BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N24 (1028 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 26 0.54 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 23 2.9 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 6.7 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 25.8 bits (54), Expect = 0.54 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 800 TAPSHSXPPPXXPPPPPXXLPXCPXSXTHPP-PPXPPXPXPP 922 T P + P P P P P +PP P PP P PP Sbjct: 147 TMPKYE-PNPSIIDPGPALPPTGFLCNNYPPLPQVPPLPLPP 187 Score = 22.6 bits (46), Expect = 5.0 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 Query: 978 PPTLXXXPXPPPPLXPP 1028 PP P P PP+ PP Sbjct: 175 PPLPQVPPLPLPPIFPP 191 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 23.4 bits (48), Expect = 2.9 Identities = 12/41 (29%), Positives = 14/41 (34%) Frame = +2 Query: 800 TAPSHSXPPPXXPPPPPXXLPXCPXSXTHPPPPXPPXPXPP 922 T P + P P P + P P PP P PP Sbjct: 147 TMPKYEPNPSIIDPGPALPPAGFLCNNYLPLPQVPPLPLPP 187 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +3 Query: 840 PXPPPXSPXAPXPXP 884 P P P P AP P P Sbjct: 80 PEPDPEIPVAPEPAP 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,722 Number of Sequences: 336 Number of extensions: 2820 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 58 effective length of database: 103,097 effective search space used: 29279548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -