 860 G Sbjct: 220 GG 221 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 29.9 bits (64), Expect = 3.9 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = -3 Query: 1084 PQDXXGXXXRRXQGXENXGREXXPXGGXGXGXXXVGRRGRGXGX*GGXGXXXAXIGXXXX 905 PQ R G + GG G G GR GRG GG G Sbjct: 399 PQPGNKDRQRGQSGFGSLNSRRGGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGG 458 Query: 904 XEGXGGG 884 EG GG Sbjct: 459 YEGYSGG 465 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,710,623 Number of Sequences: 59808 Number of extensions: 104618 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 78 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 16,821,457 effective HSP length: 83 effective length of database: 11,857,393 effective search space used: 3462358756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -