BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_O02 (955 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) 49 6e-06 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 6e-06 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.003 SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 38 0.016 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 37 0.021 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 37 0.021 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) 37 0.028 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 37 0.028 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 36 0.048 SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 36 0.048 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 36 0.048 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 36 0.048 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 36 0.048 SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 36 0.048 SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 36 0.048 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 36 0.048 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 36 0.048 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.048 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) 36 0.048 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 36 0.048 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 36 0.048 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 36 0.048 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 36 0.048 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 36 0.048 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 36 0.048 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 36 0.048 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) 36 0.048 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 36 0.048 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 36 0.048 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 36 0.048 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 36 0.048 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 36 0.048 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 36 0.048 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) 36 0.048 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 36 0.048 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 36 0.048 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 36 0.048 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 36 0.048 SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) 36 0.048 SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) 36 0.048 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 36 0.048 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 36 0.048 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 36 0.048 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 36 0.048 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 36 0.048 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 36 0.048 SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 36 0.048 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) 36 0.048 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 36 0.048 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 36 0.048 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.048 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 36 0.048 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) 36 0.048 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) 36 0.048 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 36 0.048 SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 36 0.048 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 36 0.048 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) 36 0.048 SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) 36 0.048 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 36 0.048 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 36 0.048 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 36 0.048 SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 36 0.048 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 36 0.048 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) 36 0.048 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 36 0.048 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 36 0.048 SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) 36 0.048 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 36 0.048 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 36 0.048 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 36 0.048 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 36 0.048 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 36 0.048 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 36 0.048 SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 36 0.048 SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 36 0.048 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 36 0.048 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 36 0.048 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 36 0.048 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 36 0.048 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 36 0.048 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 36 0.048 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 36 0.048 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.048 SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) 36 0.048 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 36 0.048 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 36 0.048 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 36 0.048 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57198| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55419| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55386| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 36 0.048 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54385| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.048 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53938| Best HMM Match : Gln-synt_N (HMM E-Value=0.78) 36 0.048 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 36 0.048 SB_52605| Best HMM Match : UPF0004 (HMM E-Value=3.6) 36 0.048 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51677| Best HMM Match : DUF327 (HMM E-Value=0.89) 36 0.048 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50879| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50212| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.048 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49496| Best HMM Match : DUF81 (HMM E-Value=3.6) 36 0.048 SB_49154| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46751| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46319| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 36 0.048 SB_45871| Best HMM Match : ABC_tran (HMM E-Value=2.5e-08) 36 0.048 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 36 0.048 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 36 0.048 SB_45133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44687| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44633| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 36 0.048 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42693| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 36 0.048 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40779| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 36 0.048 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39698| Best HMM Match : Rho_RNA_bind (HMM E-Value=3.4) 36 0.048 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 36 0.048 SB_39135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 36 0.048 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 36 0.048 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 36 0.048 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 36 0.048 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 36 0.048 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37138| Best HMM Match : RnaseA (HMM E-Value=8) 36 0.048 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36434| Best HMM Match : Ins_allergen_rp (HMM E-Value=5.7) 36 0.048 SB_36097| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 36 0.048 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 36 0.048 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 36 0.048 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33876| Best HMM Match : EGF (HMM E-Value=2.4e-08) 36 0.048 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 36 0.048 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 36 0.048 SB_32717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 36 0.048 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 36 0.048 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29112| Best HMM Match : Mucin (HMM E-Value=1.7) 36 0.048 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 36 0.048 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 36 0.048 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26142| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 36 0.048 SB_25656| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24739| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 >SB_52189| Best HMM Match : DUF454 (HMM E-Value=5.7) Length = 203 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +3 Query: 582 CIXESXNPRGEAXCVLGALPLPPSLTPC 665 CI ES N RGEA CVLGALPLP SLT C Sbjct: 100 CINESANARGEAVCVLGALPLPRSLTRC 127 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = +3 Query: 582 CIXESXNPRGEAXCVLGALPLPPSLTPC 665 CI ES N RGEA CVLGALPLP SLT C Sbjct: 464 CINESANARGEAVCVLGALPLPRSLTRC 491 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P SP PP PPPP PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP + P P P PP PPPP PP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPP 422 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P+ PP PPPP PP PP Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P + P PP PPPP PP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP+ P P P PP PPPP PP PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P + P PP PPPP PP PP Sbjct: 381 PPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PPPP PP PP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PPPP PP PP Sbjct: 378 PPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP Q P P P PP PPP PP PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP + P P P P PPPP PP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 P P P P P PP PPPP PP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP+ P P P PP PPPP P PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PPP PP PP Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPP 407 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P P PPPP PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PP P PP PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP P PP PP PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPP 895 PPP P P P PP PPPP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 32.3 bits (70), Expect = 0.60 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 845 SPAXPPXXXPPPPXXPPXKXXPP 913 SP PP PPPP PP PP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPP 386 Score = 32.3 bits (70), Expect = 0.60 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 794 PPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PP P P P PP PPP PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 32.3 bits (70), Expect = 0.60 Identities = 21/74 (28%), Positives = 22/74 (29%) Frame = +2 Query: 689 PXPXPPAXIPXSXXXXXXXXXXXXXXXXRQHTXFPPPAXQTXPXHPLKXAXXSPAXPPXX 868 P P PP P S + PPP P P P PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP-------PPPPPPP 418 Query: 869 XPPPPXXPPXKXXP 910 PPPP PP P Sbjct: 419 APPPPPPPPPPPPP 432 Score = 31.9 bits (69), Expect = 0.79 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P P PP P PP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PP P P P PP PPP PP PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P +P PP PPPP PP Sbjct: 401 PPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 861 PXXPPPPPXXPPXXXXPPXXKXGXP 935 P PPPPP PP PP P Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 861 PXXPPPPPXXPPXXXXPPXXKXGXP 935 P PPPPP PP PP P Sbjct: 368 PPPPPPPPPSPPPPPPPPPPSPPPP 392 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 6/48 (12%) Frame = +1 Query: 511 KQVXXTXCIHFMXXVQGEVW------EVFSALXNPPTRGERRXAYWAL 636 + + C+ F GE++ V +AL N PTRGERR AYWAL Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYWAL 149 >SB_13469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2429 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +2 Query: 611 RGGLRIGRSSASSLTDSL 664 RGGLRIGRSSASSLTDSL Sbjct: 262 RGGLRIGRSSASSLTDSL 279 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 608 GRGGLRIGRSSASSLTDSL 664 G GGLRIGRSSASSLTDSL Sbjct: 51 GPGGLRIGRSSASSLTDSL 69 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 608 GRGGLRIGRSSASSLTDSL 664 G GGLRIGRSSASSLTDSL Sbjct: 34 GGGGLRIGRSSASSLTDSL 52 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/61 (40%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = +1 Query: 463 EIXDAIALFVXII-SCNKQVXXTXCIHFMXXVQGEVWE--VFSALXNPPTRGERRXAYWA 633 +I + A F I+ S ++V I + G V + V +AL N PTRGERR AYWA Sbjct: 419 QIKETFAQFRKIVNSMEEEVEEIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYWA 478 Query: 634 L 636 L Sbjct: 479 L 479 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/50 (36%), Positives = 21/50 (42%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPPXXKGXXXXP 940 PPP+ P P+ A P PP PPP PP + PP G P Sbjct: 347 PPPSMGMAPP-PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPP 395 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/53 (28%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXK---XXPPXXKGXXXXP 940 PPP + P P P P PP PP + PP +G P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P +P PP PPP PP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPP 386 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PPP PP PP Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP P P P PP PPPP PP PP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPP-PPPTNGPPP 396 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPPXXK 922 PPP P P P PP PPP PP P K Sbjct: 376 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPSEGK 419 >SB_23824| Best HMM Match : RRM_1 (HMM E-Value=1.9e-19) Length = 623 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +2 Query: 602 PAGRGGLRIGRSSASSLTDSL 664 P GGLRIGRSSASSLTDSL Sbjct: 571 PKKPGGLRIGRSSASSLTDSL 591 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/35 (57%), Positives = 22/35 (62%) Frame = +1 Query: 532 CIHFMXXVQGEVWEVFSALXNPPTRGERRXAYWAL 636 C +M V V V +AL N PTRGERR AYWAL Sbjct: 68 CRRYMATVGKPV--VPAALMNRPTRGERRFAYWAL 100 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = +1 Query: 532 CIHFMXXVQGEVWEVFSALXNPPTRGERRXAYWAL 636 CI F + V +AL N PTRGERR AYWAL Sbjct: 129 CISFTRIFRVGKPVVPAALMNRPTRGERRFAYWAL 163 >SB_89| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +1 Query: 571 EVFSALXNPPTRGERRXAYWAL 636 +V +AL N PTRGERR AYWAL Sbjct: 5 DVPAALMNRPTRGERRFAYWAL 26 >SB_31888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 36.3 bits (80), Expect = 0.037 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Frame = +1 Query: 454 FICEIXDAIALFVXIISCNKQVXXTXCIHFMXXVQGEVWE---VFSALXNPPTRGERRXA 624 F+C + ++ + I CN + + FM + + V +AL N PTRGERR A Sbjct: 172 FVCNMLLSMGTMLLFI-CNMMLSMGTMLLFMCNMLLSMVGKPVVPAALMNRPTRGERRFA 230 Query: 625 YWAL 636 YWAL Sbjct: 231 YWAL 234 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_59631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 116 AALMNRPTRGERRFAYWAL 134 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_58955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 73 AALMNRPTRGERRFAYWAL 91 >SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) Length = 168 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 121 AALMNRPTRGERRFAYWAL 139 >SB_58783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 120 AALMNRPTRGERRFAYWAL 138 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 244 AALMNRPTRGERRFAYWAL 262 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 69 AALMNRPTRGERRFAYWAL 87 >SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) Length = 187 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 140 AALMNRPTRGERRFAYWAL 158 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 94 AALMNRPTRGERRFAYWAL 112 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 58 AALMNRPTRGERRFAYWAL 76 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 154 AALMNRPTRGERRFAYWAL 172 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 51 AALMNRPTRGERRFAYWAL 69 >SB_54224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_54223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 81 AALMNRPTRGERRFAYWAL 99 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 199 AALMNRPTRGERRFAYWAL 217 >SB_53433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 40 AALMNRPTRGERRFAYWAL 58 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 341 AALMNRPTRGERRFAYWAL 359 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 PPP T P P + P+ PP P PP PP K P Sbjct: 778 PPPPPPTKPATP-RVPPNIPSRPPGARPTPPPPPPGKPTKP 817 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXP 910 PPP P P P P PPPP P P Sbjct: 781 PPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 196 AALMNRPTRGERRFAYWAL 214 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 96 AALMNRPTRGERRFAYWAL 114 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 82 AALMNRPTRGERRFAYWAL 100 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 559 AALMNRPTRGERRFAYWAL 577 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 271 AALMNRPTRGERRFAYWAL 289 >SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 315 AALMNRPTRGERRFAYWAL 333 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 158 AALMNRPTRGERRFAYWAL 176 >SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 116 AALMNRPTRGERRFAYWAL 134 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 80 AALMNRPTRGERRFAYWAL 98 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 845 SPAXPPXXXPPPPXXPPXKXXPP 913 +P PP PPPP PP PP Sbjct: 463 APPPPPPPPPPPPPPPPPPPPPP 485 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPP 486 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPP 487 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPP 490 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPP 493 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +2 Query: 806 QTXPXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXP 910 Q P P P PP PPPP PP P Sbjct: 462 QAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 848 PAXPPXXXPPPPXXPPXKXXPP 913 P PP PPPP PP PP Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPP 492 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +2 Query: 791 PPPAXQTXPXHPLKXAXXSPAXPPXXXPPPP 883 PPP P P P PP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 794 PPAXQTXPXHPLKXAXXSPAXPPXXXPPPPXXP 892 PP P P P PP PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 28.3 bits (60), Expect = 9.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +2 Query: 815 PXHPLKXAXXSPAXPPXXXPPPPXXPPXKXXPP 913 P P P PP PPPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 42 AALMNRPTRGERRFAYWAL 60 >SB_47286| Best HMM Match : DUF485 (HMM E-Value=5.5) Length = 99 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 81 AALMNRPTRGERRFAYWAL 99 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 476 AALMNRPTRGERRFAYWAL 494 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 73 AALMNRPTRGERRFAYWAL 91 >SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 36 AALMNRPTRGERRFAYWAL 54 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 127 AALMNRPTRGERRFAYWAL 145 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 50 AALMNRPTRGERRFAYWAL 68 >SB_45312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 85 AALMNRPTRGERRFAYWAL 103 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_43936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 5505 AALMNRPTRGERRFAYWAL 5523 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 101 AALMNRPTRGERRFAYWAL 119 >SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) Length = 339 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 188 AALMNRPTRGERRFAYWAL 206 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 11 AALMNRPTRGERRFAYWAL 29 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 548 AALMNRPTRGERRFAYWAL 566 >SB_40754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 47 AALMNRPTRGERRFAYWAL 65 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 162 AALMNRPTRGERRFAYWAL 180 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 >SB_40593| Best HMM Match : UCH (HMM E-Value=1.4e-07) Length = 711 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 648 AALMNRPTRGERRFAYWAL 666 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 119 AALMNRPTRGERRFAYWAL 137 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) Length = 216 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 169 AALMNRPTRGERRFAYWAL 187 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 44 AALMNRPTRGERRFAYWAL 62 >SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 65 AALMNRPTRGERRFAYWAL 83 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 87 AALMNRPTRGERRFAYWAL 105 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_37875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 614 GGLRIGRSSASSLTDSL 664 GGLRIGRSSASSLTDSL Sbjct: 448 GGLRIGRSSASSLTDSL 464 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 94 AALMNRPTRGERRFAYWAL 112 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 53 AALMNRPTRGERRFAYWAL 71 >SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_35826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 54 AALMNRPTRGERRFAYWAL 72 >SB_35652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 64 AALMNRPTRGERRFAYWAL 82 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 80 AALMNRPTRGERRFAYWAL 98 >SB_35341| Best HMM Match : Acyl-CoA_dh_M (HMM E-Value=2.9e-14) Length = 490 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 357 AALMNRPTRGERRFAYWAL 375 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 78 AALMNRPTRGERRFAYWAL 96 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 47 AALMNRPTRGERRFAYWAL 65 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 185 AALMNRPTRGERRFAYWAL 203 >SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 576 AALMNRPTRGERRFAYWAL 594 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 298 AALMNRPTRGERRFAYWAL 316 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_33112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 71 AALMNRPTRGERRFAYWAL 89 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 802 AALMNRPTRGERRFAYWAL 820 >SB_32231| Best HMM Match : PRKCSH (HMM E-Value=4.3e-12) Length = 917 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 581 AALMNRPTRGERRFAYWAL 599 >SB_32223| Best HMM Match : SH3BP5 (HMM E-Value=0.12) Length = 709 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 137 AALMNRPTRGERRFAYWAL 155 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 187 AALMNRPTRGERRFAYWAL 205 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 86 AALMNRPTRGERRFAYWAL 104 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 487 AALMNRPTRGERRFAYWAL 505 >SB_31147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 32 AALMNRPTRGERRFAYWAL 50 >SB_30962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 733 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_30926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 145 AALMNRPTRGERRFAYWAL 163 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 932 AALMNRPTRGERRFAYWAL 950 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 58 AALMNRPTRGERRFAYWAL 76 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 100 AALMNRPTRGERRFAYWAL 118 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 437 AALMNRPTRGERRFAYWAL 455 >SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 44 AALMNRPTRGERRFAYWAL 62 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 70 AALMNRPTRGERRFAYWAL 88 >SB_27029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 424 AALMNRPTRGERRFAYWAL 442 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 233 AALMNRPTRGERRFAYWAL 251 >SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 240 AALMNRPTRGERRFAYWAL 258 >SB_26519| Best HMM Match : DUF1242 (HMM E-Value=8.7) Length = 247 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 200 AALMNRPTRGERRFAYWAL 218 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 143 AALMNRPTRGERRFAYWAL 161 >SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 36 AALMNRPTRGERRFAYWAL 54 >SB_25766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 40 AALMNRPTRGERRFAYWAL 58 >SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) Length = 911 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 752 AALMNRPTRGERRFAYWAL 770 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 52 AALMNRPTRGERRFAYWAL 70 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_24381| Best HMM Match : MMR_HSR1 (HMM E-Value=2) Length = 110 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 63 AALMNRPTRGERRFAYWAL 81 >SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 22 AALMNRPTRGERRFAYWAL 40 >SB_23874| Best HMM Match : SSIII (HMM E-Value=5.4) Length = 224 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 117 AALMNRPTRGERRFAYWAL 135 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 142 AALMNRPTRGERRFAYWAL 160 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 103 AALMNRPTRGERRFAYWAL 121 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 227 AALMNRPTRGERRFAYWAL 245 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 53 AALMNRPTRGERRFAYWAL 71 >SB_22764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 614 GGLRIGRSSASSLTDSL 664 GGLRIGRSSASSLTDSL Sbjct: 7 GGLRIGRSSASSLTDSL 23 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 101 AALMNRPTRGERRFAYWAL 119 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 136 AALMNRPTRGERRFAYWAL 154 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 61 AALMNRPTRGERRFAYWAL 79 >SB_21178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_20958| Best HMM Match : Peptidase_C15 (HMM E-Value=0.001) Length = 225 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 178 AALMNRPTRGERRFAYWAL 196 >SB_20773| Best HMM Match : DNA_pol_B_exo (HMM E-Value=2.5e-37) Length = 1652 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) Length = 1728 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 1681 AALMNRPTRGERRFAYWAL 1699 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 103 AALMNRPTRGERRFAYWAL 121 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 71 AALMNRPTRGERRFAYWAL 89 >SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) Length = 409 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 115 AALMNRPTRGERRFAYWAL 133 >SB_19170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 73 AALMNRPTRGERRFAYWAL 91 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 101 AALMNRPTRGERRFAYWAL 119 >SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 40 AALMNRPTRGERRFAYWAL 58 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 80 AALMNRPTRGERRFAYWAL 98 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 49 AALMNRPTRGERRFAYWAL 67 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 943 AALMNRPTRGERRFAYWAL 961 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 90 AALMNRPTRGERRFAYWAL 108 >SB_16558| Best HMM Match : SoxE (HMM E-Value=8.2) Length = 134 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 87 AALMNRPTRGERRFAYWAL 105 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 423 AALMNRPTRGERRFAYWAL 441 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 53 AALMNRPTRGERRFAYWAL 71 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 105 AALMNRPTRGERRFAYWAL 123 >SB_15003| Best HMM Match : WAP (HMM E-Value=0.0036) Length = 230 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 183 AALMNRPTRGERRFAYWAL 201 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 471 AALMNRPTRGERRFAYWAL 489 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 78 AALMNRPTRGERRFAYWAL 96 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 469 AALMNRPTRGERRFAYWAL 487 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 91 AALMNRPTRGERRFAYWAL 109 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 49 AALMNRPTRGERRFAYWAL 67 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 49 AALMNRPTRGERRFAYWAL 67 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 47 AALMNRPTRGERRFAYWAL 65 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 93 AALMNRPTRGERRFAYWAL 111 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 100 AALMNRPTRGERRFAYWAL 118 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 239 AALMNRPTRGERRFAYWAL 257 >SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) Length = 197 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 150 AALMNRPTRGERRFAYWAL 168 >SB_10549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_10448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 77 AALMNRPTRGERRFAYWAL 95 >SB_10073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 614 GGLRIGRSSASSLTDSL 664 GGLRIGRSSASSLTDSL Sbjct: 2 GGLRIGRSSASSLTDSL 18 >SB_9649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 119 AALMNRPTRGERRFAYWAL 137 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 1154 AALMNRPTRGERRFAYWAL 1172 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 50 AALMNRPTRGERRFAYWAL 68 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 70 AALMNRPTRGERRFAYWAL 88 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 55 AALMNRPTRGERRFAYWAL 73 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 48 AALMNRPTRGERRFAYWAL 66 >SB_8298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 78 AALMNRPTRGERRFAYWAL 96 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 69 AALMNRPTRGERRFAYWAL 87 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 46 AALMNRPTRGERRFAYWAL 64 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 1424 AALMNRPTRGERRFAYWAL 1442 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 614 GGLRIGRSSASSLTDSL 664 GGLRIGRSSASSLTDSL Sbjct: 2 GGLRIGRSSASSLTDSL 18 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 577 AALMNRPTRGERRFAYWAL 595 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 37 AALMNRPTRGERRFAYWAL 55 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 274 AALMNRPTRGERRFAYWAL 292 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 122 AALMNRPTRGERRFAYWAL 140 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 486 AALMNRPTRGERRFAYWAL 504 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 39 AALMNRPTRGERRFAYWAL 57 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 108 AALMNRPTRGERRFAYWAL 126 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 92 AALMNRPTRGERRFAYWAL 110 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 45 AALMNRPTRGERRFAYWAL 63 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 92 AALMNRPTRGERRFAYWAL 110 >SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 70 AALMNRPTRGERRFAYWAL 88 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 130 AALMNRPTRGERRFAYWAL 148 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 60 AALMNRPTRGERRFAYWAL 78 >SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 102 AALMNRPTRGERRFAYWAL 120 >SB_2218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 140 AALMNRPTRGERRFAYWAL 158 >SB_1272| Best HMM Match : Ras (HMM E-Value=8.9e-08) Length = 492 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +2 Query: 614 GGLRIGRSSASSLTDSL 664 GGLRIGRSSASSLTDSL Sbjct: 309 GGLRIGRSSASSLTDSL 325 >SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 57 AALMNRPTRGERRFAYWAL 75 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 67 AALMNRPTRGERRFAYWAL 85 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 63 AALMNRPTRGERRFAYWAL 81 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 493 AALMNRPTRGERRFAYWAL 511 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 388 AALMNRPTRGERRFAYWAL 406 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 41 AALMNRPTRGERRFAYWAL 59 >SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 25 AALMNRPTRGERRFAYWAL 43 >SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_57715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 175 AALMNRPTRGERRFAYWAL 193 >SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 60 AALMNRPTRGERRFAYWAL 78 >SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +1 Query: 580 SALXNPPTRGERRXAYWAL 636 +AL N PTRGERR AYWAL Sbjct: 8 AALMNRPTRGERRFAYWAL 26 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,304,380 Number of Sequences: 59808 Number of extensions: 318675 Number of successful extensions: 3776 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2487 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2800542235 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -