BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N23 (951 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 2e-22 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 69 7e-12 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 56 3e-08 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 56 3e-08 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 55 7e-08 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 54 2e-07 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 53 3e-07 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 53 4e-07 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 4e-07 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 52 5e-07 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 50 2e-06 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 49 5e-06 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 48 8e-06 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 48 8e-06 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 48 1e-05 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 47 3e-05 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 46 6e-05 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 46 6e-05 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 45 8e-05 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) 44 2e-04 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 44 2e-04 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 44 2e-04 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 44 2e-04 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 43 3e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 43 3e-04 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 43 4e-04 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 43 4e-04 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 42 6e-04 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 42 6e-04 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 42 6e-04 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 42 7e-04 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 42 7e-04 SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 42 0.001 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 41 0.002 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 40 0.002 SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) 40 0.002 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 40 0.002 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 40 0.002 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 40 0.003 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 40 0.003 SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 40 0.004 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 40 0.004 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 40 0.004 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 40 0.004 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 39 0.007 SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 39 0.007 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 39 0.007 SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) 39 0.007 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.007 SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 38 0.009 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 38 0.012 SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) 38 0.012 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 38 0.016 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 38 0.016 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 38 0.016 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 38 0.016 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.016 SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) 38 0.016 SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) 37 0.021 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 37 0.021 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 37 0.021 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 37 0.028 SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.028 SB_43135| Best HMM Match : CMAS (HMM E-Value=0) 36 0.036 SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.036 SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) 36 0.048 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 36 0.048 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 36 0.048 SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) 36 0.064 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 36 0.064 SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.064 SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) 36 0.064 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 36 0.064 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.084 SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) 35 0.084 SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) 35 0.11 SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) 35 0.11 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) 34 0.19 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 34 0.19 SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) 34 0.19 SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) 34 0.19 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 34 0.19 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 34 0.19 SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) 34 0.19 SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) 33 0.26 SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) 33 0.26 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 33 0.26 SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.26 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 33 0.26 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) 33 0.34 SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 33 0.34 SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) 33 0.34 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.45 SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) 33 0.45 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 33 0.45 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 33 0.45 SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.45 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 32 0.59 SB_45113| Best HMM Match : CemA (HMM E-Value=6) 32 0.59 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 32 0.59 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) 32 0.59 SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) 32 0.59 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 32 0.59 SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.59 SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) 32 0.59 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 32 0.59 SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) 32 0.78 SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.78 SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) 32 0.78 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 32 0.78 SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) 32 0.78 SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) 31 1.0 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) 31 1.0 SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) 31 1.0 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 31 1.0 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 1.0 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 31 1.0 SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) 31 1.4 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) 31 1.4 SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) 31 1.4 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) 31 1.4 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 31 1.4 SB_1366| Best HMM Match : Collagen (HMM E-Value=6.2e-05) 31 1.4 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 1.4 SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 1.7 SB_55828| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 1.8 SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 31 1.8 SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) 31 1.8 SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) 31 1.8 SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.8 SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) 31 1.8 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 31 1.8 SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) 31 1.8 SB_56163| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 30 2.4 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 30 2.4 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 30 2.4 SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) 30 2.4 SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) 30 2.4 SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) 30 2.4 SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) 30 2.4 SB_23371| Best HMM Match : SRCR (HMM E-Value=0) 30 2.4 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_11167| Best HMM Match : Mucin (HMM E-Value=4.9) 30 2.4 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) 30 3.2 SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) 30 3.2 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) 30 3.2 SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) 30 3.2 SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) 30 3.2 SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) 30 3.2 SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) 30 3.2 SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.2 SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) 30 3.2 SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 30 3.2 SB_51163| Best HMM Match : Adeno_PIX (HMM E-Value=0.96) 29 4.2 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_35820| Best HMM Match : TRAP_240kDa (HMM E-Value=0.006) 29 4.2 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_27284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 29 4.2 SB_504| Best HMM Match : GRP (HMM E-Value=2.8) 29 4.2 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 29 4.2 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_19238| Best HMM Match : DUF729 (HMM E-Value=1.4) 25 4.8 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_37296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_28577| Best HMM Match : Chitin_bind_3 (HMM E-Value=0.00012) 29 5.5 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_20539| Best HMM Match : VWA (HMM E-Value=5.1848e-44) 29 5.5 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 29 5.5 SB_2886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_47680| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_17676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_55729| Best HMM Match : YajC (HMM E-Value=0.56) 29 7.3 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_51034| Best HMM Match : Extensin_2 (HMM E-Value=0.038) 29 7.3 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 29 7.3 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 29 7.3 SB_23620| Best HMM Match : Pentapeptide_2 (HMM E-Value=0.74) 29 7.3 SB_15833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_6248| Best HMM Match : KH_1 (HMM E-Value=1.6e-41) 29 7.3 SB_3960| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 29 7.3 SB_34511| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_24909| Best HMM Match : Mab-21 (HMM E-Value=3.4e-06) 29 7.3 SB_3180| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.3 SB_31904| Best HMM Match : Extensin_2 (HMM E-Value=0.5) 25 8.4 SB_56109| Best HMM Match : Collagen (HMM E-Value=0.79) 28 9.6 SB_13751| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 28 9.6 SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_58404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_37025| Best HMM Match : Homeobox (HMM E-Value=1.3e-16) 28 9.6 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_17864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 SB_3427| Best HMM Match : Homeobox (HMM E-Value=4e-24) 28 9.6 SB_2691| Best HMM Match : Luteo_Vpg (HMM E-Value=2.1) 28 9.6 SB_1966| Best HMM Match : GRP (HMM E-Value=0.53) 28 9.6 SB_1375| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 28 9.6 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 103 bits (248), Expect = 2e-22 Identities = 54/112 (48%), Positives = 66/112 (58%) Frame = +3 Query: 93 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 272 M S +ELACVYSALIL DDDVA+T +KI T++KAA ++VEP+WPGLFAKAL+G N+ DLI Sbjct: 1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEPFWPGLFAKALQGHNIADLI 60 Query: 273 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 428 + +G SDDDMGFGLFD Sbjct: 61 --LSAGAPGAGGAVAAAPAAGGEAKAEEKKEEAKKEESEEESDDDMGFGLFD 110 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 68.5 bits (160), Expect = 7e-12 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP PPP P PPP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 68.5 bits (160), Expect = 7e-12 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP PPP P PPP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 68.5 bits (160), Expect = 7e-12 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP PPP P PPP P Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 66.9 bits (156), Expect = 2e-11 Identities = 30/72 (41%), Positives = 32/72 (44%) Frame = +1 Query: 736 NQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 N + PP P P + PPPP P PP PPPP P PPP PP Sbjct: 362 NMSPPPPPPPPP--PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 916 XPPPXPXPPPXP 951 PPP P PPP P Sbjct: 420 PPPPPPPPPPPP 431 Score = 66.1 bits (154), Expect = 4e-11 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PPP PPPP P P PP PPPPP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPP 416 Score = 66.1 bits (154), Expect = 4e-11 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PPP PPPP P P PP PPPPP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 66.1 bits (154), Expect = 4e-11 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PPP PPPP P P PP PPPPP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Score = 66.1 bits (154), Expect = 4e-11 Identities = 25/46 (54%), Positives = 25/46 (54%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PPP PPPP P P PP PPPPP Sbjct: 384 PPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 62.9 bits (146), Expect = 4e-10 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P PP P PPP PPPP P P PP PPPPP Sbjct: 387 PSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 57.6 bits (133), Expect = 1e-08 Identities = 33/90 (36%), Positives = 37/90 (41%) Frame = +1 Query: 676 TXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXX 855 T +S + P P P + PP P P + PPPP P PP Sbjct: 355 TDISAGINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP---PPPPPPPPP------- 404 Query: 856 XXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P PPP PP PPP P PPP Sbjct: 405 --PPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 48.0 bits (109), Expect = 1e-05 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PPP PPPP P P PP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P PP PPP PP PP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXP 591 PPP PP PPP P A P Sbjct: 403 PPPPPPPPPPPPPPPPAPPPP 423 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXP 591 PPP PP PPP P P Sbjct: 406 PPPPPPPPPPPPPAPPPPPPP 426 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 63.7 bits (148), Expect = 2e-10 Identities = 44/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP PPP P P+ P P P + + Sbjct: 96 PPPYPPYPPPPPY-PPPPNPPYPPPPNAPYPPPPNPPYPPPPN--APYPPSPNAPYP--- 149 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP-PPXXXX 885 P P P PP P P PPPP P PP P PP PP Sbjct: 150 PPPNPPYPPPLYPPPPNPPPP--------NAPYPPPPYPPPPNPPYPPPPNPPYPPPPNA 201 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P PPP PP PPP PP P Sbjct: 202 PNPPPPNPPYPPPPNAPNPPYP 223 Score = 61.3 bits (142), Expect = 1e-09 Identities = 42/146 (28%), Positives = 46/146 (31%), Gaps = 1/146 (0%) Frame = +1 Query: 517 YIXXPPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKF 696 Y PPP P PPP P P+ +P P P + + Sbjct: 99 YPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPP--NPPY 156 Query: 697 RHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPX 876 L P P P P P P P PP P PP P PPPP Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPP--------PPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 877 XXXPXXP-PPXPPXXPPPXPXPPPXP 951 P P P PP PPP PP P Sbjct: 209 PPYPPPPNAPNPPYPPPPNAPNPPYP 234 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P PP P PPP P PPP P PPP P PP P Sbjct: 90 PNPPYPPPPYPPYPPPPPYPPPPNP-PYPPPPNAPYPPPPNPPYPPPP 136 Score = 48.8 bits (111), Expect = 6e-06 Identities = 20/38 (52%), Positives = 20/38 (52%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP P PP P P P PPPP P P PP PPPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYP-PPPPYPPPPNPPYPPPP 120 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PP PPPP P P P P PP Sbjct: 107 PYPPPPNPPYPPPPNAPYPPPPN--PPYPPPPNAPYPPSPNAPYPP 150 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PPP PPPP P P PP P PP Sbjct: 85 PTNFSPNPPYPPPPYPPYP-PPPPYPPPPNPPYPPPPNAPYPP 126 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPP--XPXPPP 946 PP + P P P PP PPP P PPP P PPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP 127 Score = 32.7 bits (71), Expect = 0.45 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXX--PPPXPXPPP 945 PP P P P PP PPP P PPP Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPP 111 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 56.4 bits (130), Expect = 3e-08 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP PPPP P P PP PPPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP PPPP P P PP PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 50.0 bits (114), Expect = 3e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP PP PPP P PPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/44 (52%), Positives = 23/44 (52%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P PPPP P PPP PP PPP P P Sbjct: 464 PPPPPPPPPPP-------PPPP----PPPPPPPPPFPPPPPPTP 496 Score = 45.6 bits (103), Expect = 6e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP PP PP P PPP P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P P PP P PP P PPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 P P P PP P PP P PP PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP--PPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPF 594 PPP PP PPP P PF Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPF 488 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 56.4 bits (130), Expect = 3e-08 Identities = 28/54 (51%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GGG GG GGG G GGGG G GG G GGGG V R Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGR 115 Score = 49.2 bits (112), Expect = 5e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGG---GXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGG G GGG G GG G GG G G G Sbjct: 66 GGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVG 114 Score = 48.8 bits (111), Expect = 6e-06 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGGG GG G GGGG GGG G G G GG G G T Sbjct: 74 GGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFGST 121 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRG 787 G GGG G GGG GG GGG G G G G GG G R G Sbjct: 65 GGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFG 119 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G GGGG Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 55.2 bits (127), Expect = 7e-08 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGG G GG G GGGG Sbjct: 777 GDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGG 824 Score = 50.0 bits (114), Expect = 3e-06 Identities = 34/104 (32%), Positives = 37/104 (35%), Gaps = 2/104 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG GG G G G G GG G G + Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGG 829 Query: 771 RGXGNXW--GGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G + GG G+ G G G G G GGG Sbjct: 830 YGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 48.8 bits (111), Expect = 6e-06 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGG GGG G GG G GG G G G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGD--GGGYGDGDGG 813 Score = 48.0 bits (109), Expect = 1e-05 Identities = 24/49 (48%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGG 807 G GGG G G GG GGG G GGGG G G G G GGGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGG 817 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/76 (34%), Positives = 29/76 (38%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G G G G GGG GG GGG GG G G G GG G G Sbjct: 808 GDGDGGGGGGGG-GGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGG 866 Query: 771 RGXGNXWGGCLVXGED 724 G G GG ++ E+ Sbjct: 867 GGGGGGGGGGVIKNEE 882 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 54.0 bits (124), Expect = 2e-07 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 V P P P P PP P PPP PPPP P P P PPPP Sbjct: 665 VNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P T P PP P PPP PPPP P PP P PP Sbjct: 670 PIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 46.8 bits (106), Expect = 3e-05 Identities = 25/56 (44%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 760 PXXPIFXLXAXRXTXXPPPPXP-XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 P PI L T PPPP P PP P PPPP P PPP PP PP Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPP-------PPPPPPPQPSTPPPPPPSTPP 715 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PPPP P PPP PP P P PP P Sbjct: 667 PSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 42.7 bits (96), Expect = 4e-04 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 824 PXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP PPP P PPP P PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPP 715 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/64 (29%), Positives = 21/64 (32%) Frame = +3 Query: 753 TXSXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 T S P + + P P PP P PP P P PPPP P Sbjct: 662 TISVNPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGA 721 Query: 933 PPPP 944 P P Sbjct: 722 PGSP 725 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPPP P PP P PPPP P P P P Sbjct: 688 PPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSP 729 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +1 Query: 736 NQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 N + P I PI + PPPP P PP P PPPP Sbjct: 666 NPSIPIQILPIPIQTMVPPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/70 (30%), Positives = 21/70 (30%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG--GGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G G GG GG GG G GG GG G G GG N Sbjct: 562 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNN 621 Query: 776 KIGXXGXXGG 747 G G G Sbjct: 622 NGGNTGGNNG 631 Score = 32.7 bits (71), Expect = 0.45 Identities = 23/87 (26%), Positives = 27/87 (31%), Gaps = 4/87 (4%) Frame = +1 Query: 703 ALXPXVPI----LPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPP 870 ++ P +PI +P PP P P PPPP P P P PP Sbjct: 664 SVNPSIPIQILPIPIQTMVPPPPPPPP-------PPPPPPPPPPPQPSTPPPPPPSTPPV 716 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P P P Sbjct: 717 QQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GG GG G GG G GG G G GG N Sbjct: 428 GGNNNGGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNN 474 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 2/67 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGG--GGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 GG GG G GG G GG GG G G GG N G Sbjct: 539 GGNNNGGNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGG 598 Query: 767 XXGXXGG 747 G G Sbjct: 599 NTGGNNG 605 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG--GGXXXXXXXGXGGXGXGGGGXN 801 G G GG GG GG G GG GG G G GG N Sbjct: 588 GGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNN 639 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 2/52 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG--GGXXXXXXXGXGGXGXGGGGXN 801 G GG GG GG G GG GG G G GG N Sbjct: 545 GNNGGSNNGGNDGSNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNTGGNNN 596 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GG GG G GG G GG G G GG N Sbjct: 434 GNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNNNGGNN 484 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GG GG GG G GG G G GG N Sbjct: 505 GGNNNGGNNNGGNNNGGNNNGGNNNGGNNNGENNGGNNNGGNNGGSN 551 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GG G G GG G GG G G GG N Sbjct: 433 GGNNGGNNNGGNTGGDNNGGNNYGGNNNGGNNNVGNNNGGNNNGGNN 479 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G GG GG G G G G G Sbjct: 597 GGNTGGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNG 640 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG G GG GG G G GG G Sbjct: 605 GGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSGG 645 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G GG GG G G G G G Sbjct: 601 GGNNGGNTGGNNNGGNTGGNNNGGNTGGNNGGNTGGNNNGGNSG 644 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXG-RGSPLYXGXXGSTPDTXP**PSXHPPP 659 PPPP PP PST + S GS T P PPP Sbjct: 698 PPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/43 (55%), Positives = 24/43 (55%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GGGG GGG G GG G GG G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GGGG G GG G G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 52.8 bits (121), Expect = 4e-07 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G G GG Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 52.8 bits (121), Expect = 4e-07 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 52.8 bits (121), Expect = 4e-07 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGGG GGG G GG G GG G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 50.8 bits (116), Expect = 2e-06 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GGGG G G G G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GGGG GGG G GG G G G Sbjct: 672 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GGGG GGG G GG G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXA 791 G GG GG G G GGGG GGG G GG G GG G G G A Sbjct: 657 GDGGDGGGGGGG-GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGA 705 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = -1 Query: 942 GGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 GG G GGG GG GGG GG G G G G GG G G + D Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGD 715 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXG 823 G GGG G GGG GG GGG GG G G G G G Sbjct: 674 GGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDG 716 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 53.2 bits (122), Expect = 3e-07 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP PPPP P P PP PPPPP Sbjct: 204 PPPPPPRPPPSPPPPPPPPSPSPPRPPPPP 233 Score = 51.6 bits (118), Expect = 9e-07 Identities = 20/41 (48%), Positives = 20/41 (48%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP PPPP P P P PPPPP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 50.4 bits (115), Expect = 2e-06 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP----XPXPPPXP 951 T PPPP PP P PPPP P PPP PP P P P PPP P Sbjct: 202 TQPPPPPPRPPPSPPPP----PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 46.8 bits (106), Expect = 3e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPP PP P P P PP PP PP Sbjct: 209 PRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 46.0 bits (104), Expect = 4e-05 Identities = 24/59 (40%), Positives = 26/59 (44%), Gaps = 4/59 (6%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXP-PXPXXPPPXPPPPXXPXPXP---PXPPPPP 944 P + P P P PP + P P P P PPP PPPP P P P PPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPP-PPPPSPPRPLAAKLPEPPPIP 252 Score = 45.6 bits (103), Expect = 6e-05 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PPPP PPP PP PP P PPP P Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/73 (35%), Positives = 26/73 (35%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P P T PP P P PPPP P PP P PP P PP Sbjct: 195 PTSPSQITQPPPPPPRP-----PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPP 249 Query: 901 PXPPXXPPPXPXP 939 P P PP P P Sbjct: 250 PI-PNMPPTLPPP 261 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P PP P PPPP P P PPP P PP Sbjct: 211 PPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPP 256 Score = 41.5 bits (93), Expect = 0.001 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P P PP PPP P PP Sbjct: 195 PTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 35.5 bits (78), Expect = 0.064 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPP 938 P P P P P PP P P P PP P P PPP Sbjct: 216 PPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P PP P P P P P P P PP PP Sbjct: 219 PPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 520 IXXPPPXPPXPPPXXXVPXAXXXP 591 I PPP PP PPP P P Sbjct: 201 ITQPPPPPPRPPPSPPPPPPPPSP 224 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 52.8 bits (121), Expect = 4e-07 Identities = 26/48 (54%), Positives = 26/48 (54%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGGG Sbjct: 82 GRGGGFGGGGGFGGGGGGGFGG----GGGGGFGGGGGGGGGFGGGGGG 125 Score = 48.8 bits (111), Expect = 6e-06 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG 822 G GGG G GGG GG GGG G GGGG G GG G Sbjct: 86 GFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GGGG GG G GG G GG G G Sbjct: 88 GGGGGFGGGGGGGFGGGG--GGGFGGGGGGGGGFGGGGGGGFG 128 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/45 (48%), Positives = 22/45 (48%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GGGG GGG G G G GG G G G Sbjct: 84 GGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFG 128 Score = 40.7 bits (91), Expect = 0.002 Identities = 18/35 (51%), Positives = 18/35 (51%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG G GGGG G GG G GGGG Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGG 115 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G G GGG GGG G GG G GG G G G Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGG-GGGGGFGGGG 123 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 52.8 bits (121), Expect = 4e-07 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P T PPPP PP P PPPP PPP P PPP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPP 406 Query: 928 XPXPPPXP 951 P P P Sbjct: 407 PPPPTNGP 414 Score = 48.4 bits (110), Expect = 8e-06 Identities = 21/43 (48%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP--XPPPPP 944 P PP T P PP PPP PP P P PP PPPPP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/43 (46%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 PP P PPPP P PPP PP PPP PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPP 388 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP PPP PPP P P PP PP Sbjct: 370 PTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/72 (36%), Positives = 27/72 (37%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P N T PP P + PPP PP P PPPP P Sbjct: 354 PPSPPPPTNNTPPPPPP--------TNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGP- 404 Query: 892 XPPPXPPXXPPP 927 PPP PP PP Sbjct: 405 -PPPPPPTNGPP 415 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPX--PPXXPPPXPXPPP 946 PP P N P P PP PPP PP PPP PPP Sbjct: 347 PPPPTNNPPS----PPPPTNNTPPPPPPTNKPPPPPPPTNGPPP 386 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPP 926 P PPP PPPP P PP Sbjct: 72 PSTPAPPPPPPPPSSGPPLPP 92 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPP 935 P P P PPPP P PP PP Sbjct: 72 PSTPAP-PPPPPPPSSGPPLPP 92 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXT 674 PPPP PP P T G P P P P+ PPP P T Sbjct: 366 PPPPPTNKPPPPPPPTNGPPPP--PPPTNGPPPPPP--PTNGPPPPPPPT 411 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 52.4 bits (120), Expect = 5e-07 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G GG G G GGGG GGG G GG G GG G G G Sbjct: 173 GGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 50.0 bits (114), Expect = 3e-06 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G GGGG GGG G GG G GG G G Sbjct: 178 GGGYGGGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYG 220 Score = 48.8 bits (111), Expect = 6e-06 Identities = 27/59 (45%), Positives = 27/59 (45%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG*R*G 767 GGG G GG G G GGGG GGG G GG G GG G G G G R G Sbjct: 168 GGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGG-YGGSGYGGGGGYGGGGYGGGRSG 225 Score = 48.4 bits (110), Expect = 8e-06 Identities = 33/82 (40%), Positives = 34/82 (41%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GG G GGG G G GGG G GGGG G GG G GGGG Sbjct: 150 GGGGYRGGGGGYRGRGRGGGGYGGGGYGGGG---YGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 773 -IGXXGXXGGXVWLXGRMGTXG 711 G G GG + GR G G Sbjct: 207 GYGGGGGYGGGGYGGGRSGGGG 228 Score = 48.0 bits (109), Expect = 1e-05 Identities = 25/51 (49%), Positives = 25/51 (49%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG G GGG GG GGG G GGGG G GG GGGG V Sbjct: 184 GGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGG---GYGGGRSGGGGYEV 231 Score = 45.6 bits (103), Expect = 6e-05 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G GG G G GGGG GGG G GG G GG G G G Sbjct: 163 GRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYG-GGGGGYGGSG 207 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G GG G G GGGG G G G GG G GG G G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 Score = 44.4 bits (100), Expect = 1e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G GG G GGGG G GG G GG G Sbjct: 131 GYGGGRGGGGGYRSG-GGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYG 177 Score = 44.4 bits (100), Expect = 1e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGG 807 GGG GGG GG GGG G GGG G G GG G GGGG Sbjct: 145 GGGYRGGGGYRGG-GGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGG 190 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/70 (40%), Positives = 28/70 (40%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG--GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG GGG GG G GG G G GG G GG G GGGG Sbjct: 137 GGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGG-GGYGGGGYGGGGYGGGGHGGGGYGGGG 195 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 196 YGGGGGGYGG 205 Score = 41.1 bits (92), Expect = 0.001 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GGG GGG G GG G GG G G G Sbjct: 156 GGGGGYRGRGRG---GGGYGGGGYGGGGYGGGGHG-GGGYGGGGYG 197 Score = 40.7 bits (91), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGG 807 GGG GGG GG GGG G GGG G G G GGGG Sbjct: 123 GGGGRRGGGYGGGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG 170 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GGG G GGG G GG G GGGG Sbjct: 129 GGGYGGGRGGGGGYRSGGGYRGGGGYRGGG-GGYRGRGRGGGGYGGGG 175 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/48 (45%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXGGX--GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG GG G G GGGG GG G G G GG G G G Sbjct: 134 GGRGGGGGYRSGGGYRGGGGYRGGGGGYRGRGRGGGG-YGGGGYGGGG 180 Score = 29.9 bits (64), Expect = 3.2 Identities = 25/72 (34%), Positives = 27/72 (37%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG GG GG G GGGG GG GGGG R + G GG Sbjct: 124 GGGRRGGGYGGGRG----GGGGYRS------GGGYRGGGGYRGGGGGYRGRGRGGGGYGG 173 Query: 746 XVWLXGRMGTXG 711 + G G G Sbjct: 174 GGYGGGGYGGGG 185 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 51.2 bits (117), Expect = 1e-06 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PPP P PPP PPP P PPP P Sbjct: 945 PPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Score = 50.8 bits (116), Expect = 2e-06 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P PPP PPP P PPP P Sbjct: 946 PPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPP 993 Score = 46.8 bits (106), Expect = 3e-05 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P A P PP PP PP PPPP P PP PPPPP Sbjct: 937 PGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPP 991 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +1 Query: 808 PPPPXPX------PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PPP PP P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLP 974 Score = 46.0 bits (104), Expect = 4e-05 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PPPP P P PPPP P PPP PP PP Sbjct: 956 PPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 43.2 bits (97), Expect = 3e-04 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP----PPP 944 P P PP P PP P PPPP P PP PP PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/54 (40%), Positives = 22/54 (40%), Gaps = 6/54 (11%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP---XPPXXPPP---XPXPPPXP 951 PPP P P PPPP PPP PP PPP P PPP P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPP 988 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP---XPPXPPPP 941 P P P + P P PPP PP P P PP PPPP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPP 977 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPP-------PXXPXPXPPXPPPPP 944 P PP P PP P P PPP P P P PPPPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 15/56 (26%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPP------------PPXXPXP---XPPXPPPPP 944 P PP P PP PPP PP PP P P PP PPPPP Sbjct: 934 PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPP 989 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PPP PP P P PPP Sbjct: 910 PSASPPGGSVPPPPPPPGGNAPLPPPPP 937 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/47 (38%), Positives = 19/47 (40%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPPXL 665 PPPP P P P G PL GS P P P PPP + Sbjct: 953 PPPP--PPPGGSAPPPGGGAPPLPPPPGGSAPPPPP--PPPPPPPPM 995 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +1 Query: 862 PPPPXXXXPXXP-PPXPPXXPPPXPXPPP 945 PPPP P PP PP P PPP Sbjct: 920 PPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPP------PPXXPXPXPPXPPPPP 944 P P + P PPP PP PP P P PPPP Sbjct: 900 PSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPP 948 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 50.4 bits (115), Expect = 2e-06 Identities = 27/83 (32%), Positives = 28/83 (33%), Gaps = 3/83 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P + PP P P P P PP P P P Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAA 186 Query: 892 XPPPX---PPXXPPPXPXPPPXP 951 PPP PP PPP P PPP P Sbjct: 187 SPPPPSGGPPPPPPPPPPPPPPP 209 Score = 49.2 bits (112), Expect = 5e-06 Identities = 32/93 (34%), Positives = 32/93 (34%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXX 846 P P S R A P PI P PP P P T PPPP P P Sbjct: 126 PPPPPTSPATR-APPPPPPIAPATGGPPPPPPIAPA--------TGGPPPPPPIAPAATV 176 Query: 847 XXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P PP PPP P PPP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPP 209 Score = 48.4 bits (110), Expect = 8e-06 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P P P PPP P P PP PPPPP Sbjct: 164 PPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPP 206 Score = 47.2 bits (107), Expect = 2e-05 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = +1 Query: 742 TXPPXIPXX---PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 T PP +P P + PPP P P PPPP PPP PP Sbjct: 84 TAPPLVPAGVEAPTPTPMVAQSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPP 143 Query: 913 XXPPPXPXPPPXP 951 P PPP P Sbjct: 144 IAPATGGPPPPPP 156 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/92 (30%), Positives = 28/92 (30%), Gaps = 12/92 (13%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP- 888 P P P PP P P P P PP P PPPP P Sbjct: 114 PRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPA 173 Query: 889 -----------XXPPPXPPXXPPPXPXPPPXP 951 PP P PPP P PPP P Sbjct: 174 ATVPAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/65 (36%), Positives = 24/65 (36%), Gaps = 4/65 (6%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPP----PXPPPPXXPXPXPP 926 S P P A P P PP T PP P P P PPPP P P Sbjct: 105 SVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP 164 Query: 927 XPPPP 941 PPPP Sbjct: 165 PPPPP 169 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRX---TXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 P PI P PP P P + A PPPP PP P PPPP Sbjct: 153 PPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILE 212 Query: 883 XPXXPPP 903 PPP Sbjct: 213 LAAPPPP 219 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPX--PXXPPPXPPPPXXPXPXPPXPPPPP 944 + P P P P PP P PPP PPPP P PPPP Sbjct: 170 IAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPP 219 Score = 33.9 bits (74), Expect = 0.19 Identities = 22/69 (31%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPPPPX------PXPPXPXXXXXXXPPPPXXXXPXXPP 900 Q+ P P P + PPPP P PP P PPPP P P Sbjct: 104 QSVAPTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPP---PIAPA 160 Query: 901 PXPPXXPPP 927 P PPP Sbjct: 161 TGGPPPPPP 169 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P A P P T P PPP P P P P PPPP Sbjct: 78 PQTQASTAPPLVPAGVEAPTPTPMVAQSVAPTPPPP-PRAPETPSQAPSPPPPP 130 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 49.6 bits (113), Expect = 4e-06 Identities = 19/28 (67%), Positives = 19/28 (67%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP PPPP P P PP PPPPP Sbjct: 1157 PPPP--PPPPPPPPSSPSPPPPPPPPPP 1182 Score = 45.6 bits (103), Expect = 6e-05 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP PP P P PP PPPPP Sbjct: 1157 PPPPPP--PPPPPPSSPSPPPPPPPPPPPP 1184 Score = 44.0 bits (99), Expect = 2e-04 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P PPP P P P P PP PP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP P PPP P PPP P Sbjct: 1157 PPPPPPPPP--PPPSSPSPPPPPPPPPPPP 1184 Score = 41.9 bits (94), Expect = 7e-04 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP P PPP P PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPP 1182 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 PPPP P PP P PPPP P PPP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPP----PPPPPPTP 1186 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP 917 P P P PP P P P PPP PPPP P P Sbjct: 1157 PPPPPPPPP-------PPPSSPSPPPPPPPPPPPPTP 1186 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 PPP P PP P PPPP PPP PP P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPP-------PPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 520 IXXPPPXPPXPPPXXXVPXAXXXP 591 I PPP PP PPP P P Sbjct: 1156 IPPPPPPPPPPPPSSPSPPPPPPP 1179 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 49.6 bits (113), Expect = 4e-06 Identities = 29/80 (36%), Positives = 30/80 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG GG GG G GGG G GG GGGG Sbjct: 1762 GGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGG 1821 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 1822 EGMGAAGGGMGAGGEGGGAG 1841 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GGG GG GG G GGGG GG G GGGG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGG 1802 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/80 (35%), Positives = 29/80 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG GGG G GG G GG G GGG + Sbjct: 1760 GGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG---- 1815 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G G G G MG G Sbjct: 1816 GMGGGGEGMGAAGGGMGAGG 1835 Score = 44.0 bits (99), Expect = 2e-04 Identities = 29/83 (34%), Positives = 29/83 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG G G G G GG G G E Sbjct: 1766 GMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGE--- 1822 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G GG GE G G G Sbjct: 1823 -GMGAAGGGMGAGGEGGGAGGGG 1844 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G GG G G GGGG GG G GG G G G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGG 1800 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GG G GGG GG GG G G G GG G GGGG + + Sbjct: 1799 GGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGGGAGGGGGGYSAQK 1851 Score = 41.9 bits (94), Expect = 7e-04 Identities = 25/68 (36%), Positives = 25/68 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG GG G G G G GGGG G GG G G G A Sbjct: 1779 GMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGMGGGGEGMGAAGGGMGAGGEGG 1838 Query: 770 GXXGXXGG 747 G G GG Sbjct: 1839 GAGGGGGG 1846 Score = 35.9 bits (79), Expect = 0.048 Identities = 24/73 (32%), Positives = 26/73 (35%), Gaps = 1/73 (1%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GG GG GGG G GGG G G GGG + G G GG Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGG 1815 Query: 746 XVWLXGR-MGTXG 711 + G MG G Sbjct: 1816 GMGGGGEGMGAAG 1828 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 49.2 bits (112), Expect = 5e-06 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX-PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PPP PP P P PP P PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP----XXPPPXPXPPPXP 951 PPPP P PP PPPP PPP P PPP P PPP P Sbjct: 50 PPPPPPSPPAAAPAA---PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = +1 Query: 808 PPPPXPXP--PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P P P PPPP P PP PP P P P P P Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPP---PPLPAPPPPPAQPAPQPPPAP 109 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP--PXPPPPP 944 P PP P P P PP PPP P P P P P PPP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPP 107 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P PP P PP PPP P P PP PP Sbjct: 72 PAAPPPPAAPPAAPPPPPPLPAPP--PPPAQPAPQPPPAPP 110 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPX-----PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP P PP P P PPP P Sbjct: 62 PAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 808 PPPPXPXP--PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PPPP P P P PPPP P PPP PP P Sbjct: 75 PPPPAAPPAAPPPPPPLPAPPPPPAQPAPQ-PPPAPPHFLP 114 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P PP P PP P P PPP P P Sbjct: 82 PAAPPPPPPL------PAPPPPPAQPAPQPPPAPPHFLP 114 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 49.2 bits (112), Expect = 5e-06 Identities = 27/81 (33%), Positives = 32/81 (39%), Gaps = 1/81 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPP-PXXXXP 888 P +P++ + P P P L + PPPP PP P PPP P Sbjct: 681 PPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPP---PPPPGCAGLPPPPPSPQPGCA 737 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P Sbjct: 738 GLPPPPPPPPPGCAGLPPPPP 758 Score = 46.8 bits (106), Expect = 3e-05 Identities = 26/73 (35%), Positives = 29/73 (39%), Gaps = 7/73 (9%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPP--XPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 PP P P+ + + PPPP P PP PPPP PPP P P Sbjct: 677 PPPPPPLPV--IEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQP 734 Query: 922 -----PPXPXPPP 945 PP P PPP Sbjct: 735 GCAGLPPPPPPPP 747 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PPP PP P PP PPPPP Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPP 719 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXX-----PPPXPPPPXXPXPXPPXPPP 938 P P PP P PP P PPP PPPP PP PPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP----PXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P P PPPP P PPPPP Sbjct: 710 PMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P PP PPP PP P PPP Sbjct: 716 PPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPP 759 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 5/40 (12%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPP-----XPPPPXXPXPXPP 926 P PP PP P PPP PPPP P P Sbjct: 727 PPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVPMKP 766 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP + P P PP PPP P PP P P Sbjct: 726 PPPPPSPQPGCAGLPPP---PPPPPPGCAGLPPPPPPIDVP 763 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 49.2 bits (112), Expect = 5e-06 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG G G GGG G G G GGGG A G Sbjct: 36 GGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGA 95 Query: 764 XGXXGG 747 G GG Sbjct: 96 GGNVGG 101 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/67 (32%), Positives = 23/67 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G G GG G GG G G GG GG + Sbjct: 40 GGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNV 99 Query: 770 GXXGXXG 750 G G G Sbjct: 100 GGGGSGG 106 Score = 41.5 bits (93), Expect = 0.001 Identities = 29/83 (34%), Positives = 29/83 (34%), Gaps = 3/83 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG---GXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G G GG GG GG G GG G G GG G GGGG Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAA 88 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 G GG V G G G Sbjct: 89 GAAG--AGAGGNVGGGGSGGVGG 109 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG G GGG G GG G G GG G GG G GG Sbjct: 70 GGGAGNGGGGGGAGNGGAAGAAGAGAGG--NVGGGGSGGVGGNGG 112 Score = 37.1 bits (82), Expect = 0.021 Identities = 25/77 (32%), Positives = 25/77 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G G G GG G G Sbjct: 38 GVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGG 97 Query: 771 RGXGNXWGGCLVXGEDG 721 G GG V G G Sbjct: 98 NVGGGGSGG--VGGNGG 112 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 GG G GG G GGG GG G G GG G G + +D Sbjct: 62 GGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSGSDDDD 119 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GG GGG G GG GG G GG G G Sbjct: 69 GGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGGGSGGVGGNGGSG 114 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGGX 744 GG G GGG G GGG G G G G G N A G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGA 87 Query: 743 VWLXG 729 G Sbjct: 88 AGAAG 92 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 166 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/30 (66%), Positives = 20/30 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G GG G Sbjct: 139 GGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGG----GGGG-------GGGGGGGGGDG 168 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGGG GG G G GGGG G G G Sbjct: 147 GGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG GGG G G Sbjct: 147 GGGGGGGGGGGGGGGGGGGGDGDEDDDG 174 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 48.4 bits (110), Expect = 8e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P PP PPPP PPP PP P PPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P P PPP P PPPPP Sbjct: 660 PPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 37.9 bits (84), Expect = 0.012 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPPP P PPPPP Sbjct: 656 PEAGPPPPPPPPPGGQAGGAPPPPPPP 682 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P PPPP PPP PP P PPP P Sbjct: 656 PEAGPPPPP------PPPPGGQAGGAPPPPPPPLPGGAAPPPPPP 694 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 3/46 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP---XPPXPPPPP 944 P P P P PP P PP PPPP P P P PPPPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P + P PP PPP PPPP P PPPPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 45.6 bits (103), Expect = 6e-05 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP PPPP P PPP PP P PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPP 335 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +1 Query: 808 PPPPX----PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P PPPP P PPP PPP P P Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPP---PPPPPPGDGGAPPPPPPP 337 Score = 41.5 bits (93), Expect = 0.001 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PPPP P PPP PP PPP P Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 5/68 (7%) Frame = +1 Query: 757 IPXXPIFXLXAXRXTXXPPP-----PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 IP P PPP P P PP P PPPP PPP P Sbjct: 277 IPEVPDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPP-------PPPPPGDGG 329 Query: 922 PPXPXPPP 945 P P PPP Sbjct: 330 APPPPPPP 337 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 47.6 bits (108), Expect = 1e-05 Identities = 28/80 (35%), Positives = 30/80 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG GG GG G GGG G GG GGGG + Sbjct: 256 GGGGATGGGGGATGGGGGATGGGGGATGGGGGAT---GGGGGATGGGGGATGGGGGATGV 312 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G GG G +G G Sbjct: 313 GGGATGGGGGATGGGVGATG 332 Score = 46.4 bits (105), Expect = 3e-05 Identities = 25/68 (36%), Positives = 26/68 (38%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG GGG G GGG G GG G G G GGG A + Sbjct: 269 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGV 328 Query: 770 GXXGXXGG 747 G G GG Sbjct: 329 GATGGGGG 336 Score = 44.4 bits (100), Expect = 1e-04 Identities = 30/83 (36%), Positives = 30/83 (36%), Gaps = 3/83 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXR 780 G GG G GGG GG GG G G GGGG GG G GGG Sbjct: 277 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGG 336 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 G G GG G G G Sbjct: 337 ATGGGGGVTGGGGGATGGGGGPG 359 Score = 43.2 bits (97), Expect = 3e-04 Identities = 29/80 (36%), Positives = 30/80 (37%), Gaps = 3/80 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXX-GGGGXXXXXXXGXGGXGXG--GGGXNVXRXAXR 780 G GG G GGG GG GG G GGGG G G G G GGG Sbjct: 270 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVG 329 Query: 779 XKIGXXGXXGGXVWLXGRMG 720 G G GG + G G Sbjct: 330 ATGGGGGATGGGGGVTGGGG 349 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GG G GGG G GG GGGG Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGAT---GGGGGATGGGG 286 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/72 (34%), Positives = 26/72 (36%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG GGG G GGG G GG G G G GGG A G Sbjct: 243 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 764 XGXXGGXVWLXG 729 G GG + G Sbjct: 303 TGGGGGATGVGG 314 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/71 (38%), Positives = 27/71 (38%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXR 780 G GG G GGG GG GG G G GGGG GG G GGG V Sbjct: 291 GGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGG 350 Query: 779 XKIGXXGXXGG 747 G G G Sbjct: 351 ATGGGGGPGSG 361 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGG GG G GGGG GG G G G GG G G T Sbjct: 242 GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 289 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/47 (46%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG-GGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GGGG GG G G G GG G G G Sbjct: 318 GGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GG G G G GG GG GG G G G G GG G Sbjct: 319 GGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGGCG 364 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXG--GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 G G GG GG G GG G GGG GG G GGG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 767 XXGXXGG 747 G GG Sbjct: 299 GGGATGG 305 Score = 36.3 bits (80), Expect = 0.036 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GGG GGG GG GG GG G G G G G G G Sbjct: 284 GGGGATGGG--GGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGG 341 Query: 765 XGNXWGGCLVXGEDGDXGXKG 703 G GG G G G G Sbjct: 342 GGVTGGGGGATGGGGGPGSGG 362 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGG GG G GGGG G G G G Sbjct: 340 GGGGVTGGGGGATGGGGGPGSGGCGEDG 367 Score = 34.3 bits (75), Expect = 0.15 Identities = 30/102 (29%), Positives = 31/102 (30%), Gaps = 2/102 (1%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GGG GGG GG GG GG G G G G G G G Sbjct: 249 GGGGATGGG--GGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGG 306 Query: 765 XG--NXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G GG G G G T G + GGG Sbjct: 307 GGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGG 348 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GGGGG G G G GGG G G G G G + G G Sbjct: 339 GGGGGVTGGGGGAT-GGGGGPGSGGCGEDGTENVSLEFGSG 378 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G GGGG GG G G G GG G G T Sbjct: 228 GGSRLSNDRSNGRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGAT 275 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G G G GG GG G G GGGG G GG G G Sbjct: 327 GVGATGGGGGATGGGGGVTGGGGGATGGGG-----GPGSGGCGEDG 367 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 47.2 bits (107), Expect = 2e-05 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP PP PPPP P PP PP PPP PP P Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPM--PPQPPFMPPPPRMQPPGP 1280 Score = 45.2 bits (102), Expect = 8e-05 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPP-XXXXPXXPP--PXPPXXPPPXPXPPPXP 951 PPPP P P PPPP P PP P PP PP P PP P Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGP 1286 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXP---PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P P P P PP PPPP P PP PP PP Sbjct: 1239 PAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPP 1287 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP-PPXXPXP---XPPXPPPPP 944 P P PP PP P P PP PP P P PP PP PP Sbjct: 1235 PPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPP 1284 Score = 35.5 bits (78), Expect = 0.064 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 10/51 (19%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPP--------XPPPPXXPXPXPPXPP--PPP 944 P PP PP P PP PPPP P PP PP PPP Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPP 1272 Score = 34.3 bits (75), Expect = 0.15 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 3/46 (6%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPP---XPPXXPPPXPXPPPXP 951 P PP PPPP P PP PP P P PP P Sbjct: 1222 PRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-PPPXXXXPXXPPPXPPXXPPPXP-----XPPPXP 951 PP PP P PPP PP PP PP P PPP P Sbjct: 1204 PPTTAIPPPMTNTMTHSAPRPPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPP 1257 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +3 Query: 816 PXPXPPXTXXXXXPX--PPXPXXPPPXPP-PPXXPXPXP 923 P P P P PP P PP PP PP P P P Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 46.8 bits (106), Expect = 3e-05 Identities = 35/141 (24%), Positives = 39/141 (27%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 P P P PP +P A P P P T + Sbjct: 207 PMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASP 266 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P +P P N + P P P L P PP P P PP P Sbjct: 267 NPSIPPAPPNPSIPA--PPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYIP 324 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 PP PP P PP P Sbjct: 325 TAPPNPSIPPAPPNPSIPPAP 345 Score = 45.2 bits (102), Expect = 8e-05 Identities = 28/82 (34%), Positives = 31/82 (37%), Gaps = 2/82 (2%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXP 888 P +P+ P N PP P +F A PP PP P P P PP P Sbjct: 285 PSIPLAPPNPYIPPAPPN--LFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIP 342 Query: 889 XXPP-PXPPXXPPPXPXPPPXP 951 PP P P PP PP P Sbjct: 343 PAPPNPSIPPAPPNLFIPPATP 364 Score = 39.9 bits (89), Expect = 0.003 Identities = 40/148 (27%), Positives = 44/148 (29%), Gaps = 7/148 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFR--H 702 P P P PP +P A P P + P P S + Sbjct: 186 PTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIP-PAPPNPSKAIATPN 244 Query: 703 ALXPXVPILP--XNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPX 876 P P+ P N PP P I A P PP P P P PP Sbjct: 245 PPMPETPLPPATPNPFIPPASPNPSI--PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 877 XXXPXXP--PPXPPXXPPP-XPXPPPXP 951 P P P PP P P P PP P Sbjct: 303 LFIPSAPPNPHIPPAPPNPYIPTAPPNP 330 Score = 39.9 bits (89), Expect = 0.003 Identities = 21/61 (34%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPX-PPXTXXXXXPX-PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PY+ P + P P PP P PP P PP P P P P P PP Sbjct: 294 PYIPPAPPNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPNPSIPPA 353 Query: 942 P 944 P Sbjct: 354 P 354 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPX-TXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP + P PP P PP PP P P P PP P Sbjct: 163 PVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSP 218 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P P PP P P P P P P PP Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPP 283 Score = 36.3 bits (80), Expect = 0.036 Identities = 28/108 (25%), Positives = 32/108 (29%), Gaps = 8/108 (7%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP 831 P + P + + P P P PP P P + T P PP P Sbjct: 156 PTITSKPPVTETTTTKPETKPPKPPAPSTIPTPPTPPAPPSPPIP----TAPPTPPMPET 211 Query: 832 PXPXXXXXXXPPPPXXXXPXXPP--------PXPPXXPPPXPXPPPXP 951 P P P P P PP P PP P P P P Sbjct: 212 PLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNP 259 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXX--PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P A P P P P + P PP P P P P P P P PP P Sbjct: 177 PKPPAPSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAP 233 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 46.8 bits (106), Expect = 3e-05 Identities = 28/78 (35%), Positives = 29/78 (37%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P QT P +P P R T PP PP P PPPP P Sbjct: 921 PLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQV---PPPPL---PP 974 Query: 892 XPPPXPPXXPPPXPXPPP 945 PPP PP P PP Sbjct: 975 LPPPPPPVQTTTAPTLPP 992 Score = 46.0 bits (104), Expect = 4e-05 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P PP P P P PP PPPPP Sbjct: 898 PTTPKPTTPAPPPPLPLAPEPPPPLPPPPP 927 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 1/60 (1%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPX-PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P + P PP PPP P P P PP PPPPP Sbjct: 921 PLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPPIPATQVPPPPLPPLPPPPP 980 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PP P P P PPPP P PPP PP PP P P Sbjct: 890 TTTAPPTTPTTPKPTTPA---PPPPLPLAPEPPPPLPPPPPPIQTTRPTVP 937 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/37 (48%), Positives = 18/37 (48%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP T P P P PPP P P P P PP PPP Sbjct: 894 PPTTPTTPKPTTPAP--PPPLPLAPEPPPPLPPPPPP 928 Score = 40.7 bits (91), Expect = 0.002 Identities = 23/72 (31%), Positives = 23/72 (31%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P T PP P P T PPPP P P P PPP P P Sbjct: 888 PKTTTAPPTTPTTP------KPTTPAPPPPLPLAPEPPPPLPPPPPPIQTTRPTVPTTPT 941 Query: 910 PXXPPPXPXPPP 945 P PPP Sbjct: 942 TQASTTRPTPPP 953 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +3 Query: 831 PXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P T P P P PPPP P PP P PPP Sbjct: 888 PKTTTAPPTTPTTPKPTTPAPPPPLPLAPEPPPPLPPP 925 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 6/65 (9%) Frame = +1 Query: 712 PXVPILPXNQ------TXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 P VP P Q T PP P + A + P PP P PP P PP Sbjct: 934 PTVPTTPTTQASTTRPTPPPPTSALPP-PIPATQVPPPPLPPLPPPPPPVQTTTAPTLPP 992 Query: 874 XXXXP 888 P Sbjct: 993 ASCMP 997 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGGG GGG G GG G Sbjct: 761 GGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Score = 38.7 bits (86), Expect = 0.007 Identities = 23/66 (34%), Positives = 24/66 (36%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 G G GGG GG G G G GGGG G G G G G + K G Sbjct: 750 GYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGG 809 Query: 764 XGXXGG 747 G G Sbjct: 810 YGQGSG 815 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/44 (45%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 934 GGXGGX-GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GGGG GGG G G G GG G G G Sbjct: 749 GGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYGGGG 792 Score = 33.5 bits (73), Expect = 0.26 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 1/69 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG GGG GG G GG G G GG G +G + Sbjct: 766 GGGGGGYRGGGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYGQGSGGYN 825 Query: 771 RGXG-NXWG 748 R G N +G Sbjct: 826 RNTGYNTYG 834 Score = 31.1 bits (67), Expect = 1.4 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 2/62 (3%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGG--GGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 GG GG GGG G G G GG G GGGG G G Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGYG 789 Query: 752 GG 747 GG Sbjct: 790 GG 791 Score = 30.7 bits (66), Expect = 1.8 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G GGG G GG G GGG Sbjct: 730 GGRGGGGYGGGY-NDRRMQQGGYGNRSGGGYRGGGGYGGGGGGYRGGGGYGGGHRGGGGY 788 Query: 770 GXXGXXGG 747 G G GG Sbjct: 789 GGGGHRGG 796 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 7/84 (8%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXX-- 894 P P N T PP P L PP P P PPPP P Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 895 -PPPXPPXXPPP----XPXPPPXP 951 PPP PP PP P PPP P Sbjct: 370 GPPPPPPGRRPPSGKINPPPPPPP 393 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP------PPPP 944 P PP P PP PPP PPP P PP P PPPP Sbjct: 299 PLPPSRDQAPAPPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPP 344 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP PP P PP P PPP PPP P P Sbjct: 281 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPP P PPPP Sbjct: 318 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 360 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 GGGGG G G G GGGG GG Sbjct: 76 GGGGGFSGGGGGSMGGGGLGG 96 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPX 891 P P PP P F PPPP P P PPPP P Sbjct: 166 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 225 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 PP P P P P Sbjct: 226 QRSLAPPPTGSSRPLPAPPP 245 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP + P PP PP PPP P PPP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 233 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PPPP P P PP P PPP Sbjct: 301 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPP PP P PPPP P PPP P P P Sbjct: 130 TTAPPPKNSSPPPPFGA----PPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 176 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP P PPP PPPP P PPP Sbjct: 2 PPPP--PPPGPPPPPSAPSGPVKPPP 25 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P P PPPP P PP PPP P Sbjct: 357 PPPPPGRAPQPLGGP---PPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPP 926 P PP P PPP P P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPP 941 P PPP PPP P P PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPPP 25 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXP--XXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 R PPP PP P PPPP P PP PPP P P Sbjct: 238 RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNPPPPPTRGP 288 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPX--PXPPXPPPPP 944 P PP P PP P PPPP P PP PP Sbjct: 308 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 350 Score = 31.9 bits (69), Expect = 0.78 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP PPP P P P Sbjct: 2 PPPPPPPGPPPPPSAPSGP 20 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP PP P P P PP P PPP P Sbjct: 140 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKP--PPPSGNKP 182 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP P PP P P PP PP Sbjct: 245 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 289 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 808 PPPPX--PXPPXPXXXXXXXPP---PPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P PP PP PP PP PP PPP Sbjct: 263 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 313 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +1 Query: 808 PPP-----PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P PP PPP P P P PP P P Sbjct: 207 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 257 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 9/57 (15%) Frame = +1 Query: 808 PPPPXPXP------PXPXXXXXXXPPPPXXXXPXXPP---PXPPXXPPPXPXPPPXP 951 PPPP P P P P PP PP P PPP PP P Sbjct: 217 PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 273 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P PP P P PP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVKPP 24 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 PPPP P PP PPP P PPP Sbjct: 3 PPPPPPGPP---------PPPSAPSGPVKPPP 25 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P PP PP PP P PPP Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPPP 25 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXP 591 PPP PP PPP P P Sbjct: 3 PPPPPPGPPPPPSAPSGPVKP 23 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PPP P PP PPP Sbjct: 454 PRPASSSRGAPPPVPPSRGPPPPPP 478 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP PP P PPPP P PPP Sbjct: 195 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 233 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXP 939 P P PPP PP PP P P Sbjct: 454 PRPASSSRGAPPPVPPSRGPPPPPP 478 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 45.6 bits (103), Expect = 6e-05 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 7/84 (8%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXX-- 894 P P N T PP P L PP P P PPPP P Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 895 -PPPXPPXXPPP----XPXPPPXP 951 PPP PP PP P PPP P Sbjct: 282 GPPPPPPGRRPPSGKINPPPPPPP 305 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 6/47 (12%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP------PPPP 944 P PP P PP PPP PPP P PP P PPPP Sbjct: 211 PLPPSRDQAPAPPPPLNATPPP-PPPSRDQVPLPPPPLRGQIAPPPP 256 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP PP P PP P PPP PPP P P Sbjct: 193 PPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPP P PPPP Sbjct: 230 PPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPP 272 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/80 (28%), Positives = 23/80 (28%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPX 891 P P PP P F PPPP P P PPPP P Sbjct: 78 PPPPPMGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSGPPPPPPGRGPS 137 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 PP P P P P Sbjct: 138 QRSLAPPPTGSSRPLPAPPP 157 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP + P PP PP PPP P PPP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 145 Score = 35.5 bits (78), Expect = 0.064 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PPPP P P PP P PPP Sbjct: 213 PPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPP PP P PPPP P PPP P P P Sbjct: 42 TTAPPPKNSSPPPPFGA----PPPPDRGGQLAKKPSQGSFPPPPPMGKPPP 88 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P P PPPP P PP PPP P Sbjct: 269 PPPPPGRAPQPLGGP---PPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXP--XXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 R PPP PP P PPPP P PP PPP P P Sbjct: 150 RPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPP--PPKRGSSNPPPPPTRGP 200 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPX--PXPPXPPPPP 944 P PP P PP P PPPP P PP PP Sbjct: 220 PAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPP 262 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP PP P P P PP P PPP P Sbjct: 52 PPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKP--PPPSGNKP 94 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP P PP P P PP PP Sbjct: 157 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPP 201 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 808 PPPPX--PXPPXPXXXXXXXPP---PPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P PP PP PP PP PP PPP Sbjct: 175 PPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPP 225 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 5/51 (9%) Frame = +1 Query: 808 PPP-----PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P PP PPP P P P PP P P Sbjct: 119 PPPERSSGPPPPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGP 169 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 9/57 (15%) Frame = +1 Query: 808 PPPPXPXP------PXPXXXXXXXPPPPXXXXPXXPP---PXPPXXPPPXPXPPPXP 951 PPPP P P P P PP PP P PPP PP P Sbjct: 129 PPPPGRGPSQRSLAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPP 185 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PPP P PP PPP Sbjct: 366 PRPASSSRGAPPPVPPSRGPPPPPP 390 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP PP P PPPP P PPP Sbjct: 107 PPPPHSRHGSAPPPPERSSGPPPPPPGRGPSQRSLAPPP 145 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXP 939 P P PPP PP PP P P Sbjct: 366 PRPASSSRGAPPPVPPSRGPPPPPP 390 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G GGG G GG G G GG G G GG Sbjct: 142 GAGGGIGRGGGR--GRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGG 187 Score = 43.6 bits (98), Expect = 2e-04 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G G GG G G GG G G G GG G R + Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTGGGSRGGGGDGRGRGRGGTEER 207 Query: 773 IGXXGXXGG 747 G G Sbjct: 208 TRIEGYGSG 216 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/78 (37%), Positives = 29/78 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G GGG G G G G GG G G GG R Sbjct: 128 GRGGWRGRGGGEGNGAGGG-IGRGGGRGRGGGEGGWGGRGGNGGGRGGGEGGGGRGRGTG 186 Query: 770 GXXGXXGGXVWLXGRMGT 717 G GG GR GT Sbjct: 187 GGSRGGGGDGRGRGRGGT 204 Score = 39.1 bits (87), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG G G G GGG G GG G GGG Sbjct: 127 GGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRGGNGGG 171 Score = 38.3 bits (85), Expect = 0.009 Identities = 23/56 (41%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 G GGG G G G G GG G GG G GG G GG G G G + G Sbjct: 142 GAGGGIGRGGGRGRGGGEGGWGGRGGNGG-GRGGGEGGGGRGRGTGGGSRGGGGDG 196 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G GGG G G G G G G G G G Sbjct: 122 GGVQRGGRGGWRGRGGGEGNGAGGGIGRGGGRGRGGGEGGWGGRG 166 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 45.2 bits (102), Expect = 8e-05 Identities = 21/45 (46%), Positives = 21/45 (46%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG GGG G G G G GG G GG G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDG 85 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/47 (51%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG-GXGXXXXXVXGGXGXGXXG 806 GGGGG GG G GGGG GGG G G G G GG G G G Sbjct: 41 GGGGGGGGGG----GGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G G GG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDG 87 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG G G G GGGG G GG G G G Sbjct: 49 GGGGGGGGGGGDGDGDGDGDANANADGGGG------GGGGGDGDGDG 89 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 45.2 bits (102), Expect = 8e-05 Identities = 26/79 (32%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPP--PPXPXPPXPXXXXXXXPPPPXXXXPXX 894 P P T PP P P PP P P PP P PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQ 206 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP PP PP P Sbjct: 207 PPPIPPIDPPRTQPPPIFP 225 Score = 40.7 bits (91), Expect = 0.002 Identities = 25/75 (33%), Positives = 27/75 (36%), Gaps = 1/75 (1%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P + PP PIF + R T PP P PP PP P PP P Sbjct: 157 PISPIDPPRTQPPPIFPIDPPR-TQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 215 Query: 910 P-XXPPPXPXPPPXP 951 P PPP P P Sbjct: 216 PRTQPPPIFPQPTTP 230 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP P P P PP PPP P P PPP Sbjct: 181 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 222 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P PP P P P PP PPP P P P P Sbjct: 194 PPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQPTTPAP 232 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXX 885 L P PI P PP P P PP P P P PPP Sbjct: 155 LPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPID 214 Query: 886 PXXPPPXPPXXPPPXPXP 939 P P P P P P Sbjct: 215 PPRTQPPPIFPQPTTPAP 232 Score = 36.7 bits (81), Expect = 0.028 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = +1 Query: 799 TXXPPPPXPXPP-XPXXXXXXXPPP--PXXXXPXXPPPXPPXXPP---PXPXPPPXP 951 T P P PP P PPP P PPP PP PP P P PP P Sbjct: 146 TPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 2/61 (3%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP--P 941 P + P A P PP T P PP PP P PP PP P Sbjct: 143 PVMTPTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDP 202 Query: 942 P 944 P Sbjct: 203 P 203 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 44.8 bits (101), Expect = 1e-04 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P P P P PP P PP P PP P PPP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAP 208 Score = 38.3 bits (85), Expect = 0.009 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXX-PXPXPPXPPPPP 944 P P P P P PP P P P PP P PP PP PP Sbjct: 164 PPAP-PAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPX--PXPPPXP 951 PP P PP PP P PP PP PP P PP P Sbjct: 161 PPQPPAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P PP P P P PPPPP Sbjct: 161 PPQP-PAPPAAPFMAPAAPPAPPPPGAPAAPPAPPFGGP-PSAPPPPP 206 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 A + P P PP P PP P PPPP P Sbjct: 170 APFMAPAAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P P PP PP Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAAPPAPP 182 Score = 28.7 bits (61), Expect = 7.3 Identities = 20/67 (29%), Positives = 21/67 (31%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P + PP P P A PP P PP PP P P P Sbjct: 155 PSIASQPPQPPAPPAAPFMAPAA--------PPAPPPP----GAPAAPPAPPFGGPPSAP 202 Query: 901 PXPPXXP 921 P PP P Sbjct: 203 PPPPAPP 209 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 44.0 bits (99), Expect = 2e-04 Identities = 17/26 (65%), Positives = 17/26 (65%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PPP PPPP P P PP PPPP Sbjct: 862 PRPRRPPPPPPPP--PPPPPPPPPPP 885 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P PP PPP PP PPP P PP Sbjct: 860 PRPR-PRRPPPPPPPPPPPPPPPPPPP 885 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P PPP PP PPP P PPP P Sbjct: 864 PRRPPPPPPPPPPPPPPPPPPP 885 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PP PPP P PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP 882 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP PPP P PPP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPP 881 Score = 31.9 bits (69), Expect = 0.78 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPP 899 P P P PP P PPP PPP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +1 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P PPPP PPP PP PPP Sbjct: 860 PRPRPRRPPPPPPP------PPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 P P P PP P PPPP P PPP PP Sbjct: 862 PRPRRPPPPPP-------PPPP----PPPPPPPPP 885 >SB_17289| Best HMM Match : GRP (HMM E-Value=0.00022) Length = 131 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG 863 GGGGG GG G G GGGG GGG G G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDG 79 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/29 (65%), Positives = 19/29 (65%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGGG GGG G GG G Sbjct: 53 GGGGGGGGGGG--GGGGGGGGGGGGGGDG 79 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G Sbjct: 55 GGGGGGGGGGGGGGGGGGGGGGGDGDDDDG 84 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG GGG GG G Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGG 77 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GGG GG GGG G GGGG G GG V Sbjct: 53 GGGGGGGGGGGGGGGGGGGGGGGGGDGDDDDGDDDDDDDDGGDAV 97 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 44.0 bits (99), Expect = 2e-04 Identities = 19/40 (47%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXX--PPPXPPPPXXPXPXPPXPPPP 941 PP P PP PPP PPPP P PP PPPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P PPP P PPP P P P PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPPGGGVPGPPKPPP 682 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 P PP PPPP P P P PP Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 P PP P PP P P PP P P Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPP 683 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 4/44 (9%) Frame = +1 Query: 808 PPPPX----PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P PP PPPP P P PP PPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPP----PGGGVPGPPKPPPP 683 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 43.6 bits (98), Expect = 2e-04 Identities = 28/82 (34%), Positives = 28/82 (34%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG--XGGGGXNVXRXAXRX 777 G GG G GG GG GG G GGGG GG G GGGG Sbjct: 38 GHGGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGAT 97 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G GG G G G Sbjct: 98 GGGGGATGGGGGATGGHGGATG 119 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/69 (37%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGX-GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG GG GG G G G G G G GGG A Sbjct: 63 GGGGGATGGGGGATGGHGGATGGGGGATGDG-GGATGGGGGATGGGGGATGGHGGATGGG 121 Query: 773 IGXXGXXGG 747 +G G GG Sbjct: 122 VGATGGHGG 130 Score = 41.1 bits (92), Expect = 0.001 Identities = 28/75 (37%), Positives = 28/75 (37%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GG G GGG GG GG G GGG G GG G GGG G Sbjct: 59 GGATGGGGGATGGGGGATGGHGGATGGGGGAT---GDGG-GATGGGGGATGGGGGATGGH 114 Query: 764 XGXXGGXVWLXGRMG 720 G GG V G G Sbjct: 115 GGATGGGVGATGGHG 129 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGG GG G GGGG GG G G G GG G G T Sbjct: 93 GGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGAT 139 Score = 38.7 bits (86), Expect = 0.007 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGX-GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG GG GGG G GG G G G GG A Sbjct: 84 GGGGGATGDGGGATGG-GGGATGGGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGH 142 Query: 773 IGXXGXXGG 747 G G GG Sbjct: 143 GGATGGGGG 151 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGX-GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG GG GG G GGG G G G GG A Sbjct: 91 GDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG-GATGGHGGATGGHGGATGGG 149 Query: 773 IGXXGXXGG 747 G G GG Sbjct: 150 GGATGGGGG 158 Score = 37.5 bits (83), Expect = 0.016 Identities = 27/72 (37%), Positives = 27/72 (37%), Gaps = 4/72 (5%) Frame = -2 Query: 950 GXGGGX-GXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAX 783 G GGG G GG GG GG G G GGGG GG G GGG Sbjct: 70 GGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHG 129 Query: 782 RXKIGXXGXXGG 747 G G GG Sbjct: 130 GATGGHGGATGG 141 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG G GG GG G GG GGGG Sbjct: 119 GGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGGG 164 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG G GGG GG GG GG G G Sbjct: 141 GHGGATGGGGGATGGGGGATGGGGGATG 168 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GG G GG GG GG G GGG G GG GG Sbjct: 127 GHGGATGGHGGATGGHGGATGGGGGATGGG---GGATGGGGGATGG 169 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG GG GG GG G G G Sbjct: 134 GHGGATGGHGGATGGGGGATGGGGGATGGG 163 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGG 807 G GG G G G GG GG G GG G GG G GGG Sbjct: 113 GHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGGGGATGGGGGATGGG 163 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GG G GGG GG GG GG Sbjct: 148 GGGGATGGGGGATGGGGGATGG 169 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = -1 Query: 945 GGGXGX--GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 GGG GGG GG GG GG G G G GG G Sbjct: 64 GGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGG 109 Score = 31.9 bits (69), Expect = 0.78 Identities = 30/104 (28%), Positives = 31/104 (29%), Gaps = 2/104 (1%) Frame = -1 Query: 951 GXGGGXG--XGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEX 778 G GG G GGG GG GG GG G G G G G G Sbjct: 48 GATGGGGGATGGGATGGGGGATGG--GGGATGGHGGATGGGGGATGDGGGATGGGGGATG 105 Query: 777 EDRGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G GG G G G T G + GGG Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGGATGGHGGATGGHGGATGGG 149 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/45 (46%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPX--PXPPXPPPPP 944 P P PP T P P P PPPP P P PP PPPPP Sbjct: 280 PPPPPPLTGGMLPP--PFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXPPPXPXPPPXP 951 R T P PP P PPP PPP P P P P PPP P Sbjct: 269 RYTNTQRPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +1 Query: 793 RXTXXPPPPXPXP----PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 R T PPPP P P P PPP P P PP PP P Sbjct: 275 RPTSQPPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PPP P PP PPPPP Sbjct: 212 PVNPPEPDYLEPTPPPPAAPAPPPPPAAAP---PPPPPPPP 249 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PP P P P PPPP P PPP PP P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP---XPXPPPXP 951 P P PP P P PPP P PPP P PPP P Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P PPP P P PP PPP P P Sbjct: 215 PPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P PPPP P PP PPPP Sbjct: 212 PVNPPEPDYLEPTPPPPAA----PAPPPPPAAAPPPPPPPPP 249 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P PP P PP PPP PPPP Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPP 249 Score = 34.7 bits (76), Expect = 0.11 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 A V P P P P PP P P PPPP P P Sbjct: 210 ATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P PPP PPP Sbjct: 200 PSAAAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPP 243 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP-----XXPPPXPXPPPXP 951 PPPP P P PPPP PPP PP PPP PP P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 R + PPPP P P PPP P PPP P PPP P P Sbjct: 333 RSSQRPPPPSRGAPPPPSMGMA-PPPVGGAAPPPPPPPPVGGPPPPPPP 380 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP----PXPPPPP 944 PP P PP P PP PPPP P P PPPPP Sbjct: 356 PPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 41.1 bits (92), Expect = 0.001 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 4/59 (6%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP----PPPP 944 P A P P PP + P PP P PPPP PP P PPPP Sbjct: 291 PSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 40.3 bits (90), Expect = 0.002 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPX---IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 P P +Q PP P P + PPP P PP PPPP Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPV---GGPPPPPPPIEG 383 Query: 883 XPXXPPPXPPXXPPPXPX-PPPXP 951 P PP PPP PPP P Sbjct: 384 RPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 39.9 bits (89), Expect = 0.003 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 15/68 (22%) Frame = +1 Query: 793 RXTXXPPPPX-----PXPPXPXXXXXXXPPPPXXXXP-----XXPPP-----XPPXXPPP 927 R + PPPP P PP P PPP P PPP PP PPP Sbjct: 311 RGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Query: 928 XPXPPPXP 951 PPP P Sbjct: 371 VGGPPPPP 378 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPP---XPPPPXXPXPXPPXPPPP 941 P P PP P P PPP PPP PP PPPP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 37.9 bits (84), Expect = 0.012 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P P PP P PPP PPP P P Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PPPPX----PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP PPPP PPP PPP P P Sbjct: 306 PPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPP 357 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 5/71 (7%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXP-XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PP P R PPP PP P PPPP PP P P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAP 346 Query: 925 PXP----XPPP 945 P P PPP Sbjct: 347 PPPSMGMAPPP 357 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPP-----PXPPPPXXPXPXPPXPPPP 941 P P PP P PP PP P PPPP PP P P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIP 410 Score = 35.1 bits (77), Expect = 0.084 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXP----PPPXXPXPXPPXPPPPP 944 P PP + P PP PP P PP PP PPPPP Sbjct: 327 PPPPPSRSSQRPPPPS-RGAPPPPSMGMAPPPVGGAAPPPPPPPP 370 Score = 30.7 bits (66), Expect = 1.8 Identities = 33/136 (24%), Positives = 35/136 (25%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXTXXLIXQISSC 704 PPPP PS RG+P GS P P PPP P S Sbjct: 287 PPPPPSRGAAPPPPS---RGAPPPPPSRGSAPPPPPARMGTAPPPPPP---------SRS 334 Query: 705 XXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPP 884 P + P P PP P PP Sbjct: 335 SQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPP 394 Query: 885 PXPPPPXXPXPXPPXP 932 P PP P P P P Sbjct: 395 PPPPGRGAPPPGPMIP 410 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +1 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPX-----PPPXP 951 P P PPPP P PPP PPP P PPP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPP-PPPSRGSAPPPPPARMGTAPPPPP 330 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GGGG G G G GG G GG G G Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDG 119 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G G GG GG GGG G GGGG G G G GG N Sbjct: 74 GGGDTDGGGGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDN 123 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GGG G GGG GG GGG G GG G G G Sbjct: 83 GCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GG G G GGGG GGG G G G G Sbjct: 85 GGGGGGGGGVGG-GGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 43.2 bits (97), Expect = 3e-04 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 11/50 (22%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPP-----------XXPXPXPPXPPPPP 944 PP P PP P PPP PPPP P PP PPPPP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPP 145 Score = 41.9 bits (94), Expect = 7e-04 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P PP P P P PP PPP P PP Sbjct: 107 PPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P P PP PPPPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPP 117 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Frame = +2 Query: 863 PXPXXPXXPPX---PPPXPPXXPPPXPXPPP 946 P P PP PPP PP PPP P PPP Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +2 Query: 890 PXPPPXPPXXPPPXPXPPP 946 P PPP PP PPP P PPP Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 38.3 bits (85), Expect = 0.009 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP PPP P PPP P Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/80 (28%), Positives = 25/80 (31%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P PP I + + PPPP P PP P Sbjct: 106 PPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLH 165 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 PP PP P P P P P Sbjct: 166 ASPPGPPPAPMPAPPPMVVP 185 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PP PPP P PPP P Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAP 148 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 871 PXXXXPXXPP----PXPPXXPPPXPXPPPXP 951 P P PP P PP PPP P PPP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP 118 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPP 928 P PP P P PP PPP P PP Sbjct: 115 PPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 29.1 bits (62), Expect = 5.5 Identities = 26/108 (24%), Positives = 29/108 (26%), Gaps = 4/108 (3%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFR--- 699 PPP PP PPP P + P C P + Sbjct: 104 PPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQ 163 Query: 700 -HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP 840 HA P P P PP + P T PPP P P Sbjct: 164 LHASPPGPPPAPM-PAPPPMV--VPSHRHVFHHVTHPAPPPMQMAPAP 208 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXP 940 PP PPP P PPP P Sbjct: 168 PPGPPPAPMPAPPPMVVP 185 Score = 27.9 bits (59), Expect(2) = 1.4 Identities = 20/82 (24%), Positives = 24/82 (29%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H + P P P P P + + + PP P P P P P Sbjct: 132 HVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQLHASPPGPPP-APMPAPPPMVVPSHRHV 190 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 P PP P P PP Sbjct: 191 FHHVTHPAPPPMQMAPAPCMPP 212 Score = 21.8 bits (44), Expect(2) = 1.4 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 Query: 535 PXPPXPPPXXXVPXAXXXP 591 P PP PPP P P Sbjct: 102 PPPPPPPPPPPPPPPPPPP 120 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPPP P PPP PPP PP P PPP P Sbjct: 279 TPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/56 (37%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Frame = +1 Query: 787 AXRXTXXPPPPXPXPPXP----XXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 A + PPPP P P PPPP P PPP P PP P PP Sbjct: 274 ASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP----XPPXPXXXXXXXPPPP 873 P +P N T PP P PPPP P PP P PPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 Score = 29.9 bits (64), Expect = 3.2 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 19/58 (32%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPP-------------PXPPPP--XXPXPXPPXP----PPPP 944 PP PP P PP P PPPP P P PP P PPPP Sbjct: 269 PPIPSASQNATPPPPPPPPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPP 326 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG GG GGG G GGG G GG G GGGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGG-----YGGGHGGGGYGGGG 233 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/47 (48%), Positives = 23/47 (48%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GGGG GG GGG Sbjct: 201 GYGGGSG-GGGYGGGRGGGGYG-GGHGGGGYGGGGRHDYGGGSKGGG 245 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG G GG G GG G GG G G Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGG 232 Score = 41.1 bits (92), Expect = 0.001 Identities = 24/67 (35%), Positives = 24/67 (35%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG-GXNVXRXAXRXKIG 768 GGG GGG G GG GGG G GG G GGG G R G Sbjct: 179 GGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYG 238 Query: 767 XXGXXGG 747 GG Sbjct: 239 GGSKGGG 245 Score = 40.7 bits (91), Expect = 0.002 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GGG GG G G GGG GG G GG G GG G Sbjct: 201 GYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGGSKG 243 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG G G G GGG GG G G G GG G G G Sbjct: 176 GDSGGGGSQGGGYRSGGGGYGGSKGGYGGGSGGGGYGGGRGGGGYG 221 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 GG G GGG GG G G G GGGG GG G GG Sbjct: 100 GGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGGG 142 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG 822 G GGG G GGG GG GGG GGGG G GG G Sbjct: 101 GRGGGGGYGGG--GGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -3 Query: 943 GGGG----GXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G GGGG GGG GG G G G G Sbjct: 92 GGGGRRERGGRGGGGGYGGGGGYGGGGRSYGGGGGGGGFYQDSYGGGGGG 141 Score = 34.7 bits (76), Expect = 0.11 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG 822 G GGG G GGG GG G G GGGG G GG G Sbjct: 103 GGGGGYGGGGGY-GGGGRSYGG--GGGGGGFYQDSYGGGGGGG 142 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 GGGGG GG GGGG GG Sbjct: 122 GGGGGGGGFYQDSYGGGGGGG 142 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 42.7 bits (96), Expect = 4e-04 Identities = 30/81 (37%), Positives = 30/81 (37%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG-GXNVXRXAXRXK 774 G G G G G G GG G G G G GG G G G GGG G R Sbjct: 17 GQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGGMGRGP 76 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G G G W GRM G Sbjct: 77 GGGLGRGPGGGW--GRMQEGG 95 Score = 35.5 bits (78), Expect = 0.064 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G G G GGG G GGG G GG G G G G G G N Sbjct: 69 GGGMGRGPGGGLGRGPGGG-WGRMQEGGMGRGPGQGWGCRGMGCGWGCGN 117 Score = 33.5 bits (73), Expect = 0.26 Identities = 30/86 (34%), Positives = 31/86 (36%), Gaps = 6/86 (6%) Frame = -1 Query: 951 GXGG-GXGXGGGXXGGXGGGXG-GXXGXXGXGXXXXXXXXXXGXGG--XGXXXXRXXRG- 787 G GG G G GGG G GGG G G G G G G G G R G Sbjct: 4 GPGGWGRGSGGGWGQGPGGGWGRGQGGGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGG 63 Query: 786 -XEXEDRGXGNXWGGCLVXGEDGDXG 712 + G G GG L G G G Sbjct: 64 WGRMQGGGMGRGPGGGLGRGPGGGWG 89 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGX--GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGG 807 G GGG G GGG G GGG G GG G G G G G G G Sbjct: 59 GPGGGWGRMQGGGMGRGPGGG-LGRGPGGGWGRMQEGGMGRGPGQGWGCRG 108 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/51 (41%), Positives = 21/51 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GGG G GGG GG GGG G G G G G G G V Sbjct: 308 GGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDGDGDGDDGWGV 358 Score = 41.5 bits (93), Expect = 0.001 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G G GGG GG GGG G GGG G G G G Sbjct: 302 GDGDGDGGGGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG 348 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GGG GGG G G G GG G G Sbjct: 99 GGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGG 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G G GG GG GGG Sbjct: 110 GYGGGRG-GGGYGGGRGGGGYG---GGRGGGYGGGRRDYGGGSKGGG 152 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GGG GG G G GGG GG G G G G G G Sbjct: 110 GYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGG 152 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXG-GXGXXXXXVXGGXGXGXXG 806 GG GG G G GG GGG G G G G GG G G G Sbjct: 94 GGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGG 139 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGG 810 G G G GG GG GGG G GGG G G G GGG Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGG 147 Score = 35.1 bits (77), Expect = 0.084 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GG GG G G GGG G GG G GGG Sbjct: 89 GGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGG 132 Score = 33.9 bits (74), Expect = 0.19 Identities = 23/67 (34%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXG-GGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 G G GG G GGG G G GGG G G G GGG R G Sbjct: 87 GAGGSRAGGYRSG-GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYG 145 Query: 767 XXGXXGG 747 GG Sbjct: 146 GGSKGGG 152 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G GGGG GG G G G GG G G G Sbjct: 87 GAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGYG 130 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GG GG G G GG G G G GGGG Sbjct: 84 GERGAGGSRAGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGG 128 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 42.3 bits (95), Expect = 6e-04 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 A V P P PP P PP PP PPPP P PP PP Sbjct: 545 APAVTPSEEPPPPPPGVDIPPPLPPSEDPKPP-PPPPEPPEECPPPPP 591 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PP P P PPPP P P PPPPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPPP-PEPPEECPPPPP 591 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P T P PP PP PP P P PP P PP Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P P P PPP PP P P PPP Sbjct: 554 PPPPPPG------VDIPPPLPPSEDPKPPPPPPEPPEECPPPPP 591 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PPP PPP PP P P PPP P Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEP 582 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P PPP P PP P PPP P PP Sbjct: 540 PIPAVAPAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 35.5 bits (78), Expect = 0.064 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P PP P PP P P PPP P PP PPP Sbjct: 550 PSEEPPPPPPGVDIPPPLPPSEDPKPPPP--PPEPPEECPPPP 590 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P + P P P P P PP P P PPPP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPP 590 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 41.9 bits (94), Expect = 7e-04 Identities = 29/94 (30%), Positives = 33/94 (35%), Gaps = 10/94 (10%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H L P + + + PP IP P+ L PPPP PP PPP Sbjct: 208 HQLFADAPPIQTSTSLPPMIP--PVGML-GHPPMGAPPPPHSMPPPGMPPPGMMPPPGFP 264 Query: 880 XX----------PXXPPPXPPXXPPPXPXPPPXP 951 P PPP PP PP PP P Sbjct: 265 PMGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPP 298 Score = 35.5 bits (78), Expect = 0.064 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PP P PPP PP P P PPPP Sbjct: 260 PPGFPPMGMPGMGGMPP-PGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPP-PXPPXXPPPXPXPP 943 P P P P P P PP PP PP P P PP Sbjct: 259 PPPGFPPMGMPGMGGMPPPGMP--PPMPPGGMPPNMEQPPPPPP 300 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 41.9 bits (94), Expect = 7e-04 Identities = 21/46 (45%), Positives = 21/46 (45%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G GG G G GGGG GGG GG G GG G G Sbjct: 437 GVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDG 482 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G G GGG GG G G G GG G G G GGG Sbjct: 439 GDGRG-GDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGGG 484 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG GG G G Sbjct: 454 GDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G GG GG G GGG G G G GGG Sbjct: 433 GCSSGVGDGRGGDGGGDGGGGGD----GGGDGIDGGDGGGDGGGDGGG 476 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 11/56 (19%) Frame = -2 Query: 944 GGGXGXG-----------GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG G G GG GGG G GGG G G G GGG Sbjct: 421 GGGRDDGDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGG 476 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G G G GGGG G G GGG Sbjct: 427 GDGDSDGCSSGVGDGRGGDGGGDGGGGGDGGGDGIDGGDGGGDGGG 472 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G GGG GG GG G GGGG G GG G GGG N Sbjct: 65 GDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDGGGGGDGGGGN 113 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = -2 Query: 950 GXGGGXGXGG-----GXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGG 807 G GGG G G G G GGG G GGG G G GG G GGG Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 105 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Frame = -3 Query: 943 GGGGGXGGX----GXGXXG--GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G G GGG GGG G GG G G G G G Sbjct: 52 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 103 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGGGGXGGGXXGXGG 860 GGGGG G G G G GGGG GGG G Sbjct: 89 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G G G G GG G GG G GGGG Sbjct: 49 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCD----GGGGDGDGGGG 92 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G G GGG GG G GG G G Sbjct: 73 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 117 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 41.5 bits (93), Expect = 0.001 Identities = 22/50 (44%), Positives = 22/50 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G GGG GG GG G GGGG G GG G GGG N Sbjct: 80 GDGNVGDDGGGDGGGCDGGG-GDGDGGGGGDGDGGGGGDGGGGGDGGGGN 128 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/54 (42%), Positives = 23/54 (42%), Gaps = 6/54 (11%) Frame = -2 Query: 950 GXGGGXGXGG-----GXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGG 807 G GGG G G G G GGG G GGG G G GG G GGG Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGG 120 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/52 (44%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Frame = -3 Query: 943 GGGGGXGGX----GXGXXG--GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G G GGG GGG G GG G G G G G Sbjct: 67 GGGGGDGDGDDDDGDGNVGDDGGGDGGGCDGGGGDGDGGGGGDGDGGGGGDG 118 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGGGGXGGGXXGXGG 860 GGGGG G G G G GGGG GGG G Sbjct: 104 GGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 Score = 35.9 bits (79), Expect = 0.048 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G G G G GG G GG G GGGG Sbjct: 64 GDGGGGGGDGDGDDDDGDGNVGDDGGGDGGGCD----GGGGDGDGGGG 107 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G G GGG GG G GG G G Sbjct: 88 GGGDGGGCDGGGGDGDGGGGGDGDGGGGGDGGGGGDGGGGNDDDG 132 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P PP P PP PP P P PPP P Sbjct: 398 PGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 2/56 (3%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXX--PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P + P P P PP P P P PPPP P PP PPPP Sbjct: 389 PWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIP--PPPPGFPQFQPPPPPPP 442 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P PP P P P P PPP P PP P PP Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPP PP P PPPP PPP P P Sbjct: 322 PPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKP 362 Score = 32.7 bits (71), Expect = 0.45 Identities = 22/77 (28%), Positives = 24/77 (31%), Gaps = 5/77 (6%) Frame = +1 Query: 727 LPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP---PXPXXXXXXXPPPPXXXXPXXP 897 L + PP P A + PPPP P P P PPP P Sbjct: 301 LGVGEAPPPPAASEPAAFAPAPPPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGP 360 Query: 898 PP--XPPXXPPPXPXPP 942 P P PP PP Sbjct: 361 KPLMSTPVQRPPGMRPP 377 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPPP P PP P PPP P Sbjct: 386 PPPPWSKP----GGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPP 429 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 8/47 (17%) Frame = +1 Query: 808 PPPPXPX--------PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PPPP P PP PPPP PPP PP P Sbjct: 400 PPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PP PPP P PPP P Sbjct: 307 PPPPAASE---PAAFAPAPPPSQAPPPPKTIPSTLPPPPVP 344 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXP---XXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP T P PP P PPP P P P P Sbjct: 323 PPSQAPPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRP 371 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 41.1 bits (92), Expect = 0.001 Identities = 38/144 (26%), Positives = 40/144 (27%), Gaps = 3/144 (2%) Frame = +1 Query: 529 PPPXPPXPP-PXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHA 705 PPP P P P P P G P P P H Sbjct: 442 PPPGAPHPRVPPPGAPHPRVPP--PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQ 499 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXX 882 P P P + PP P + A PP P P P P PPP Sbjct: 500 RVPP-PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASH 558 Query: 883 XPXXPPPXP-PXXPPPXPXPPPXP 951 PP P P PPP P P Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVP 582 Score = 41.1 bits (92), Expect = 0.001 Identities = 37/140 (26%), Positives = 39/140 (27%), Gaps = 2/140 (1%) Frame = +1 Query: 529 PPPXPPXPP-PXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHA 705 PPP P P P P P G P P P H Sbjct: 472 PPPGAPHPRVPPPGAPHPRVPP--PGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHP 529 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXX 882 P P P + PP P + A PP P P P P PPP Sbjct: 530 RVPP-PGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPP-GTP 587 Query: 883 XPXXPPPXPPXXPPPXPXPP 942 P PPP P P P P Sbjct: 588 HPRVPPPGAPHPKVPPPGAP 607 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P PPP P P P P P P PP Sbjct: 424 PGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 473 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P PPP P P P P P P PP Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 483 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P PPP P P P P P P PP Sbjct: 444 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 493 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P PPP P P P P P P PP Sbjct: 484 PGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 533 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P PPP P P P P P P PP Sbjct: 504 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 553 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P P P PPP P P P P P P PP Sbjct: 559 PRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPKVPP 603 Score = 37.9 bits (84), Expect = 0.012 Identities = 37/144 (25%), Positives = 39/144 (27%), Gaps = 3/144 (2%) Frame = +1 Query: 529 PPPXPPXPP-PXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHA 705 PPP P P P P P G P P H Sbjct: 452 PPPGAPHPRVPPPGAPHPRVPP--PGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHP 509 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXX 882 P P P + PP P + A PP P P P P PPP Sbjct: 510 RVPP-PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPH 568 Query: 883 XPXXPPPXP-PXXPPPXPXPPPXP 951 PP P P PPP P P Sbjct: 569 PRVPPPGAPHPRVPPPGTPHPRVP 592 Score = 37.5 bits (83), Expect = 0.016 Identities = 29/102 (28%), Positives = 31/102 (30%), Gaps = 2/102 (1%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPX 828 P P P H P P P + PP P + A PP P P Sbjct: 432 PPPGAPHPRFPPPGAPHPRVPP-PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPR 490 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXPPPXPXPPPXP 951 P P PPP PP P P PPP P P Sbjct: 491 VPPPGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 532 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 828 PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P PPP P P P P P P PP Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPP 463 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +3 Query: 828 PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P PPP P P P P P P PP Sbjct: 503 PPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPP 543 Score = 36.7 bits (81), Expect = 0.028 Identities = 36/140 (25%), Positives = 37/140 (26%), Gaps = 2/140 (1%) Frame = +1 Query: 529 PPPXPPXPP-PXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHA 705 PPP P P P P P G P P P H Sbjct: 502 PPPGAPHPRVPPPGAPHPRVPP--PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHP 559 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPP-PXXX 882 P P P + PP P P PPP P P P P Sbjct: 560 RVPP-PGAPHPRVPPPGAPH-PRVPPPGTPHPRVPPPGAPHPKVPPPGAPYQRLPYSGAY 617 Query: 883 XPXXPPPXPPXXPPPXPXPP 942 P PPP PP P P P Sbjct: 618 HPRLPPPGPPYQRVPPPGAP 637 Score = 35.9 bits (79), Expect = 0.048 Identities = 24/83 (28%), Positives = 25/83 (30%), Gaps = 1/83 (1%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXX 885 + P I P PP IP PI P PP P PPP Sbjct: 310 MRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQGASQTPPYPGSHYSRVPPPDGPYT 369 Query: 886 PXXPPPXPP-XXPPPXPXPPPXP 951 PP P PPP P P Sbjct: 370 RALPPGEPYARMPPPGATHPRVP 392 Score = 35.1 bits (77), Expect = 0.084 Identities = 34/140 (24%), Positives = 36/140 (25%), Gaps = 2/140 (1%) Frame = +1 Query: 529 PPPXPPXP--PPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRH 702 PPP P P PP P G P P P H Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPP---GAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPH 458 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 P P P + PP P + A PP P PPP Sbjct: 459 PRVPP-PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Query: 883 XPXXPPPXPPXXPPPXPXPP 942 P PPP P P P P Sbjct: 518 HPRVPPPGAPHPRVPPPGAP 537 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXP 921 PP P + A PP P P P P PPP PP P P P Sbjct: 403 PPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVP 462 Query: 922 PPXPXPPPXP 951 PP P P Sbjct: 463 PPGAPHPRVP 472 Score = 34.7 bits (76), Expect = 0.11 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXP 921 PP P + A PP P P P P PPP PP P P P Sbjct: 423 PPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVP 482 Query: 922 PPXPXPPPXP 951 PP P P Sbjct: 483 PPGAPHPRVP 492 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P P PPP P PP PP P PP P Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPP-PPIRAPVDVYPPRAP 344 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP P P PPPP Sbjct: 306 PHPRMRPPTRIPPPGMGPPPRIPPPP 331 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP PPP PPP P PP P Sbjct: 317 PPPGMGPPPRIPPPPIRAPVDVYPPRAP 344 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P T P P PPP P P P P PP Sbjct: 362 PPPDGPYTRALP-PGEPYARMPPPGATHPRVPSPGASHPRVPP 403 Score = 28.7 bits (61), Expect = 7.3 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 2/79 (2%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLX-AXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P VPI P ++ P P P+ PPP P P PP Sbjct: 671 PRVPISPLAES-PQKSPLEPVTATQMTPPVAPRVPPPSPRMQPPASGFLRMHPPASGFPR 729 Query: 889 XXPPPXP-PXXPPPXPXPP 942 PP P PP PP Sbjct: 730 MHPPASGFPRMHPPASGPP 748 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 41.1 bits (92), Expect = 0.001 Identities = 31/103 (30%), Positives = 32/103 (31%), Gaps = 5/103 (4%) Frame = +1 Query: 652 PXLXCPXPTXLSXK-FRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX 828 P L P PT R A P LP + P PI P P P Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPR 1074 Query: 829 PPXPXXXXXXXPPP----PXXXXPXXPPPXPPXXPPPXPXPPP 945 P P PPP P P P PP P P P P P Sbjct: 1075 QPPPPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAPRP 1117 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/76 (30%), Positives = 24/76 (31%), Gaps = 4/76 (5%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P+ P P P P P PPP P P P Sbjct: 1013 PVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPP 1072 Query: 910 PXXPPP----XPXPPP 945 P PPP P PPP Sbjct: 1073 PRQPPPPSTSQPVPPP 1088 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P+L P P PP P P P PPP P P P P PPP Sbjct: 1015 PHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPP 1073 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/82 (28%), Positives = 23/82 (28%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H P P P Q I P PP PP P P Sbjct: 992 HPSPPMQPAKPPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPP 1051 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 PPP P PP P PPP Sbjct: 1052 SAVPIPPPRKPSPPPSEPAPPP 1073 Score = 38.3 bits (85), Expect = 0.009 Identities = 22/79 (27%), Positives = 26/79 (32%), Gaps = 2/79 (2%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXP--PPPXPXPPXPXXXXXXXPPPPXXXXPXX 894 P+ P + PP P + + P PP P PP PPP Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPV 1085 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP P P P P P Sbjct: 1086 PPPRQPDPIPTNPAHPTEP 1104 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +3 Query: 528 PPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPP 659 PP P PP PS P+ S P + P P PPP Sbjct: 1035 PPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG G GG G G GGGG GGG G GG Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G G G GG G G GGGG GGG G GG Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G GG G G GGGG GGG GG G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGG GGG G G Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGGG GG G G Sbjct: 342 GGGGGGGGGGGGGGGGGGRGGGGGFSSRG 370 Score = 37.5 bits (83), Expect = 0.016 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G G GGG GG GGG GG G G Sbjct: 338 GSGRGGGGGGGGGGGGGGGGGGRGGGGG 365 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G GG G G Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G GGG GG GGG GG G G Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGG 364 Score = 33.1 bits (72), Expect = 0.34 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = -3 Query: 925 GGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG G G GGGG GGG G GG G G G Sbjct: 337 GGSGRGGGGGGG-GGGGGGGGGGGRGGGGGFSSRGRG 372 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G G GGGG G GG G GGGG Sbjct: 337 GGSGRGGGGGGGGGGGG-------GGGGGGRGGGG 364 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 908 GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGGG G GG G GGG Sbjct: 340 GRGGGGGGGGGGGGGG-------GGGGRGGGGG 365 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP T P P P P PPP P P P P P P PP Sbjct: 55 PNIPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 40.7 bits (91), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP T P P P P PPP P P P P P P PP Sbjct: 70 PGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPP 114 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXX--PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP T P P P PPP P P P P P P PP Sbjct: 30 PRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPP 74 Score = 36.3 bits (80), Expect = 0.036 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 4/75 (5%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP----PPPXXXXPXXP 897 P N T P P T P P P P P P PPP P P Sbjct: 24 PPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP 83 Query: 898 PPXPPXXPPPXPXPP 942 PP P P P P Sbjct: 84 PPNTPIPGNPPPNTP 98 Score = 35.5 bits (78), Expect = 0.064 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 1/75 (1%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP-PXPXXXXXXXPPPPXXXXPXXP 897 P P PP IP P PPP P P P PPP P P Sbjct: 45 PNTPIPGDPPPNIPI-PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDP 103 Query: 898 PPXPPXXPPPXPXPP 942 PP P P P P Sbjct: 104 PPNTPIPGDPPPNTP 118 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P P PP P P P PPP P P P P P Sbjct: 75 PNTPIPGDPPPNTPIPGNPP-PNTPIPGDPPPNTPIPGDPPPNTP 118 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP T P P P P P PPP P P P P P Sbjct: 40 PGDRPPNTPI---PGDPPPNIPIPGNPPPNTPIPGDPPPNTP 78 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP T P P P P PPP P P P P P P Sbjct: 80 PGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPPPNTPIQGDP 123 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PPPPXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXX---PPPXPXPPPXP 951 PPP P P P PPP P PPP P PP P P P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTPIPGDPP 114 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP----PPPXXXXPXXP 897 P N P P T P P P P P PPP P P Sbjct: 14 PPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNPPPNTPIPGDP 73 Query: 898 PPXPPXXPPPXPXPP 942 PP P P P P Sbjct: 74 PPNTPIPGDPPPNTP 88 Score = 32.3 bits (70), Expect = 0.59 Identities = 21/75 (28%), Positives = 21/75 (28%), Gaps = 4/75 (5%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP----PPPXXXXPXXP 897 P N P P T P P P P P PPP P P Sbjct: 4 PPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPGNP 63 Query: 898 PPXPPXXPPPXPXPP 942 PP P P P P Sbjct: 64 PPNTPIPGDPPPNTP 78 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/48 (33%), Positives = 16/48 (33%), Gaps = 2/48 (4%) Frame = +1 Query: 808 PPP--PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P P PPP PP P PP P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIP 60 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P P P P P P P PPP P P P Sbjct: 85 PNTPIPGNPPPNTPI-PGDPPPNTPIPGDPPPNTPIQGDPLTIP 127 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 40.3 bits (90), Expect = 0.002 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPP 941 PPP PPPP P PP PPPP Sbjct: 197 PPPPPPPPGFPGGAPPPPPPP 217 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPPP P PPPPP Sbjct: 190 PMAGMPPPPPPPPPPGFPGGAPPPPPP 216 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 PPPP P PP PPPP P PPP PP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAP--PPPALNGGPP 231 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP PP P P PPP Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPP 215 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P P PP PPP PPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P P PP P P PPPP P PP P Sbjct: 188 PSPMAGMPPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP P P P PP PPP Sbjct: 196 PPPPPPPPPGFPGGAPPPPPPPFGAPPP 223 Score = 35.1 bits (77), Expect = 0.084 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 P P PP P PPPP PPP PP PP P Sbjct: 188 PSPMAGMPPPPPP-----PPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 34.7 bits (76), Expect = 0.11 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P P P P PPPP Sbjct: 195 PPPPPPPPPPGFPGGAPPPPPPPFGAPPPP 224 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P PP PPPP P P PP Sbjct: 195 PPPPPPPPP---------PGFPGGAPPPPPPPFGAPPPPALNGGPP 231 >SB_6096| Best HMM Match : Chitin_bind_3 (HMM E-Value=1.9e-06) Length = 295 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP T P P PP PP P P PP PP P Sbjct: 219 PRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPPKP 259 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P P PP PP PP P PP P Sbjct: 215 PTQAPRPPTTQTPPTKAPTDPPV--PPTNPPVPPTNPPAPPTNPPKP 259 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PP PP PP P PP Sbjct: 232 PTDPPVPPTNPPVPPTNPPAPPTNPP 257 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +1 Query: 718 VPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 V ILP N P P P + PP P PP P P P Sbjct: 205 VKILPGNGVVPTQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNP 256 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 T P PP P PP P PP PP PP Sbjct: 216 TQAPRPPTTQTPPTKAPTDPPVPPTNPPVPPTNPPAPPTNPP 257 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG G GG G G GGGG GGG GG Sbjct: 208 GGGRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/42 (47%), Positives = 20/42 (47%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG G G GGGG GGG G GG G GG G Sbjct: 200 GGSSRGGYGGGR-GGGGYGGGRGGGGGYGGGRRDYGGGSKGG 240 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GGG G GG G GGG G GG G GGG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGG 229 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G G GG GG GGG G GGGG GG GG N Sbjct: 196 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGGYGGGRRDYGGGSKGGGYDRN 245 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 908 GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G GG G GGGG G GG G GGGG R G GG Sbjct: 183 GGGGSQGGGYRSGGGGYGGSSRGGYGG-GRGGGGYGGGRGGGGGYGGGRRDYGG 235 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GG GG GG G G GG G GG G GGG Sbjct: 186 GSQGGGYRSGG--GGYGGSSRGGYGGGRGGGGYGGGRG-GGGGYGGG 229 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP T P P PPP PP P P PP PPP P Sbjct: 283 PVPPMT-----PPPAVVTAPPPAPPLPNFTSPSPPPPPPLP 318 Score = 37.5 bits (83), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P P PPPP PP PP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPP------PPLPPAMP 322 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PP P P PPPPP Sbjct: 297 PPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPP 339 Score = 35.5 bits (78), Expect = 0.064 Identities = 23/74 (31%), Positives = 23/74 (31%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P T PP P P F T PPP P P PP P PPP Sbjct: 291 PAVVTAPPPAPPLPNF-------TSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSE 343 Query: 910 PXXPPPXPXPPPXP 951 P P P P Sbjct: 344 DFYSMPSSLPMPSP 357 Score = 34.3 bits (75), Expect = 0.15 Identities = 35/142 (24%), Positives = 38/142 (26%), Gaps = 3/142 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP P PP VP G P P P ++ Sbjct: 245 PPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPP--MTPPPAVVT------A 296 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P LP N T P P P+ PP PP P P P Sbjct: 297 PPPAPPLP-NFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMP 355 Query: 889 XXPP---PXPPXXPPPXPXPPP 945 P P P P PPP Sbjct: 356 SPPEDLYDAPATLPSPIMPPPP 377 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP-PPXXXXPXXPPPXPPXXPP 924 PP +P I + T PP PP P PPP PP Sbjct: 247 PPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVPPMTPPPAVVTAPPPAPPLPNF 306 Query: 925 PXPXPPPXP 951 P PPP P Sbjct: 307 TSPSPPPPP 315 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP--PXXP------PPXPXPPPXP 951 P PP PP PP P P PPP P P P PP PP P Sbjct: 283 PVPPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPP 338 Score = 30.3 bits (65), Expect = 2.4 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 22/68 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXX--------PXPXPPX----------- 929 P P P PP PP PPP PPP P P PP Sbjct: 311 PPPPPPLPPAMPAMDDLLPPEVLSPPPPPPPSEDFYSMPSSLPMPSPPEDLYDAPATLPS 370 Query: 930 ---PPPPP 944 PPPPP Sbjct: 371 PIMPPPPP 378 Score = 28.7 bits (61), Expect = 7.3 Identities = 21/76 (27%), Positives = 23/76 (30%), Gaps = 8/76 (10%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP-PPP-----XXXXPXXPPPXP 909 P + P+ PPPP P P P PP P P Sbjct: 226 PSSLRVKPVSGRLGLSNIKPPPPPVPPPTIPSVPPGSETYVPPGSATYESMDSVNKAPVP 285 Query: 910 PXXPPP--XPXPPPXP 951 P PPP PPP P Sbjct: 286 PMTPPPAVVTAPPPAP 301 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXX-PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P T P PPP PPPP P PPPPP Sbjct: 558 PKRPAPTPSQTQVKYMGSTSPVATSPPPHPPPPAHHVNKPGVPPPPP 604 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P PPP P PPP PP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPP-TDPPTQP 1059 Score = 39.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P T P P P P P PPP P P P PP P Sbjct: 1018 PLPTDPPTEPPTDPPTPPPTEP-PTPPPTEPPTPPPTDPPTQP 1059 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 T P P P P P P PP P PP PP PP P P Sbjct: 1012 TTNVPDPLPTDP-PTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDPPTQP 1059 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 T P P P P P P PP PP PP P PP Sbjct: 1003 TSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPP 1051 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G GG G GGGG GG GG G Sbjct: 802 GGMGMSGGGSMGAHGGGGMAGGGSSMGGAG 831 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP--PPXP 951 P P P P P PP PP PP P P PP P Sbjct: 1002 PTSGPTNPGTTTNVPDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTP 1050 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P P PP PPPPP Sbjct: 59 PTVPIPPTLPPPP--PPPPPPLPPPPP 83 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 830 PXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXP 934 P N P P PP PPP PP PPP P Sbjct: 49 PCNHQLLMVGPTVPIPPTLPPPPPPPPPPLPPPPP 83 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP PPP P PPP Sbjct: 59 PTVPIPPTLPPPPPP-PPPPLPPPPP 83 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP PPP P PPP P Sbjct: 62 PIPPTLPPPPPPPPPPLPPPPP 83 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPP 873 T PPPP P PP P PPPP Sbjct: 66 TLPPPPPPPPPPLP-------PPPP 83 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 39.9 bits (89), Expect = 0.003 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P P PP PPPPP Sbjct: 283 PTVPIPPTLPPPP--PPPPPPLPPPPP 307 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 Query: 830 PXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXP 934 P N P P PP PPP PP PPP P Sbjct: 273 PCNHQLLMVGPTVPIPPTLPPPPPPPPPPLPPPPP 307 Score = 37.9 bits (84), Expect = 0.012 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP PPP P PPP Sbjct: 283 PTVPIPPTLPPPPPP-PPPPLPPPPP 307 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP PPP P PPP P Sbjct: 286 PIPPTLPPPPPPPPPPLPPPPP 307 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPP 873 T PPPP P PP P PPPP Sbjct: 290 TLPPPPPPPPPPLP-------PPPP 307 >SB_5433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G G GGGG GGG G GG Sbjct: 27 GGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GG GGG G GG G Sbjct: 25 GGGGHGGGHGYGGGPNGGGGGGGGGGGGGG 54 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG GGG GG G Sbjct: 28 GHGGGHGYGGGPNGGGGGGGGGGGG 52 Score = 36.7 bits (81), Expect = 0.028 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GG G G GG GGG G GG G G G G Sbjct: 25 GGGGHGG-GHGYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSG 68 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GGG G G G GGGG GG G G Sbjct: 34 GYGGGPNGGGGGGGGGGGGGGDEDDSGKNG 63 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG--XXXXXXXGXGGXGXGGGGXNVXR 792 G GGG GGG GG GGG G G GG GG N R Sbjct: 34 GYGGGPNGGGGGGGGGGGGGGDEDDSGKNGKEYSGKNKWNNGGEYNNGGKYNKWR 88 Score = 29.9 bits (64), Expect = 3.2 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G G G G G GG G GGG G GGGG G G G Sbjct: 26 GGGHGGGHGYGGGPNGGGGGGGG----GGGGGGDEDDSGKNGKEYSG 68 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 39.9 bits (89), Expect = 0.003 Identities = 27/75 (36%), Positives = 28/75 (37%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG GG G GGG G GG G GGG + G Sbjct: 141 GGGGGYRGGYRGGYRGGYRGGRDRGGG----YGGGGEGGYGMGGGDYS-GGCGYGSSYGG 195 Query: 764 XGXXGGXVWLXGRMG 720 G GG G G Sbjct: 196 GGDYGGGPGYGGGQG 210 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG--XGGXGXGGGG 807 G GG G GG GGG G GGG G GG G GGG Sbjct: 153 GYRGGYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGG 202 Score = 32.7 bits (71), Expect = 0.45 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 5/55 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG-----XGGGGXN 801 G GGG G G GG G G GGG G GG GGGG N Sbjct: 167 GYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGGN 221 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG GGG GG GG GG G GG GG G Sbjct: 157 GYRGGRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPG 204 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GGG GG G GG G G GG G GGG Sbjct: 161 GRDRGGGYGGGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGG 208 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G G G G GG G G GG GG G G Sbjct: 170 GGGEGGYGMGGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYG 212 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXX--GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GGG GGG GG G GG G Sbjct: 179 GGGDYSGGCGYGSSYGGGGDYGGGPGYGGGQGYGSYSGGGGGNYDYQG 226 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPP--PXPPPPXXPXPXP--PXPPPPP 944 P P PP P PP P PP P P P P P P PP PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 37.1 bits (82), Expect = 0.021 Identities = 19/51 (37%), Positives = 19/51 (37%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPPP PP P PP P P P PP P PP P Sbjct: 28 TPPPPPPYEAPPPPPGPPGPDGPP---GFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXPPPXPXPPPXP 951 PPP P PP P P P P PP P P PP PP P Sbjct: 38 PPPPPGPPGP-DGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNP 84 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXP-XPPXPPPP 941 P PP P PP P PP P P PP P P Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXP-XPPXPPPP 941 P PP P PP P PP P P PP P P Sbjct: 710 PGPPGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXP-XPPXPPPP 941 P PP P PP P PP P P PP P P Sbjct: 795 PGPPGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXP-XPPXP 932 P PP P PP P PP P P PP P Sbjct: 880 PGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P P P PP P P P PP Sbjct: 112 PGPPGPPGPQMPPGPPGLPGPPGPAGPP 139 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP--PXPPPPXXPXPXPPXPPPPP 944 P P P P PP PP P PP P P P PP P P Sbjct: 257 PQGPNGLPGPNGILGPPGPPGDMGPPGLPGPPGPQMP-PGPPGLPGAP 303 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P P P PP P PP P PP P Sbjct: 689 PGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPGPNGPPGP 736 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P P P PP P PP P PP P Sbjct: 774 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 821 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P P P PP P PP P PP P Sbjct: 859 PGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPKGPPGP 906 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/66 (28%), Positives = 19/66 (28%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P A P P P P PP P PP P PP Sbjct: 74 PPGFQGPPGNPAGAIGPPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPPGPPGLPGPP 133 Query: 928 XPXPPP 945 P PP Sbjct: 134 GPAGPP 139 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 828 PPXTXXXXXPX-PPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP P PP P PP P P P P P PP Sbjct: 791 PPGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPP 828 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PX 906 P Q PP I P + PP P PP P P PP P PP P Sbjct: 685 PNGQPGPPGINGPP------GQIGEMGPPGLPGPPGP-ASPPSPPGPPGPPGPNGPPGPN 737 Query: 907 PPXXPP 924 P PP Sbjct: 738 GPLGPP 743 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 828 PPXTXXXXXPX-PPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP P PP P PP P P P P P PP Sbjct: 706 PPGLPGPPGPASPPSPPGPPGPPGPNGPPGPNGPLGPP 743 Score = 31.1 bits (67), Expect = 1.4 Identities = 22/66 (33%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PX 906 P Q PP I P + PP P PP P P PP P PP P Sbjct: 770 PNGQPGPPGINGPP------GQVGEMGPPGLPGPPGPASPPSP-PGPPGPPGPKGPPGPN 822 Query: 907 PPXXPP 924 P PP Sbjct: 823 GPLGPP 828 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P P PP P PP P PP Sbjct: 782 PPGQVGEMGP-PGLPGPPGPASPPSPPGPPGPPGPKGPP 819 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P P PP P PP P PP Sbjct: 867 PPGQVGEMGP-PGLPGPPGPASPPSPPGPPGPPGPKGPP 904 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PP P P P PP P Sbjct: 625 PGPPGPASPPSPPGPPGPPGPKGPPGP 651 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP P PP P P P P P PP Sbjct: 633 PPSPPGPPGPPGPKGPPGPNGPLGPP 658 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P P PP P PP P PP Sbjct: 697 PPGQIGEMGP-PGLPGPPGPASPPSPPGPPGPPGPNGPP 734 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P PP PP P PP P P Sbjct: 628 PGPASPPSPPGPPGPPGPKGPPGPNGP 654 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P PP PP P PP P P Sbjct: 713 PGPASPPSPPGPPGPPGPNGPPGPNGP 739 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P PP PP P PP P P Sbjct: 798 PGPASPPSPPGPPGPPGPKGPPGPNGP 824 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/77 (25%), Positives = 22/77 (28%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P+ P PP P P + P P P PP P P Sbjct: 229 PLGPPGDVGPPGNPGGPGYQ--GNHGNPAGPQGPNGLPGPNGILGPPGPPGDMGPPGLPG 286 Query: 901 PXPPXXPPPXPXPPPXP 951 P P PP P P P Sbjct: 287 PPGPQMPPGPPGLPGAP 303 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/83 (28%), Positives = 27/83 (32%), Gaps = 6/83 (7%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX-PXPPXPXXXXXXXPP--PPXXXXPX 891 P+ P + PP P P + P P PP P P Sbjct: 569 PLGPPGEAGPPGNPGGPGYQGNHGNPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPP 628 Query: 892 XP--PPXPPXXP-PPXPXPPPXP 951 P PP PP P PP P PP P Sbjct: 629 GPASPPSPPGPPGPPGPKGPPGP 651 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXP-XPPXPPPP 941 P T PP P P PPPP P P PP P P Sbjct: 19 PACTLSCCETPPPPPPYEAP-PPPPGPPGPDGPPGFPGP 56 Score = 29.1 bits (62), Expect = 5.5 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P Q PP + P P P PP P P PP P Sbjct: 594 PAGPQGPNGQPGPPGVNGPP------GEIGEIGPAGLPGPPGP-ASPPSPPGPPGPPGPK 646 Query: 892 XPP-PXPPXXPPPXPXP 939 PP P P PP P Sbjct: 647 GPPGPNGPLGPPGESGP 663 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXPPPXPP---PPXXPXPXPPXPPPPP 944 P P P PP P PP P P P PP P Sbjct: 179 PGPNGPLGPPGPPGDMGPPGLPGPQGPQMPPGP 211 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +3 Query: 822 PXPPXTXXXXX-PXPPXPXXPPPXPPPPXXPXPXPP 926 P PP P PP P PP P P P P P Sbjct: 273 PGPPGDMGPPGLPGPPGPQMPPGPPGLPGAPGPKGP 308 Score = 28.7 bits (61), Expect = 7.3 Identities = 25/81 (30%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P Q PP I P PP P PP P P P P Sbjct: 339 PAGPQGPNGQPGPPGINGPP------GPLGDVGPPGLPGPPGP-QMPPGPPGLPGAPGPK 391 Query: 892 XPP-PXPPXXPPPXPXPPPXP 951 PP P PP PP P Sbjct: 392 GPPGTNGPLGPPGDVGPPGNP 412 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP-XPXPPXPP 935 P P P P P P P P PP P P P PP Sbjct: 181 PNGPLGPPGPPGDMGPPGLPGPQGPQMPPGPPGLPGAPGPKGPP 224 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXPPPXPXPPPXP 951 PP P PP P P P P PP P PP PP P Sbjct: 281 PPGLPGPPGP-QMPPGPPGLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 327 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P Q PP I P + PP P PP P P PP P PP Sbjct: 855 PNGQPGPPGINGPP------GQVGEMGPPGLPGPPGP-ASPPSPPGPPGPPGPKGPPGPN 907 Query: 910 PXXPPPXPXPP 942 PP P Sbjct: 908 GCLGPPGDAGP 918 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P P PPP P PP P PP Sbjct: 20 PKPPQPTPPKPDTPPPGTNIPTPPSPNTPP 49 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP----PPPXXXXPXXPPP--XPPXXPPPXPXPPP 945 P PP P P P P PPP P PP PP PP PPP Sbjct: 25 PTPPKPDTPPPGTNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPP 76 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP--XXPXPXPPXPPPP 941 P P PP T P PP P PPP PP P PP PP Sbjct: 27 PPKPDTPPPGTNI---PTPPSPNTPPPVTQPPVTQPPVTQPPVTQPP 70 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP--XPPXXPPPXPXPP 942 P PP P PP P PPP P P P PP PP PP Sbjct: 20 PKPPQPTPPKP------DTPPPGTNIPTPPSPNTPPPVTQPPVTQPP 60 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP--XPPXXPPPXPXPP 942 T PP P P P P PP P PPP PP PP PP Sbjct: 19 TPKPPQPTPPKPDTPPPGTNIPTPP---SPNTPPPVTQPPVTQPPVTQPP 65 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXP--PPPXXPXPXPPXPPPP 941 P T P PP P PPP P P P PP PP Sbjct: 14 PVDQATPKPPQPTPPKPDTPPPGTNIPTPPSPNTPPPVTQPP 55 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PPP PP P PP Sbjct: 22 PPQPTPPKPDTPPPGTNIPTPPSPNTPP 49 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 3/50 (6%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPP---PXXXXPXXPPPXPPXXPPPXPXP 939 T P PP P P P PP P P P PP P P Sbjct: 37 TNIPTPPSPNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPPVTQSPEQEP 86 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXP 932 PP PPP PPPP P P PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPPP P P PP PP P Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPPTP 1330 Score = 39.5 bits (88), Expect = 0.004 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 PP PPPP P P PP PP PP Sbjct: 1307 PPESPPPPPPPPPPPPPPPLPP 1328 Score = 35.1 bits (77), Expect = 0.084 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PP PP PPP P PPP P Sbjct: 1307 PPESPPPPPPPPPPPPPPP 1325 Score = 35.1 bits (77), Expect = 0.084 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPP 943 PP PPP PP PPP P P Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP PPP P PP P Sbjct: 1312 PPPPPPPPPPPPPPLPPTP 1330 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 P PPP PP PPP P P P Sbjct: 1308 PESPPPPPPPPPPPPPPPLP 1327 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P PP PP PPP P PPP P Sbjct: 1307 PPESPPPPP-PPPPPPPPPPLP 1327 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPP 902 PP + P PP P PPP PP P Sbjct: 1307 PPESPPPPPPPPPPP-PPPPLPPTP 1330 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXP 888 PPPP P PP P PPPP P Sbjct: 1311 PPPPPPPPPPP-------PPPPLPPTP 1330 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P T P PP P P P P P PP P PPP Sbjct: 330 PPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 Score = 36.7 bits (81), Expect = 0.028 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 T PP P P P P PPP P PPP P PPP Sbjct: 327 TNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPP---PPPPPTPPP 372 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PPP P P P P Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPTTPKTHPQLGPPPPPPPPPPTPPP 372 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PPPP P P P P PP Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP P PPP PP P P P PP P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGP 121 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPP--PXXPXPXPPXPPPP 941 P PP T PP P PP PPP P P P P PP P Sbjct: 95 PPPPAT-------PPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP P P P PP P Sbjct: 101 PPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P PP PP PP P PP Sbjct: 95 PPPPATPPPPTMPPTPP--PPQTPAPP 119 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP PP PPP PP P Sbjct: 95 PPPPATPP--PPTMPPTPPPPQTPAPPGP 121 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 T PPP PP P P PP P P P P P P Sbjct: 91 TCGDPPPPATPPPP----TMPPTPPPPQTPAPPGPDTPAPPAP 129 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PP PP PPP PP Sbjct: 95 PPPPATPP-PPTMPPTPPPPQTPAPP 119 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +1 Query: 862 PPPPXXXXPXXPP-PXPPXXP-PPXPXPPPXP 951 PPP P PP P PP P PP P P P Sbjct: 96 PPPATPPPPTMPPTPPPPQTPAPPGPDTPAPP 127 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 P P PP T P P P P P P P P Sbjct: 95 PPPPATPPPPTMPPTPPPPQTPAPPGPDTPAPPAP 129 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 38.7 bits (86), Expect = 0.007 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP--PPXPXPPPXP 951 PPPP P P P P P PPP PP P P P PP P Sbjct: 778 PPPPPPTKPATPRVPPNIPSRPPGARP-TPPPPPPGKPTKPTKPSLPPVP 826 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPX-PXXPP---PXPPPPXXPXPXPPXPPPPP 944 P P PP T PP P PP P PPPP P P P P Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLP 823 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P P P PP P P PP PP P P P Sbjct: 777 PPPPPPPTKPATPRV---PPNIPSRPPGARPTPPPPPPGKPTKPTKP 820 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP PPP P P PP P Sbjct: 781 PPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 T PPPP P P PP PPP P PP P Sbjct: 692 TRRPPPPRPMAPKDASLHRASSPPGFTHKGSEPPPKP--APPARP 734 Score = 28.3 bits (60), Expect = 9.6 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 7/55 (12%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXP-------PXPXXPPPXPPPPXXPXPXPPXPP 935 A P P P P T P P P PPP P PP PP Sbjct: 773 ALGAPPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVPP 827 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 38.7 bits (86), Expect = 0.007 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG GG G GGGG GGG GG G GG G Sbjct: 226 GGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGG 264 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG G G GGG G GG G G GG G Sbjct: 223 GVPGGFGGGGGVWGNGGGGGGGGGYSGGGSGNPHYYACGGGGGSYNSG 270 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/50 (42%), Positives = 21/50 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GG G GG GGG G GGGG G GG GGG N Sbjct: 213 GGVGGRSVWNGVPGGFGGG-GGVWGNGGGG-------GGGGGYSGGGSGN 254 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -3 Query: 934 GGXGGXGX--GXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GG GG G GG G GGG G GG G GG Sbjct: 213 GGVGGRSVWNGVPGGFGGGGGVWGNGGGGGGGGGYSGG 250 >SB_43284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG GG G GGG G GG G GG G GG Sbjct: 153 GDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGG 199 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 GG G GGG GG GG G GGGG G GG G Sbjct: 170 GGSNGSGGGDDGGDGGDDGG--GSGGGGDDGGSDGGGGGNDGG 210 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG-----XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G G GG G G G GG G G G GGGG Sbjct: 143 GDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDGGGSGGGG 195 Score = 33.5 bits (73), Expect = 0.26 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG---GXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G G G G G G G GGG G G G G GGG Sbjct: 129 GDGDGDGDGDGDGDGDGDGDGDGDGDGGGSDDGGDDDDGDGGGSNGSGGGDDGGDGGDDG 188 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 189 GGSGGGGDDGG 199 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G GGG G GG G GGG G G GGGG N Sbjct: 161 GGDDDDGDGGGSNGSGGGDDGGDGGDDGGG---SGGGGDDGGSDGGGGGN 207 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGX--GGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG G G G GG G GGG G G G G G G Sbjct: 167 GDGGGSNGSGGGDDGGDGGDDGGGSGGGGDDGGSDGGGGGNDGGRDDG 214 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG G GG G GGGG G GG Sbjct: 188 GGGSGGGGDDGGSDGGGGGNDGGRDDGG 215 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG 867 G GG G GG GG GGG G GG Sbjct: 189 GGSGGGGDDGGSDGG-GGGNDGGRDDGG 215 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 38.7 bits (86), Expect = 0.007 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPPP 944 PPPP P P PP PPPPP Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXP 932 PP P PPP PPPP P P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.9 bits (79), Expect = 0.048 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 Query: 896 PPPXPPXXPPPXPXPPP 946 PPP PP PPP P PPP Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPP 926 P PP P PPP PPPP P P Sbjct: 55 PPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.9 bits (79), Expect = 0.048 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPP 945 PPP PP PPP P PPP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 35.5 bits (78), Expect = 0.064 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPP 935 PP P PPP PPPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.064 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPPP P P P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 Score = 35.5 bits (78), Expect = 0.064 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 898 PPXPPXXPPPXPXPPPXP 951 PP PP PPP P PPP P Sbjct: 54 PPPPPPPPPPPPPPPPPP 71 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP PPP PP PPP P P Sbjct: 56 PPPPPPPPPPPPPPPPSSSP 75 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P PPP PP PPP P P P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP PP PPP P P Sbjct: 54 PPP----PPPPPPPPPPPPPPPSSSPSRP 78 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP 897 PPPP P PP P PPPP P P Sbjct: 54 PPPPPPPPPPPPP-----PPPPPSSSPSRP 78 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 519 HXPPPPXXPXPPXXXPSTXGRGSP 590 H PPPP P PP P SP Sbjct: 52 HDPPPPPPPPPPPPPPPPPPSSSP 75 >SB_36971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1870 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P PP P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGP 1382 Score = 36.7 bits (81), Expect = 0.028 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P PP P P P P PP P P Sbjct: 1360 PRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 33.5 bits (73), Expect = 0.26 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPP 943 P PP P P PP PPP PP Sbjct: 1575 PITPPPPTPSPPQTPPPVNTPP 1596 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PP P P PP P P P P Sbjct: 1360 PRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 32.3 bits (70), Expect = 0.59 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPP 938 PP P PP PPP P P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P P P P P P P Sbjct: 1358 PRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 1/35 (2%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-PPPXXPXP 917 P P P P PP P PP P P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRPGPPTPRP 1387 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P PP PP P P P P Sbjct: 1353 PIPSTPRPRPPTPPRPPTPRPRPPTPRP 1380 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PPP P P P Sbjct: 1578 PPPPTPSPPQTPPPVNTPPRPETPEP 1603 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 38.7 bits (86), Expect = 0.007 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPPP 944 PPPP P P PP PPPPP Sbjct: 424 PPPPPPPAPLPPPPPPPP 441 Score = 37.9 bits (84), Expect = 0.012 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 885 PXPPPPXXPXPXPPXPPPPP 944 P PPPP P P PP PPP P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 35.9 bits (79), Expect = 0.048 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PPPP P P P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPP-PPPPQPTTALPDP 450 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXPXPPPXP 951 P P P PPPP P PPP PP P P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 34.7 bits (76), Expect = 0.11 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP PPP P PPP P P P Sbjct: 424 PPPPPPPAPLPPPPPPPPQP 443 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP-PXXPPPXPXPPP 945 P P P PPPP P PPP P P P P P Sbjct: 409 PFPTPNRRRRRSLVQPPPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 R PPPP P P P PPPP P P P P Sbjct: 419 RSLVQPPPPPPPAPLP-------PPPPPPPQPTTALPDPLQGP 454 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PP PPP P P P P PP P P Sbjct: 449 PPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSP 487 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 5/66 (7%) Frame = +1 Query: 769 PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP---PP--XP 933 P+ L A T P P PP P PPP P PP P P PP P Sbjct: 437 PLPSLRASAATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSP 496 Query: 934 XPPPXP 951 PP P Sbjct: 497 KQPPLP 502 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/90 (25%), Positives = 26/90 (28%) Frame = +1 Query: 673 PTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXX 852 P L + P + T PP +P L PPP PP P Sbjct: 424 PAPLPKAHNEKIAPLPSLRASAATLPP-LPSDEPPPLPPDEEKPPPPPAPALPPLP--LP 480 Query: 853 XXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P P PP P PP Sbjct: 481 PELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P PP P P P P P P PP P P PP Sbjct: 458 PLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P P P P P P PP PP Sbjct: 466 PPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPPKHSNGPP 510 >SB_44923| Best HMM Match : Fibrillarin (HMM E-Value=0) Length = 304 Score = 38.7 bits (86), Expect = 0.007 Identities = 21/49 (42%), Positives = 22/49 (44%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G G GGG G GGG G GGGG G GG GG G + R Sbjct: 41 GAGRGGGRGGPRGGG-RGGGRGGGGGFKSPRGGGRGGGRGGGRGVFIAR 88 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GGG GG G Sbjct: 55 GRGGGRGGGGGFKSPRGGGRGGGRG 79 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 G GGG GG G GGG GGG G GG G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGGGGFKSPRGGGRGGGRGGGRG 83 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 950 GXGGGXGX--GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG 831 G GGG G GGG GG GGG G GGG G G Sbjct: 43 GRGGGRGGPRGGGRGGGRGGG-GGFKSPRGGGRGGGRGGGRG 83 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPX--PPPPXXPXPXPPXPPPPP 944 P PP P PP PPP PPPP P P PPPP Sbjct: 456 PNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 36.3 bits (80), Expect = 0.036 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP--PPXPPXXPPPXPXPPPXP 951 PP P P P PPPP P PP P PPP PP P Sbjct: 451 PPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP--PXXPPPXPXPPP 945 PPPP P PPP P PP P PPP PPP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPPRGMPPP 506 Score = 35.1 bits (77), Expect = 0.084 Identities = 21/57 (36%), Positives = 21/57 (36%), Gaps = 11/57 (19%) Frame = +1 Query: 814 PPXPXPP-------XPXXXXXXXPPPPXXXXPXXPPP----XPPXXPPPXPXPPPXP 951 PP P PP P PPPP PPP PP PP P PP P Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPP 492 Score = 33.5 bits (73), Expect = 0.26 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PPPP PPP PPP PPP Sbjct: 441 PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMG-MYPPPRGFPPP 485 Score = 32.7 bits (71), Expect = 0.45 Identities = 25/81 (30%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +1 Query: 721 PILPXNQTXPPX----IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P LP N PP +P P+ R PPPP PP PPPP P Sbjct: 452 PQLPPNLPPPPGGMRGMPPPPMGMYPPPRG--FPPPPFGPPPP----FYRGPPPPRGMPP 505 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 P PP P P Sbjct: 506 PPRQRMPSQGPPQVHYPSQDP 526 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 7/50 (14%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXX-PPP------XPPPPXXPXPXPPXPPPPP 944 P P PP P P PPP PPPP P P PPPP Sbjct: 437 PQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPP 486 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 12/52 (23%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPX--------PXXPPPXPPPPXXPXPXPPXP----PPP 941 P PP P PP P PP PPPP PP P PPP Sbjct: 428 PPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPP 479 Score = 29.9 bits (64), Expect = 3.2 Identities = 29/91 (31%), Positives = 29/91 (31%), Gaps = 9/91 (9%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXP--IFXLXAXRXTXX-PPPPX---PXPPXPXXXXXXX 861 H L P VP LP PP F L PPPP P P P Sbjct: 390 HTLTP-VPGLPGALPAPPAEKEDQGDYFNLSTPAANMRLPPPPQHTGPPQPRPPHGMPQG 448 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXP---XPPP 945 PP PPP PP P PPP Sbjct: 449 GGPPQLPPNLPPPPGGMRGMPPPPMGMYPPP 479 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P P PP P PP P Sbjct: 428 PPPPQHTGP--PQPRPPHGMPQGGGPPQLP 455 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PP P P PP PPPP Sbjct: 436 PPQPR-PPHGMPQGGGPPQLPPNLPPPP 462 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP PP P PP PP PP P PP Sbjct: 1425 PPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPP---PPAPPCPP 1467 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPP 938 PPPP P P PP PPP Sbjct: 1455 PPPP--PPPAPPCPPP 1468 Score = 26.2 bits (55), Expect(3) = 0.007 Identities = 19/77 (24%), Positives = 21/77 (27%), Gaps = 3/77 (3%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFR---HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX 822 P CP P + H+ P P PP P PPPP Sbjct: 1461 PAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHVHTIVHHHVHPPPPA 1520 Query: 823 PXPPXPXXXXXXXPPPP 873 P PP P P Sbjct: 1521 PPPPVCMPMCAVAAPAP 1537 Score = 25.8 bits (54), Expect(3) = 0.007 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 529 PPPXPPXPPP 558 PPP PP PPP Sbjct: 1459 PPPAPPCPPP 1468 Score = 23.8 bits (49), Expect(3) = 0.007 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 520 IXXPPPXPPXPP 555 I PPP PP PP Sbjct: 1453 ILPPPPPPPAPP 1464 >SB_47508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2143 Score = 38.3 bits (85), Expect = 0.009 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPP--PP 944 P PPP PPPP P PP PPP PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP PPP PP P P PPP Sbjct: 82 PPPPPPPPPASNVPAPPPPP 101 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXP--PXXPPPXPXPPP 946 P P PP PPP P PPP P PP Sbjct: 77 PAAVIPPPPPPPPPASNVPAPPPPPPVMPP 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 T P P PP PPPP PPP PP PP Sbjct: 74 TDGPAAVIPPPP---------PPPPPASNVPAPPPPPPVMPP 106 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P PP P PPPP PP P PPP Sbjct: 582 PIPPPP-PQMNNTSAPPPPNKEKQTAKPPAP--LPPP 615 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 7/48 (14%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPX-----PPPPXXPXPX--PPXPPPPP 944 P PP P P PP PPPP PP P PPP Sbjct: 568 PLPPPEFSDLESSAPIPPPPPQMNNTSAPPPPNKEKQTAKPPAPLPPP 615 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P Sbjct: 83 PPPPPPPPASNVPAPPPPP 101 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.009 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPX-PPXXPPPXPXPPP 945 PPP P P P PP P P PP PP P PPP Sbjct: 138 PPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPP 183 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 38.3 bits (85), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP--XPPXXPPPXPXP-PPXP 951 T PPP P PP PP P PPP PP PP P P P P Sbjct: 116 TGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYP 169 Score = 37.1 bits (82), Expect = 0.021 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-XPPXXPPPXPXP 939 T PP P P P P PPP P PP PP P P P Sbjct: 156 TSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGPYPQTQP 203 Score = 32.3 bits (70), Expect = 0.59 Identities = 25/82 (30%), Positives = 26/82 (31%), Gaps = 7/82 (8%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPPPXXXXP 888 P+ T PP P PI PP P P PP PP P P Sbjct: 109 PVAYGYPTGPPP-PYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQP 167 Query: 889 XXPPPXPPXXPP---PXPXPPP 945 PP PP P P PP Sbjct: 168 YPQQGYPPQPPPQAYPQPGYPP 189 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P PPP PP P P P PP P Sbjct: 130 PYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPAQPYPQQGYPPQP 177 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 Y P P P P P P PP P P PP P P P P P Sbjct: 147 YPPPGGYPPTSYPPQPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYP-PTGPYPQTQP 203 Score = 28.7 bits (61), Expect = 7.3 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 2/64 (3%) Frame = +3 Query: 753 TXSXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP--XPPPPXXPXPXPP 926 T Y P P P P P P PPP PP P P P Sbjct: 106 TSQPVAYGYPTGPPPPYSPIPPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPPQPYPA 165 Query: 927 XPPP 938 P P Sbjct: 166 QPYP 169 Score = 28.3 bits (60), Expect = 9.6 Identities = 26/97 (26%), Positives = 29/97 (29%), Gaps = 4/97 (4%) Frame = +1 Query: 673 PTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP-PPPXPXPPX--PX 843 PT + + P P P PP +P T PPP PP P Sbjct: 105 PTSQPVAYGYPTGPPPPYSPI----PPQVPYPGAAGPPMPHPTASVYPPPGGYPPTSYPP 160 Query: 844 XXXXXXPPPPXXXXPXXPP-PXPPXXPPPXPXPPPXP 951 P P P PP P PP PP P Sbjct: 161 QPYPAQPYPQQGYPPQPPPQAYPQPGYPPQGYPPTGP 197 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 37.9 bits (84), Expect = 0.012 Identities = 23/68 (33%), Positives = 24/68 (35%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G G G G G GG G G G GGG + R Sbjct: 261 GQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPG 320 Query: 770 GXXGXXGG 747 G G G Sbjct: 321 GGWGRMQG 328 Score = 35.5 bits (78), Expect = 0.064 Identities = 29/86 (33%), Positives = 31/86 (36%), Gaps = 2/86 (2%) Frame = -1 Query: 951 GXGGGXGX--GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEX 778 G GGG G GGG G GGG G G G G G G G RG Sbjct: 287 GSGGGWGRMQGGGMGRGPGGGWGRMQGGMGRGPGGGWGRMQGGGMGRGPGGG-LGRG--- 342 Query: 777 EDRGXGNXWGGCLVXGEDGDXGXKGM 700 G G GG + G G +GM Sbjct: 343 PGGGWGRMQGGGMGRGPGQGWGCRGM 368 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG---GGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G G G GGG G GG G G GG G G G Sbjct: 242 GGGMGQGPRGWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGG 290 Score = 31.1 bits (67), Expect = 1.4 Identities = 28/83 (33%), Positives = 29/83 (34%), Gaps = 5/83 (6%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGG-----XXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G GGG G GGG G GGG G G GG G R Sbjct: 251 GWGRGSGGGWGQGPGGGWGRGQGRGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 + G G G W GRM G Sbjct: 311 MQ-GGMGRGPGGGW--GRMQGGG 330 >SB_44270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1172 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G G G G G GG GGG G G G Sbjct: 438 GGGTGSGSTGNGNAGNGGAGGGGAGGGSTG 467 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G G GGG G G G G G GG G G G Sbjct: 425 GGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAG-GGGAGGGSTG 467 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG G G G G G G G GG G Sbjct: 433 GGSAAGGGTGSGSTGNGNAGNGGAGGGGAG 462 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G G GGG GG G G G G G G G Sbjct: 418 GSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGG 463 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXX-GGXGGGXXGXXXXGGGGXXXXXXXGXGGXG 822 G GGG GGG G G G G GGGG G G Sbjct: 430 GAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGGSTGGASSSG 473 Score = 31.9 bits (69), Expect = 0.78 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGG 810 G GGG G GG G G G G GG G GGG Sbjct: 417 GGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAGGG 464 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GG G G GGG G G G GGG Sbjct: 412 GASSAGGSSAGASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGG 459 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGG-XXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 G GG G GG GGG G G G GG G G G T A G Sbjct: 422 GASGGGHKGAGGGSAAGGGTGSGSTGNGNAGNGGAGGGGAG-GGSTGGASSSG 473 >SB_47980| Best HMM Match : EGF_CA (HMM E-Value=7.6e-20) Length = 591 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG G G G GGGG GG G G GG Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSGLSPTCGGGG 528 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G GGGG GGG G G + G G Sbjct: 487 GGFGGGGGASGG--GGGGGGGGGFSGGACGDFTSGLSPTCGGG 527 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGG 867 GG G GGG GG GGG G GG Sbjct: 487 GGFGGGGGASGGGGGGGGGGGFSGG 511 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG GGG GG GG GG G G Sbjct: 490 GGGGGASGGGGGGGGGGGFSGGACGDFTSG 519 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Frame = -3 Query: 934 GGXGGXGXGXX--GGGGXGGGXXGXGGXGXXXXXVXGG 827 GG GG GG G GGG G GG G GG Sbjct: 474 GGVGGRSIWNVVPGGFGGGGGASGGGGGGGGGGGFSGG 511 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG G GG G G GGG GGG GG Sbjct: 117 GGGRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 37.5 bits (83), Expect = 0.016 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GGG G GG G GGG G GG G GGG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGGGRGGGGYGGGRGGGGSYGGG 138 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G GGG GGG G G G Sbjct: 104 GGGGYGGSSRGGYGGGRGGGGYGGGRGGG 132 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 943 GGG---GGXGGXGXGXXGGGGXGGGXXGXG 863 GGG GG GG G G GG G GGG G G Sbjct: 316 GGGYRSGGGGGYGGGRGGGRGYGGGRGGGG 345 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GGG G GGG G GGG G GG GGG Sbjct: 312 GGGRGGGYRSGGGGGYGGGR---GGGRGYGGGRGGGGRRDYGGG 352 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG GGG G G Sbjct: 323 GGGGYGGGRGGGRGYGGGRGGGGRRDYGGG 352 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GGG G G GGG GG G G G GG G Sbjct: 314 GRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGGGSRSG 356 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = -2 Query: 908 GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G GG G GGGG G GG G GGGG R G GG Sbjct: 92 GGGGSQGGGYRSGGGGYGGSSRGGYGG-GRGGGGYGGGRGGGGSYGGGRRDYGG 144 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GG GG G G GGG GGG GG G GG Sbjct: 313 GGRGGGYRSGGGGGYGGGRGGGRGYGGGRGGGGRRDYGG 351 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG 864 G G G GG GG GGG G GGG Sbjct: 105 GGGYGGSSRGGYGGGRGGGGYGGGRGGGG 133 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = -2 Query: 938 GXGXGGGXXGG---XGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GG GGG G GG G G G G GGGG Sbjct: 89 GERGGGGSQGGGYRSGGGGYGGSSRGGYG--GGRGGGGYGGGRGGGG 133 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG G G Sbjct: 115 GYGGGRG-GGGYGGGRGGGGSYGGGRRDYG 143 >SB_7159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 37.9 bits (84), Expect = 0.012 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G G G GG G GGG GGG G GG G GG G G Sbjct: 7 GDGDGEGGGDGGDSGGGSDGGGDGGDGGGGS-----DGGDGEG 44 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG---GGGXXXXXXXGXGGXGXGGG 810 G GG GGG G GGG G G G G G G GG Sbjct: 18 GDSGGGSDGGGDGGDGGGGSDGGDGEGDDDGDGEGDDDGDGEGDDDGDGG 67 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 37.9 bits (84), Expect = 0.012 Identities = 26/75 (34%), Positives = 26/75 (34%), Gaps = 1/75 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P LP T P P P F PPP P PP P P P P Sbjct: 748 PPAPPLPPKVTPKPPAP--PQF-------APVPPPCAPIPPMPCSAPLPPAPAPFSAAPH 798 Query: 892 XPP-PXPPXXPPPXP 933 PP P PPP P Sbjct: 799 LPPAPNISAEPPPPP 813 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPP-PPXXPXPXPPXPPPPP 944 P P P PP P P PP PP PP P PP Sbjct: 738 PSPSEVTTKSPPAPPLPPKVTPKPPAPPQFAPVPPPCAPIPP 779 Score = 33.1 bits (72), Expect = 0.34 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP-PPXP 951 T PP P PP PP P P PPP P P P P PP P Sbjct: 744 TTKSPPAPPLPP----KVTPKPPAPPQFAP-VPPPCAPIPPMPCSAPLPPAP 790 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P P P P PP PP PPP Sbjct: 771 PPPCAPIPPMPCSAPLPPAPAPFSAAPHLPPAPNISAEPPPPPP 814 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 T PPPP P P P PP PPP P P Sbjct: 846 TAEPPPPPPVARKPSRSNSTSSQQSIESAPGSPPTGADDFPPPPPPP 892 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PPP P P P P P P P Sbjct: 748 PPAP-PLPPKVTPKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAP 792 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP P PP P P PPP Sbjct: 748 PPAPPLPPKVTPKPPAPPQFAPVPPP 773 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP PP PPP P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 35.5 bits (78), Expect = 0.064 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PPPP P P PP P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKP 98 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PPP PPPP PP PPPP Sbjct: 73 PPPLCAPPPPPPPP------PPPPPPP 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPP 926 PP P PPP PPPP P P Sbjct: 80 PPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PPP PPPP P P P P Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP PPP PPPP P P P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP 897 PPPP P PP P PPPP P P Sbjct: 79 PPPPPPPPPPP-------PPPPGAKKPDDP 101 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 PP P PP P PPP P P Sbjct: 74 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 101 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 37.5 bits (83), Expect = 0.016 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 2/77 (2%) Frame = +1 Query: 727 LPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP- 903 +P T PP P +F + T PP P PP P P P PPP Sbjct: 508 VPTTVTAPPAAPPPSVFAPSSGVPTPVTEPP-PAPPPSVFAPSSGVPTPVTAPPPAPPPS 566 Query: 904 -XPPXXPPPXPXPPPXP 951 P P P P P Sbjct: 567 VFAPSSAVPTPATAPPP 583 Score = 33.9 bits (74), Expect = 0.19 Identities = 20/72 (27%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +1 Query: 727 LPXNQTXPPXIPXXPIFXLXAXRXTXXP-PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 +P PP P +F + T PPP P PPP P Sbjct: 392 VPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFASSSGVP 451 Query: 904 XPPXXPPPXPXP 939 P PPP P P Sbjct: 452 TPVTAPPPAPPP 463 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/72 (27%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +1 Query: 727 LPXNQTXPPXIPXXPIFXLXAXRXTXXP-PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 +P T PP P +F + T PPP P PPP P P Sbjct: 450 VPTPVTAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVP 509 Query: 904 XPPXXPPPXPXP 939 PP P P Sbjct: 510 TTVTAPPAAPPP 521 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP + P P PP PPP P P P Sbjct: 537 PPPAPPPSVFAPSSGVPTPVTAPPPAPPPSVFAPSSAVPTP 577 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/79 (26%), Positives = 24/79 (30%), Gaps = 4/79 (5%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P +P T PP + P + P P PP P P P PP Sbjct: 348 PAVPTPATAPPPVVAPPPSVFASSSGV---PTPVKAPPPSVFASSSGVPTPVAAPPPAPP 404 Query: 901 P----XPPXXPPPXPXPPP 945 P P P PPP Sbjct: 405 PSVFAPSSGVPTPVAAPPP 423 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/71 (26%), Positives = 21/71 (29%), Gaps = 3/71 (4%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP---PXPPXX 918 P P +F + T PP PP P P P PP Sbjct: 493 PVAAPPPSVFAPSSGVPTTVTAPPAAPPPSVFAPSSGVPTPVTEPPPAPPPSVFAPSSGV 552 Query: 919 PPPXPXPPPXP 951 P P PPP P Sbjct: 553 PTPVTAPPPAP 563 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPP P PPP P P P PPP P Sbjct: 461 PPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPVAAPPPSVFAP 504 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P T P PP PP P P P PPP Sbjct: 321 PQMVAPSSTVTPPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPP 365 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 5/65 (7%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP-----PPPXXXXPXXPPPXPP 912 P P +F + T PP PP P PPP P P P Sbjct: 377 PVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTPVAAPPPSVFAPSSGVPTPV 436 Query: 913 XXPPP 927 PPP Sbjct: 437 AAPPP 441 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP + P P PP PPP P P P Sbjct: 377 PVKAPPPSVFASSSGVPTPVAAPPPAPPPSVFAPSSGVPTP 417 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP + P P PP PPP P P P Sbjct: 435 PVAAPPPSVFASSSGVPTPVTAPPPAPPPSVFAPSSGVPTP 475 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 37.5 bits (83), Expect = 0.016 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 5/44 (11%) Frame = +3 Query: 822 PXPPXTXXXXXPX---PPXPXXPPP--XPPPPXXPXPXPPXPPP 938 P PP T P PP P PPP P PP P PP PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 37.1 bits (82), Expect = 0.021 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PPP P PP P PP Sbjct: 124 PPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PPPP PP P PPPP P PP P PP Sbjct: 131 PPPPVTPPPGPET-----PPPPDTPAPPVPPTEAPPTAPP 165 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP 926 P P PP T PP P P P PP P PP Sbjct: 126 PTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXPXPPPXP 951 PPP PP P PPP P PPP P P PP PP P Sbjct: 124 PPPTGTLPPPPVT------PPPGPETP--PPPDTPAPPVPPTEAPPTAP 164 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXP-PPXPPXXPPPXPXP 939 PPP P P P P P P PP PP PP P Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP P P P PP P Sbjct: 123 PPPPTGTLP--PPPVTPPPGPETPPPPDTP 150 Score = 29.9 bits (64), Expect = 3.2 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP P P P PP PP P PP Sbjct: 131 PPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 37.5 bits (83), Expect = 0.016 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP PP PPP P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 35.5 bits (78), Expect = 0.064 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PPPP P P PP P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKP 299 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PPP PPPP PP PPPP Sbjct: 274 PPPLCAPPPPPPPP------PPPPPPP 294 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPP 926 PP P PPP PPPP P P Sbjct: 281 PPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PPP PPPP P P P P Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP PPP PPPP P P P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP 897 PPPP P PP P PPPP P P Sbjct: 280 PPPPPPPPPPP-------PPPPGAKKPDDP 302 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 PP P PP P PPP P P Sbjct: 275 PPLCAPPPPPPPPPPPPPPPGAKKPDDP 302 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P PP PP P PP P PP PPP Sbjct: 363 PPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 36.7 bits (81), Expect = 0.028 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P P PP P PPPP P P PPP Sbjct: 365 PIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPX---PPPPXXPXPXPPXPPPPP 944 P P PP P PPP PPP PP PPPP Sbjct: 380 PHVPPPMIGPVTVPPPPLIPPPQASIPPPTMIQTLPPPSVPPPP 423 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPP--PXXXXPXXPPP--XPPXXPPPXPXPPP 945 PPP P PPP P P PPP P PPP PPP Sbjct: 353 PPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPPLIPPP 401 Score = 33.5 bits (73), Expect = 0.26 Identities = 25/69 (36%), Positives = 26/69 (37%), Gaps = 3/69 (4%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPP---PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXX 918 PP IP P + A PPP P PP P PPP P PP Sbjct: 364 PPIIPIPPP-AMPAMFNPHVPPPMIGPVTVPPPPLI------PPPQASIP--PPTMIQTL 414 Query: 919 PPPXPXPPP 945 PPP PPP Sbjct: 415 PPPSVPPPP 423 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP------XPPPP 941 P PP P PP PPP P P PP PPPP Sbjct: 349 PVIVPPPNLLFSFPPPPIIPIPPPAMPAMFNPHVPPPMIGPVTVPPPP 396 >SB_12027| Best HMM Match : Extensin_2 (HMM E-Value=0.2) Length = 1706 Score = 37.5 bits (83), Expect = 0.016 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP P PPP PP P P PP PP P Sbjct: 1259 PPLPPLPPPDAQPPSLP-PQPPQPPQP 1284 Score = 34.3 bits (75), Expect = 0.15 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 882 PPXPPPPXXPXPXPPXPPPPP 944 PP PPP P PP PP PP Sbjct: 1262 PPLPPPDAQPPSLPPQPPQPP 1282 >SB_45304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 37.1 bits (82), Expect = 0.021 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGGGG G G G GGGG GG G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GGG G GGG G GG G GG G Sbjct: 468 GGFGGGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 Score = 33.1 bits (72), Expect = 0.34 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG 864 G GGG G GGG GG G GGG Sbjct: 478 GAGGGGGGGGGYSGGASGSRSNSCGGGGG 506 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGG-GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GG G GG GG G GG G GGGG Sbjct: 440 GSRGTGGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGG 488 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG GG GG GG GG G Sbjct: 471 GGGGGPNGAGGGGGGGGGYSGGASG 495 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GG G GG G GGG G GG G GG Sbjct: 455 GGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/34 (50%), Positives = 17/34 (50%), Gaps = 4/34 (11%) Frame = -2 Query: 950 GXGG--GXGXGGGXXGGXGGGXXG--XXXXGGGG 861 G GG G G GGG GG GG G GGGG Sbjct: 472 GGGGPNGAGGGGGGGGGYSGGASGSRSNSCGGGG 505 Score = 29.5 bits (63), Expect = 4.2 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GG G GGGG G GG G GG Sbjct: 446 GEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGG 492 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GG G GG GGGG G GG G GG + R Sbjct: 445 GGEGGKSFLAGGAGGRSNQNDVEGGFGGGGGPNGAGGGGGGGGGYSGGASGSR 497 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG G GG G G Sbjct: 482 GGGGGGGYSGGASGSRSNSCGGGGGSYNAG 511 >SB_30371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 955 Score = 37.1 bits (82), Expect = 0.021 Identities = 22/74 (29%), Positives = 24/74 (32%), Gaps = 3/74 (4%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP---XXPPPXP 909 ++ PP P R T PPPP P P PPP P PPP P Sbjct: 510 ESPPPIPPIRCSSVSRPVRPTGPPPPPVPKPQFDDTPTRAPPPPDMQTNPDTERRPPPLP 569 Query: 910 PXXPPPXPXPPPXP 951 P P P Sbjct: 570 PAPKRALDLKPNLP 583 >SB_5678| Best HMM Match : Rick_17kDa_Anti (HMM E-Value=1.3) Length = 292 Score = 37.1 bits (82), Expect = 0.021 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 2/49 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGG 810 G GGG GGG GG G G G GGG G G GGG Sbjct: 133 GMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGG 181 Score = 36.7 bits (81), Expect = 0.028 Identities = 23/47 (48%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGG 810 GGG G GG GG GGG G G GGG G GG G GGG Sbjct: 141 GGGMG-GGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGG-GMGGG 185 Score = 36.3 bits (80), Expect = 0.036 Identities = 27/81 (33%), Positives = 30/81 (37%), Gaps = 4/81 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG----GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAX 783 G G G G GGG GG GG G G GGG G G G GG Sbjct: 179 GGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMGFNGMEDGGKEGGMGGG 238 Query: 782 RXKIGXXGXXGGXVWLXGRMG 720 ++G GG + G MG Sbjct: 239 MLQMGDSN--GGGMSEMGNMG 257 Score = 35.9 bits (79), Expect = 0.048 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG--GGG 807 GGG GG GGG G G GG G G G G GGG Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGG 216 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG G G GGG GGG GG G + GG G Sbjct: 129 GGEGGMGGGMSMGGGMGGG-MSMGGMGGGMGGMMGGGSMG 167 Score = 35.5 bits (78), Expect = 0.064 Identities = 29/85 (34%), Positives = 31/85 (36%), Gaps = 5/85 (5%) Frame = -2 Query: 950 GXGGGX---GXGGGXXGGXGGG--XXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G GGG G GGG G GGG G GG GG G + Sbjct: 143 GMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGM 202 Query: 785 XRXKIGXXGXXGGXVWLXGRMGTXG 711 G GG + G MG G Sbjct: 203 QGMGSMGGGMMGGG--MGGGMGFNG 225 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GG GGG G G + GG G G G Sbjct: 145 GGGMSMGGMGGGM--GGMMGGGSMGGGMMSMAGGGMGGGMGGGMGG 188 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG-XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G GG GGG G G GG G G GGG Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGG 177 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = -3 Query: 943 GGGGGXGGX---GXGXXGG---GGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG GG G G GG GG GGG G G G + G G G Sbjct: 129 GGEGGMGGGMSMGGGMGGGMSMGGMGGGMGGMMGGGSMGGGMMSMAGGGMGG 180 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G GGG GG G G GG G G G Sbjct: 141 GGGMGGGMSMGGMGGG-MGGMMGGGSMGGGMMSMAGGGMGGGMGG 184 Score = 31.5 bits (68), Expect = 1.0 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G G GGG GGG G G G + GG G G Sbjct: 162 GGGSMGGGMMSMAGGGMGGGMGGGMGGG-----MEGGMGGG 197 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/48 (41%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = -3 Query: 937 GGGXGGXGXGXXGG---GGXGGG-XXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G GG GG GGG G G G + GG G G Sbjct: 175 GGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMGGGMGGGMG 222 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 1/47 (2%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXV-XGGXGXGXXG 806 GG G G G GGG GGG G G G G G G G Sbjct: 168 GGMMSMAGGGMGGGMGGGMGGGMEGGMGGGMMEGMQGMGSMGGGMMG 214 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 37.1 bits (82), Expect = 0.021 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +3 Query: 831 PXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP---XPPPPP 944 P + P PP P PP PP P PP PPPPP Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPP 890 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP P P P P PP P PP P Sbjct: 850 PLSPSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRP 892 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/61 (26%), Positives = 19/61 (31%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P+ P PP +P P + PPPP P P P PP Sbjct: 858 PLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKPPPPPP 917 Query: 901 P 903 P Sbjct: 918 P 918 Score = 29.1 bits (62), Expect = 5.5 Identities = 20/81 (24%), Positives = 23/81 (28%), Gaps = 1/81 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P PI ++ P + T P P PP P P Sbjct: 810 PTEPIYINRKSLSSPEPESAVELSRPDSLTMEAPTTKTDRPLSPSAPPPLPPRPVGAPPS 869 Query: 892 XPP-PXPPXXPPPXPXPPPXP 951 PP P PP PPP P Sbjct: 870 LPPRPRTRPLPPKSDTPPPPP 890 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 37.1 bits (82), Expect = 0.021 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXP--PPPP 944 P PP PPP PP P P PP PPPP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPP 212 Score = 36.7 bits (81), Expect = 0.028 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP P P P PP P PP P PP PP Sbjct: 179 PPPAPPGVLA---PPPAPPGVLPPPPAPPGALIPPPPAPP 215 Score = 34.3 bits (75), Expect = 0.15 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPP PPP PP PP P PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PP P P PP PPP Sbjct: 174 PGILAPPPAPPGVLAPPPAPPGVLPPP 200 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P P PP P PP P PP P PP Sbjct: 180 PPAPPGVLAPPPAPPGVLPP--PPAPPGALIPPPPAPP 215 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PPP P PP P PP Sbjct: 179 PPPAPPGVLAPPPAPPGVLPPPPAPP 204 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 P PP P P PPP PPP PP Sbjct: 181 PAPPGVLAPPPAPPGVLPPPPAPPGALIPPPPAPP 215 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 36.7 bits (81), Expect = 0.028 Identities = 22/60 (36%), Positives = 23/60 (38%) Frame = +1 Query: 760 PXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P P+F A PPPP P PP P P P P PP PP P P P Sbjct: 1652 PWYPVFHYPAP---PPPPPPAPGPPGP-DGPMGLPGPQGPDGPKG-PPGPPGLPGPQGIP 1706 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 7/53 (13%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-----PXPPPPXXP--XPXPPXPPPPP 944 P P P P P P PP P PP P P P P PP PP Sbjct: 1797 PGPPGPPGPPGAIGWKGNPGNPAGPPGLDGPPGPPGPQGPKGWPGVPGPPGPP 1849 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P PP P PP P P P P P PP P Sbjct: 1660 PAPPPPPPPAPG-------PPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PP P P P P P P Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGP 1684 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP-XPPXPPPPP 944 P P PP P PP P P P P P PP PP P Sbjct: 1660 PAPPPP---PPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLP 1700 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPP 943 P P P PP PPP P PP Sbjct: 1652 PWYPVFHYPAPPPPPPPAPGPP 1673 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPP 942 P P PPP PP PP P P Sbjct: 1655 PVFHYPAPPPPPPPAPGPPGPDGP 1678 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 3/48 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXX-PXPPXPXXP--PPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P P PP PP P P P P Sbjct: 1665 PPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAP 1712 >SB_29605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 36.7 bits (81), Expect = 0.028 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGG-GXXGXGGXGXXXXXVXGGXGXG 815 GG G GG G GG G GG G G GG G G G G Sbjct: 37 GGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDG 79 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 G GG G G GG G G G GG G G GG G G Sbjct: 35 GQGGNGQGGDGQAGQGGNGQGGDGQAGQGGNGQGGDGPAGQGGDGPG 81 >SB_28771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.028 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXG 869 GGGG G G G GGGG GGG G Sbjct: 5 GGGGDGDGGDGDGGGGGDGGGDGG 28 Score = 31.9 bits (69), Expect = 0.78 Identities = 26/76 (34%), Positives = 29/76 (38%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GGG G GG GG GGG GG G G G G G + E G Sbjct: 6 GGGDGDGGDGDGG-GGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDG-----GVDCERGG 59 Query: 765 XGNXWGGCLVXGEDGD 718 G+ GG G+D D Sbjct: 60 DGDVDGG--GDGDDDD 73 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXG--XXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GG G G G G G GGG G G G GG G GG + R Sbjct: 2 GYDGGGGDGDGGDGDGGGGGDGGGDGGDCDGDGGDCDGGDDDGGDDGGDGGVDCER 57 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG G G G G G Sbjct: 15 GDGGGGGDGGGDGGDCDGDGGDCDGGDDDG 44 >SB_43135| Best HMM Match : CMAS (HMM E-Value=0) Length = 254 Score = 36.3 bits (80), Expect = 0.036 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -2 Query: 272 DQVTDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSYGNIIIHQDESR 126 DQ+ I+ F+ G++ WP + + S R + GG+ + II DESR Sbjct: 102 DQIVSIEMFEAVGQENWPTYFQMLSERLKQGGSAVLQ----IICIDESR 146 >SB_42034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 504 Score = 36.3 bits (80), Expect = 0.036 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 PPP PPP PP PPPPP Sbjct: 7 PPPPPPPIAAEFTAPPAPPPPP 28 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP PP P PPP P Sbjct: 5 PPPP----PPPPPIAAEFTAPPAPPPPPNP 30 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP PP PP PPP P P Sbjct: 9 PPPPPIAAEFTAPPAPP--PPPNPAP 32 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP P PP P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPPPNPAP 32 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP 897 PPPP P P PPPP P P Sbjct: 6 PPPPPPPPIAAEFTAPPAPPPPPNPAPDVP 35 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 7/33 (21%) Frame = +3 Query: 855 PXPPXPXXP-------PPXPPPPXXPXPXPPXP 932 P PP P P PP PPPP P P P P Sbjct: 5 PPPPPPPPPIAAEFTAPPAPPPP--PNPAPDVP 35 >SB_49222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 36.3 bits (80), Expect = 0.036 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGG GG G G GG GGG G GG Sbjct: 58 GGGGQGGGQGVGGQEVGGQGGGGQGVGG 85 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G GG G GGGG G G GG G Sbjct: 63 GGGQGVGGQEVGGQGGGGQGVGGQEVGGQG 92 Score = 32.7 bits (71), Expect = 0.45 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GG GG GGG G GG Sbjct: 61 GQGGGQGVGGQEVGGQGGGGQGVGGQEVGG 90 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GGG GG G G GGGG G GG GG G Sbjct: 51 GQGVGGQGGGGQGGGQGVGGQEVGGQGGGG------QGVGGQEVGGQG 92 >SB_32722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 603 Score = 36.3 bits (80), Expect = 0.036 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP-PXPPPPP 944 PP P PP P PP PPP P P P PP PP Sbjct: 423 PPGGGVPSHP-PPLPQPPPSIIPPPTTPLPQTVPTPPRPP 461 >SB_11533| Best HMM Match : Baculo_PEP_C (HMM E-Value=3.6) Length = 491 Score = 35.9 bits (79), Expect = 0.048 Identities = 18/27 (66%), Positives = 18/27 (66%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGG GG G G GGGG GG G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNG 346 Score = 35.9 bits (79), Expect = 0.048 Identities = 16/22 (72%), Positives = 16/22 (72%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GGGGG GG G G GGGG GGG Sbjct: 320 GGGGGGGGGGGG--GGGGGGGG 339 Score = 34.3 bits (75), Expect = 0.15 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG-----XXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G G G G G G G Sbjct: 320 GGGGGGGGGGGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDG 371 Score = 28.3 bits (60), Expect = 9.6 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 5/55 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG-----GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GGG G G G G G G G G G N Sbjct: 329 GGGGGGGGGGGDXXXXNGDDDDDGNGNGDDDGDGNGDDDDGDGDGDDGDGDDGDN 383 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 35.9 bits (79), Expect = 0.048 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG GG GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRGGARG 1027 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGGG GG G G Sbjct: 1003 GGGGGG-GGGGGGGGGRRGGRGGARG 1027 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXG 854 G G GGGG GGG GG G Sbjct: 1003 GGGGGGGGGGGGGGGRRGGRG 1023 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 35.9 bits (79), Expect = 0.048 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPP P PP PPP Sbjct: 431 PPTPPPTPPPTPPPTTLPPTTQPPP 455 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P PPP PPP P P P P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PP PP PP PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P PP P PPP P Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQPPPQP 457 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P PP T P PP PP PPP Sbjct: 430 PPPTPPPT---PPPTPPPTTLPPTTQPPP 455 >SB_15225| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 246 Score = 35.9 bits (79), Expect = 0.048 Identities = 25/70 (35%), Positives = 25/70 (35%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRX 777 G GG GGG G G G G GGGG G G G GGG R Sbjct: 37 GIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRG 96 Query: 776 KIGXXGXXGG 747 I G GG Sbjct: 97 GIAGEGMGGG 106 Score = 33.5 bits (73), Expect = 0.26 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG--GXGXGGG 810 G G G GG G GGG GGGG G G G G GG Sbjct: 130 GEGMGRGGMAGEGMGGGGMAGEGMGGGGMAGEGMGGGGIAGEGISGG 176 Score = 32.7 bits (71), Expect = 0.45 Identities = 41/147 (27%), Positives = 44/147 (29%), Gaps = 3/147 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G G GG G G GG G GGG G G G GGGG R Sbjct: 18 GWRGQHSRGGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGM-AGEGMGRG 76 Query: 776 KIGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPS 597 + G GG + G MG G G G R G+ Sbjct: 77 GMAGEGMGGGGMAGEG-MGRGGIAGEGMGGGGMAGEGMSRGGIAGEGMGRGGMAGEG--- 132 Query: 596 IKGXXXAXGTXXXGGGXGGXG-GGXXM 519 G G GGG G G GG M Sbjct: 133 -MGRGGMAGEGMGGGGMAGEGMGGGGM 158 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 940 GGGGXGGXGXGXXG--GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G G G GGG G G G G G G Sbjct: 44 GGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGMAGEGMGGGGMAG 90 Score = 32.7 bits (71), Expect = 0.45 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = -3 Query: 940 GGGGXGGXGXGXXG--GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G G G GGG G G G G G G Sbjct: 64 GGGGMAGEGMGRGGMAGEGMGGGGMAGEGMGRGGIAGEGMGGGGMAG 110 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = -3 Query: 940 GGGGXGGXGXGXXG--GGGXGGGXXGXGGXGXXXXXVXG-GXGXG 815 GGGG G G G G G G GGG G G G + G G G G Sbjct: 84 GGGGMAGEGMGRGGIAGEGMGGG--GMAGEGMSRGGIAGEGMGRG 126 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG GGG G G G G G G Sbjct: 26 GGMAGEGMGRGGIAGGRMGGGGMAGEGMGRGGMAGEGMGGGGMAG 70 >SB_34906| Best HMM Match : Cadherin (HMM E-Value=0) Length = 3922 Score = 35.5 bits (78), Expect = 0.064 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 GGG G GGG GG GGG G G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG GG G G GGGG G G G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 Score = 29.1 bits (62), Expect = 5.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG GGG G GG G GG G Sbjct: 3698 GGGYGGGGGGYGGGGGGYGDGTGGAAFG 3725 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG-XGGXGXGGGG 807 GG GGG GG GG G GG G GG G GGG Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGG 149 Score = 35.5 bits (78), Expect = 0.064 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GG GGG GG G G GGGG G GG GG Sbjct: 115 GEAGGQAGGGGQAGGQAGSQAGGGAAGGGG---QEGGGQGGAQAGG 157 Score = 33.9 bits (74), Expect = 0.19 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 GGG GGG G GG GG G G GGG + A G Sbjct: 141 GGGGQEGGGQGGAQAGGSTSGSSSGGATSGGGGVSGSSGTSIAGGGSSAGAGAGATSAG 199 Score = 31.9 bits (69), Expect = 0.78 Identities = 23/78 (29%), Positives = 23/78 (29%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G GG GG GG G G G G G GG Sbjct: 105 GTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEGGGQGGAQAGGSTSGSSS 164 Query: 770 GXXGXXGGXVWLXGRMGT 717 G GG V G GT Sbjct: 165 GGATSGGGGV--SGSSGT 180 >SB_53638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.064 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G G GGG G GGGG G GG GGG Sbjct: 60 GDDGGAGGGAGGDDDDGGGISGCGDGGGGG------GGAGGDDDDGGG 101 Score = 34.7 bits (76), Expect = 0.11 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = -2 Query: 938 GXGXGG---GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GG G GG GGG G GGG G GG G GG G Sbjct: 51 GCGDGGDDCGDDGGAGGGAGGDDDDGGG----ISGCGDGGGGGGGAG 93 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG G G G GGG G G G GG G GG G Sbjct: 63 GGAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 G G G GG G G G GGGG G GG Sbjct: 64 GAGGGAGGDDDDGGGISGCGDGGGGGGGAGGDDDDGGGG 102 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 35.5 bits (78), Expect = 0.064 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 882 PPXPPPPXXPXPX--PPXPPPPP 944 PP PPPP P PP PPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPPP 777 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = +1 Query: 787 AXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 A + + PP P PP P P PP PP P PPP P Sbjct: 675 ARKSSPSSAPPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP P PP PPPPP Sbjct: 684 PPPPAPPPPPIGGGDPTIWVSGGPPLSAPPLSSTLGPPPPAPPPPP 729 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 PPP PPP P PPPPP Sbjct: 755 PPPPPPPAVPGEGARPPPPPPP 776 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 9/60 (15%) Frame = +1 Query: 799 TXXPPPPXPXPPX------PXXXXXXXPPPPXXXXPXXPPPXPPXXPP---PXPXPPPXP 951 T PPPP P PP P PPP PP P P PPP P Sbjct: 717 TLGPPPPAPPPPPLGRDSAAVFMLTWTPLTNTSSAANVPPPPPPPAVPGEGARPPPPPPP 776 >SB_36275| Best HMM Match : Extensin_2 (HMM E-Value=0.062) Length = 406 Score = 35.5 bits (78), Expect = 0.064 Identities = 32/110 (29%), Positives = 36/110 (32%), Gaps = 9/110 (8%) Frame = +1 Query: 649 TPXLXCPXPTXLSXKFRHALXPXV--PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX 822 TP P PT ++H P P P + +P L T PP P Sbjct: 191 TPHTSIP-PTP-RPTYKHPSYPSYKHPSYPSSHIQASLLPHIQASLLPLIPNTSIPPTPT 248 Query: 823 P---XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP----PPXP 951 P PP P PP P P P P PP P P PP P Sbjct: 249 PHTSIPPTP-TPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTP 297 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 3/50 (6%) Frame = +1 Query: 799 TXXPPPPXP---XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 T PP P P PP P PP P P P P PP P P Sbjct: 251 TSIPPTPTPHTSIPPTP-TPHTSIPPTPTPHTSIPPTPTPHTSIPPTPHP 299 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PP P P P PP P P P P P P P P Sbjct: 160 TSIPPTPHPTYKHPSYPTYNIPPTPHTSIPPTPHTSIPPTPRPTYKHPSYP 210 Score = 29.9 bits (64), Expect = 3.2 Identities = 22/83 (26%), Positives = 25/83 (30%), Gaps = 3/83 (3%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPP 870 H +P++P P P I T PP P P PP P PP Sbjct: 229 HIQASLLPLIPNTSIPPTPTPHTSIPPTPTPH-TSIPPTPTPHTSIPPTPTPHTSI-PPT 286 Query: 871 PXXXXPXXPPPXPPXXPPPXPXP 939 P P P P P P Sbjct: 287 PTPHTSIPPTPHPTYKHPSYSYP 309 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P T PP P PP P PP P P Sbjct: 236 PLIPNTSIPPTPTPHTSIPPTPTPHTSIPPTPTPHTSIPPTPTP 279 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 35.5 bits (78), Expect = 0.064 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P PP P PP PP P P PP P Sbjct: 259 PSPPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYP 307 Score = 34.7 bits (76), Expect = 0.11 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 5/82 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP--PPPXXXXPXX 894 P P PP P P PP P PP P P P P Sbjct: 294 PSPPRYPPSPPRYP--PSLHRYPQSPLRYPPSPIRYPPLPSRYPPSPPRYPSSHPRYPPS 351 Query: 895 PP---PXPPXXPPPXPXPPPXP 951 PP P PP P P PP P Sbjct: 352 PPRYPPSPPRYPSSHPRYPPSP 373 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP-PPXXPXPXPPXPPPP 941 P P PP P P PP PP PP P P PP P Sbjct: 328 PPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSP 373 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXX--PXXPPXPPPXPPXXPPPXPXPPP 946 PP P P P PP PP PP PP P PP Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPX--PXXPXXPPXPPPXPPXXPPPXPXPPP 946 PP P P P P PP PP PP P P PP Sbjct: 328 PPLPSRYPPSPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPP 371 Score = 31.1 bits (67), Expect = 1.4 Identities = 26/88 (29%), Positives = 28/88 (31%), Gaps = 3/88 (3%) Frame = +1 Query: 697 RHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPX 876 R P P P + P IP P + R PP P PP PP Sbjct: 254 RDCYLPSPPRYPPSPLRYPPIP--PRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPPS-L 310 Query: 877 XXXPXXP---PPXPPXXPPPXPXPPPXP 951 P P PP P PP PP P Sbjct: 311 HRYPQSPLRYPPSPIRYPPLPSRYPPSP 338 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PP PP P P PP PP Sbjct: 265 PPSPLRYPPIPPRYPPSLIRYPTLPPRYPPSPPRYPPSPPRYPP 308 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 35.1 bits (77), Expect = 0.084 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PP PP PP P P P PPPP Sbjct: 208 PPNAPPGLMPPPGMLPPPGGMPPGRMPPQGLPFPPPGPIPPPP 250 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P PP PPP P PPP Sbjct: 223 PPPGGMPPGRMPPQGLPFPPPGPIPPP 249 >SB_36422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 35.1 bits (77), Expect = 0.084 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = +3 Query: 879 PPPXPP-PPXXPXPXPPXPPPPP 944 PP PP PP P P PP PPPPP Sbjct: 29 PPEAPPLPPFAPLP-PPVPPPPP 50 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP PP PP P P P PPP Sbjct: 29 PPEAPPLPPFAPLPPPVPPP 48 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPP 902 P PP PPP PPPP Sbjct: 34 PLPPFAPLPPPVPPPP 49 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPP 935 P PP PP P P PP PP Sbjct: 29 PPEAPPLPPFAPLPPPVPPPPP 50 >SB_26709| Best HMM Match : CtnDOT_TraJ (HMM E-Value=8.8) Length = 291 Score = 35.1 bits (77), Expect = 0.084 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG GG GG GGGG G GGGG Sbjct: 213 GYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGG 262 Score = 33.9 bits (74), Expect = 0.19 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GG G G GGGG G GG GGG Sbjct: 205 GRAGGMNSGYNGGPAPGAVGGFGGGGGGSEDNGASGGGGGYSGGG 249 Score = 32.7 bits (71), Expect = 0.45 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG G G GGG G GG GG Sbjct: 221 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGTHSGQAGGGGGSYCGG 267 >SB_18621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 34.7 bits (76), Expect = 0.11 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 GGG G G GG GGG GGG GG G G Sbjct: 46 GGGVGDDDGGGGGCGGGDDDDDGGGGGDDDDDDDDDDGGGGGG 88 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GG G G GGGG G GGG Sbjct: 46 GGGVGDDDGGGGGCGGGDDDDDGGGGGDDDDDDDDDDGGGGGG 88 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 34.7 bits (76), Expect = 0.11 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G G GG GG G G G GG G G GGG Sbjct: 204 GRGRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYGDSYGSYGGGGG 250 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG G GGG GG GGG GG G G Sbjct: 200 GGYGGRGRGGGGRGGYGGG-GGYGGYGG 226 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GG G GGG G GGG G G GG G Sbjct: 197 GGRGGYGGR--GRGGGGRGGYGGGGGYGGYGGYDQYSGGGYGGYG 239 >SB_4609| Best HMM Match : EGF (HMM E-Value=8.9e-07) Length = 287 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -1 Query: 942 GGXGXGGGXXGGXGGGXGGXXGXXGXG 862 GG G GGG G GGG GG G G G Sbjct: 259 GGFGGGGGACGCNGGGAGGGGGYSGGG 285 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GGGG G G G GGGG GG Sbjct: 263 GGGGACGCNGGGAGGGGGYSGG 284 Score = 29.1 bits (62), Expect = 5.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG 863 G GGG G G GG G GGG G G Sbjct: 260 GFGGGGGACGCN-GGGAGGGGGYSGGG 285 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GG G GG GG GG GG Sbjct: 263 GGGGACGCNGGGAGGGGGYSGG 284 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G G GG GGG G G Sbjct: 260 GFGGGGGACGCNGGGAGGGGGYSGG 284 >SB_5386| Best HMM Match : GRP (HMM E-Value=0.012) Length = 800 Score = 34.7 bits (76), Expect = 0.11 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G G GGG GGG G G G G G G G Sbjct: 337 GGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHG-GGDHGDGDHG 381 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G G G G GGG GGG G G G Sbjct: 367 GGDHGGGDHGDGDHGGGDHGGGDHGGGDHG 396 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G G G G GGG GGG G G G Sbjct: 372 GGDHGDGDHGGGDHGGGDHGGGDHGGGDYG 401 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GGG GGG G G G G G G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPG-GGDPGGGDHG 366 Score = 33.5 bits (73), Expect = 0.26 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGX--GGGXXGXXXXGGG--GXXXXXXXGXGGXGXGGG 810 G GG GGG GG GGG G GGG G GG GGG Sbjct: 343 GDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGG 393 Score = 32.7 bits (71), Expect = 0.45 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGG--GXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G G G GGG GGG G G G G G G G Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPG-GGDHGGGDHG 371 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGG 807 GGG GG GG GGG G GGG G G G GGG Sbjct: 336 GGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGG 383 Score = 32.3 bits (70), Expect = 0.59 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGG--GXXXXXXXGXGGXGXGGG 810 GGG GG GG GGG G GGG G GG GGG Sbjct: 341 GGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHGGG 388 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G G GGG GGG G G G Sbjct: 378 GDHGGGDHGGGDHGGGDHGGGDYGDGDHG 406 Score = 31.1 bits (67), Expect = 1.4 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GG GGG G GGG G G G GGG Sbjct: 356 GGGDPGGGDHGGGDHGGGDHGDGDHGGG----DHGGGDHGGGDHGGG 398 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG--GXXXXXXXGXGGXGXGGG 810 G G G G G GGG G GGG G GG GGG Sbjct: 325 GGDGDHGDGDHGGGDPGGGDPGGGDPGGGDPGGGDPGGGDHGGGDHGGG 373 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGX--GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GGG GG GGG G GGG G G G GGG Sbjct: 328 GDHGDGDHGGGDPGGGDPGGGDPGGGDPGGG----DPGGGDHGGGDHGGG 373 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG-XGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G GGG GGG G G G G G G G Sbjct: 351 GGGDPGGGDPGGGDHGGGDHGGGDHGDGDHGGGDHG-GGDHGGGDHG 396 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GG G GGG G G G G G Sbjct: 361 GGGDHGGGDHGGGDHGDGDHGGGDHGGGDHGGGDHGGGDYGDGDHG 406 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GG GG GG GG GG G GG Sbjct: 777 GGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGG 822 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG GG G GG GG G GG Sbjct: 788 GGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGG 833 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GG GG G GG GG G GG Sbjct: 771 GAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGG 818 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G G G G G GG G GG G G Sbjct: 778 GASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASG 825 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G G GG G G GG G G G G Sbjct: 789 GANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASG 836 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXA 791 GG G G G GG GG GG GG G G + A Sbjct: 763 GGDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGA 812 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G G G GG G GG GG G G Sbjct: 782 GAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAG 828 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG-GGXN 801 G G G G GG GG G GG GG G GG N Sbjct: 793 GAGSSSGGASGGAGGSSGGASGGAGGSSGGASGGAGSSSGGASGGADGGSN 843 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GG GG G GG GG G GG Sbjct: 764 GDGHASSGAGSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGG 811 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXA 791 G G G G GG GG GG GG G G + A Sbjct: 773 GSSSGGASGGAGGSSGGANGGAGSSSGGASGGAGGSSGGASGGAGGSSGGA 823 >SB_44859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 650 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/53 (37%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP--PPPXXXXPXXP--PPXPPXXPPPXPX-PPPXP 951 PP PP P P PPP P P PP P PP P PP P Sbjct: 510 PPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 Score = 31.5 bits (68), Expect = 1.0 Identities = 24/82 (29%), Positives = 24/82 (29%), Gaps = 4/82 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXX--PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXX 885 P P P Q P P P PP P PP PP Sbjct: 174 PTQPFYPPTQPFYPPTPSSYPPTQPSYPPTAPSYPPTPSSYPPIAASY----PPTAPSYN 229 Query: 886 PXXP--PPXPPXXPPPXPXPPP 945 P P PP P PP P PP Sbjct: 230 PTAPSYPPTPSSYPPTQPSHPP 251 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 1/46 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP-XPXPPXPPPP 941 P P P P P PPP P PP P P P PP Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPP 552 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP-PXPXPPPXP 951 P P P P P P P PP P PP P PP P Sbjct: 507 PSYPPTQPSYPPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQP 555 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXX-PXXPPXPPPXPPXXPPPXPXPPP 946 PP P + P P P P PP P PP P PP Sbjct: 517 PPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPP 559 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 869 PXXPXXPPXP---PPXPPXXPPPXPXPPP 946 P P PP P PP P PP P PP Sbjct: 181 PTQPFYPPTPSSYPPTQPSYPPTAPSYPP 209 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/46 (30%), Positives = 14/46 (30%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P P P P P PP P Sbjct: 517 PPTPSSYLPTQPYYPPPQPYPPTQPSYPPTPSSYPPTQPSYPPTAP 562 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P P P PP PPPP P PPPP Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPP 69 Score = 31.5 bits (68), Expect = 1.0 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 12/60 (20%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP------XPPXXPP------PXPXPPPXP 951 PPPP P P P P PPP PP PP P PPP P Sbjct: 25 PPPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 Score = 29.5 bits (63), Expect = 4.2 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P R P PP P PPPP PP PPP Sbjct: 26 PPPPPTRPFERNIHPRTEPRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDD-YPPPPPPP 84 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 34.3 bits (75), Expect = 0.15 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 4/57 (7%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 R + P P PP P PPP P PPP PP PP PP P Sbjct: 2158 RHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGP 2214 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 PPP PP P PPP P PP PP PPP P P Sbjct: 2174 PPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPPSGSHSPAP 2224 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P P PP PPP P P P P Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAP 2190 Score = 33.5 bits (73), Expect = 0.26 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXP--PXPXXPPPXPPPPXXPXP--XPPXPPPP 941 P P P P P P PPP PP P P PP PPP Sbjct: 2151 PPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P PP PP PP P PPP Sbjct: 2151 PPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPP 2196 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP PPP P PP PP Sbjct: 2156 PARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.9 bits (64), Expect = 3.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +1 Query: 808 PPPPX------PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P P P PPP PP P PP PP Sbjct: 2150 PPPPMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.5 bits (63), Expect = 4.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXP--PXPXXPPPXPPPPXXPXPX--PPXPPPP 941 P PP P P P PPP PP P PP PPP Sbjct: 2171 PSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 Y P P P PP PP P P P P PP PPP Sbjct: 2121 YNTPPPMGQYGAPARPAMGPPPMGSSRY-GPPPPMGPARHSPSGPSPLGAPPSVPPP 2176 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P PP P PPPP P P PP PP Sbjct: 2133 PARPAMGPP-PMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPP 2176 Score = 28.3 bits (60), Expect = 9.6 Identities = 24/85 (28%), Positives = 29/85 (34%), Gaps = 3/85 (3%) Frame = +1 Query: 697 RHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPX-PXXXXXXXPPPP 873 R A+ P P + ++ PP P P + PP P P P PP Sbjct: 2135 RPAMGP--PPMGSSRYGPPP-PMGPARHSPSGPSPLGAPPSVPPPMGAPPSGPPPMGAPP 2191 Query: 874 XXXXPXXPPP--XPPXXPPPXPXPP 942 P PP PP PP PP Sbjct: 2192 SGPPPMGTPPSGHPPMGAPPMGPPP 2216 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/46 (32%), Positives = 15/46 (32%), Gaps = 1/46 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP-XPPXPPPP 941 P P P PP PP PPP P PP PP Sbjct: 2166 PLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 >SB_58920| Best HMM Match : GRP (HMM E-Value=0.35) Length = 243 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNV 798 G G GG G GGG GGGG G G G GGG V Sbjct: 98 GSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGGDDDGSNGGGVMV 146 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXP-PPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P PP P P P P PPP PPP PP Sbjct: 698 PLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/79 (30%), Positives = 27/79 (34%), Gaps = 11/79 (13%) Frame = +1 Query: 748 PPXIPXXPI-FXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPPP---XXXXPXXPPP 903 PP P P+ + + PPPP P P P PPPP P PP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Query: 904 ---XPPXXPPPXPXPPPXP 951 PP P PP P Sbjct: 741 SSKHPPTVSPSSSSAPPRP 759 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP P P P P PPPPP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPP 707 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P P P PPP P P PP Sbjct: 700 PLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPPPDESPP 740 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 861 PPXPXXPP-PXPPPPXXPXPXPPXPPP 938 PP PP P P P P PP PPP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPPP 707 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P P P PPP Sbjct: 682 PLTPPPPLPTPIASSEPLPLPPP 704 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P P P PPP Sbjct: 681 PPLTPPPPLPTPIASSEPLPLPPPPP 706 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G G G G GGGG GGG G GG Sbjct: 333 GSAGDGSGDRGFLGGGGGGGGSSGGGG 359 >SB_42356| Best HMM Match : PDZ (HMM E-Value=5.7e-19) Length = 619 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPP P P PP P P P PP PPP P Sbjct: 50 PPPPPTRPSHSCGPHPVPPTPLVQHPE--PEAPPQLPPPPP 88 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP--PPP 944 P P PP T P P P PP P P P PP PPP Sbjct: 45 PHYHQPPPPPTR------PSHSCGPHPVPPTPLVQHPEPEAPPQLPPP 86 Score = 28.7 bits (61), Expect = 7.3 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 4/47 (8%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPP----PPXXPXPXPPXPPPPP 944 P P PP T P P P PP PP P PP P P Sbjct: 63 PHPVPP-TPLVQHPEPEAPPQLPPPPPFIVDDTESPQEQPPTTPVSP 108 >SB_24696| Best HMM Match : F5_F8_type_C (HMM E-Value=0.00023) Length = 547 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGG-GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G GG GGG GGGG G GGGG Sbjct: 343 GYNGGPSPGAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGG 391 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/50 (38%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = -2 Query: 944 GGGXGX-GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 GG G G GG G G GGGG G GG G GGG + Sbjct: 334 GGRAGNMNSGYNGGPSPGAVGGFGGGGGGSEDNGASGGGG-GYSGGGSGI 382 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG G G GGG G GG G Sbjct: 351 GAVGGFGGGGGGSEDNGASGGGGGYSGGGSGITWNQAGGGGGSYCAG 397 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 2/26 (7%) Frame = +3 Query: 870 PXXPPP--XPPPPXXPXPXPPXPPPP 941 P PPP PPPP P PP P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPP 806 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP PP P P P Sbjct: 790 PPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%), Gaps = 4/39 (10%) Frame = +3 Query: 831 PXTXXXXXPXPPX----PXXPPPXPPPPXXPXPXPPXPP 935 P T P PP P PPP PP P P PP Sbjct: 781 PTTPPPEYPPPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PP P P P PP Sbjct: 790 PPPPGLARPNPPPPNPPLQVTSIPGEPAPP 819 Score = 28.3 bits (60), Expect = 9.6 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 14/60 (23%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXP------XPPXPXXPPPXPP----PPXXPXPXP----PXPPPPP 944 P P P PP T PP P PP P P P P P PPPPP Sbjct: 835 PFNPAPAPPITPDDTITRSAVHNLPPCPPDPPQRLPLVEACPGSPSVKPAIDWPPPPPPP 894 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXG 869 GGG GG G G GGGG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 33.1 bits (72), Expect = 0.34 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -1 Query: 942 GGXGXGGGXXGGXGGGXGG 886 GG G GGG GG GGG GG Sbjct: 514 GGGGGGGGGGGGGGGGRGG 532 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 925 GGXGXGXXGGGGXGGGXXGXG 863 GG G G GGGG GGG G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXG 854 G G GGGG GGG G GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXG 889 G GGG G GGG GG GG G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRG 534 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXG 862 GGG GG GGG GG G G G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXG 885 G GGG G GGG GG GG G Sbjct: 515 GGGGGGGGGGGGGGGRGGRGRG 536 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 922 GXGXGXXGGGGXGGGXXGXGGXG 854 G G G GGGG GGG G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGG 864 G GGG GG GGG G G G Sbjct: 514 GGGGGGGGGGGGGGGGRGGRGRG 536 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 33.9 bits (74), Expect = 0.19 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-PPPXXPXPXPPXPP 935 P P P PP P PPP P PPP P P P Sbjct: 511 PTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAPCNP 551 Score = 31.9 bits (69), Expect = 0.78 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 890 PXPPPXPPXXPPPXPXPPP 946 P P P P PPP P PPP Sbjct: 522 PAPQPPSPPAPPPKPAPPP 540 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PP P P P PP Sbjct: 522 PAPQPPSPPAPPPKPAPPPRSPP 544 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXP-PXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P + P P P PP PP P P PP P Sbjct: 504 PCAPSCAPTYSPSCCGSYPAPQPPSPPAPPPKPAPPPRSPPAAAP 548 Score = 28.7 bits (61), Expect(2) = 0.77 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P PP P P P P P P Sbjct: 522 PAPQPPSPPAPPPKPAPPP 540 Score = 21.8 bits (44), Expect(2) = 0.77 Identities = 10/33 (30%), Positives = 10/33 (30%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 PPP P PP P P P P Sbjct: 457 PPPPPPPPPQMYQQPLMMPQAPMMMPQAPMMMP 489 >SB_41600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 33.9 bits (74), Expect = 0.19 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P P PPP P PP P P Sbjct: 340 PLPPIPRTRPAMTPPPISPTTGPPKSPAP 368 >SB_34828| Best HMM Match : W2 (HMM E-Value=6.9) Length = 184 Score = 33.9 bits (74), Expect = 0.19 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P PP P P P PP PP P Sbjct: 122 PRPRPKAKRIRRLLPTPPPPTPPQSTPKPRRVLPTPPPKPPTP 164 Score = 29.9 bits (64), Expect = 3.2 Identities = 20/77 (25%), Positives = 22/77 (28%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPP---PXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P N + PP + T PP P P P PPP P Sbjct: 90 PLNLSSPPNSTPSTAQAVANNDPTLPTPPFSTPRPRPKAKRIRRLLPTPPPPTPPQSTPK 149 Query: 901 PXPPXXPPPXPXPPPXP 951 P PP P P P Sbjct: 150 PRRVLPTPPPKPPTPRP 166 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P P PP + P P PP P PP Sbjct: 136 PTPPPPTPPQSTPKPRRVLPTPPPKPPTPRPP 167 Score = 28.7 bits (61), Expect = 7.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P PP P PP P P P PPP PP PP Sbjct: 136 PTPPPPTPP-------QSTPKPRRVLP-TPPPKPPTPRPP 167 >SB_29063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 33.9 bits (74), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGG 810 G GG G G G G G G G GG G G G G G G G Sbjct: 18 GGGGDRGRGRGHCLGHGSGRGGRGGRGGSGRGRGRGRGSGRGRGRGSG 65 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 33.9 bits (74), Expect = 0.19 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP 917 P P T P P PPP PPPP P P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP PPP P P Sbjct: 367 PLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 32.7 bits (71), Expect = 0.45 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P P PPP PPPP P P Sbjct: 361 PAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +1 Query: 862 PP--PPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P P P P PPP P PPP P Sbjct: 357 PPSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPX-PXPPXPPPPP 944 P P P P P P P P PP PPPPP Sbjct: 358 PSTPAPT-PAPLSSTPCAPFAPPPPPPPPPP 387 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP T P P P PPP P P PP P P Sbjct: 357 PPSTPAPT-PAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 2/37 (5%) Frame = +3 Query: 807 PXXPXPXP-PXTXXXXXPX-PPXPXXPPPXPPPPXXP 911 P P P P P + P PP P PPP P P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P PP PPP P P P Sbjct: 363 PTPAPLSSTPCAPFAPPPPPPPPPPPAP 390 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +1 Query: 865 PPPXXXXPXXP-PPXPPXXPPPXPXPPPXP 951 P P P P P PP PPP P P P Sbjct: 365 PAPLSSTPCAPFAPPPPPPPPPPPAPGSTP 394 >SB_37850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG GG G G G GGG G GG Sbjct: 248 GGIGGLGGGGVIAGAGAGIGGGVIGTGG 275 >SB_35562| Best HMM Match : MAM (HMM E-Value=6.4e-20) Length = 256 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP PPP P P P PP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PP P PPP PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +2 Query: 869 PXXPXXPPXPP--PXPPXXPPPXPXPPP 946 P P P PP P PP PPP P P Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPPNTPGP 254 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 882 PPXPPPPXXP--XPXPPXPPPPP 944 P P PP P P PP PPPP Sbjct: 227 PASPKPPTAPPNTPPPPVTPPPP 249 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P PPP PP P PP Sbjct: 230 PKPPTAPPNTPPPPVTPPPPNTPGPP 255 >SB_7831| Best HMM Match : RNA_pol_Rpb1_7 (HMM E-Value=0) Length = 1467 Score = 33.5 bits (73), Expect = 0.26 Identities = 31/105 (29%), Positives = 34/105 (32%), Gaps = 12/105 (11%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXP---- 831 P + S F H L P P LP + + R T PP PP P P Sbjct: 587 PSYSPSSPSFHHNLRPTPPPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQST 646 Query: 832 PXPXXXXXXXP------PPPXXXXPXXPP-PXPPXXPPPXPXPPP 945 P P P PPP P P P PPP P P Sbjct: 647 PPPLLLIPLLPLLTLPLPPPTVRHPQATPLPRLATHPPPLSTPQP 691 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/45 (33%), Positives = 16/45 (35%), Gaps = 3/45 (6%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXP---PPXPPXXPPPXPXPPP 946 PP P + P P P PP PP PP PPP Sbjct: 605 PPLPLSIPLLLQATPPHLQSTAQPRPTTVPPLPPTPPPRQSTPPP 649 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 33.5 bits (73), Expect = 0.26 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG G G G G Sbjct: 86 GGGGGDGGGGGDGGGDGDGDGDGDG 110 Score = 31.9 bits (69), Expect = 0.78 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG GGG G G Sbjct: 84 GDGGGGGDGGG--GGDGGGDGDGDG 106 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG 863 G GGG G G G GGG G G G Sbjct: 84 GDGGGGGDGGGGGDGGGDGDGDGDGDG 110 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GG GG G GGGG GGG G G Sbjct: 84 GDGGGGGDG----GGGGDGGGDGDGDGDG 108 >SB_40954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 274 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P P P P P P PP PPP Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P P P P P PPPPP Sbjct: 56 PPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P P PP P P P P P PPP P P Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVTPQTPSPASPGLPFMPPPPPPP 94 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXPXPPP 945 P PP P P P P P P P P P P PPP Sbjct: 51 PQMGMPPPPGPGQPEMPGQPQVT-PQTPSPASPGLPFMPPPPPPP 94 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 33.5 bits (73), Expect = 0.26 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 PPPP PP P PPP P PPP P Sbjct: 512 PPPPPASPPPPLPAEEDNSPPP---LPAGPPPDEP 543 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = +3 Query: 855 PXPPXPXXPPPXPP--PPXXPXPXPPXPPP 938 P PP P PPP P P P P PPP Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLPAGPPP 540 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPP P PPP P Sbjct: 511 PPPPPPASPPPPLPAEEDNSPPPLP 535 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPPP P P PPP PPP P PP P Sbjct: 511 PPPPPPASP---------PPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXP 897 R PPP P PP P PP P P P Sbjct: 509 RSPPPPPPASPPPPLPAEEDNSPPPLPAGPPPDEP 543 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PP P P PP P PP Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPP 539 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P P PPP P PP Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLPAGPP 539 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 33.5 bits (73), Expect = 0.26 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPP PP P PPP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXP-XPXPPXPPP 938 P P PP PPP P PP PPP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 869 PXXPXXPPX-PPPXPPXXPPPXPXPPP 946 P P PP PPP PP P PPP Sbjct: 251 PSVPIPPPTKPPPRVASRRPPPPLPPP 277 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP P PPPP Sbjct: 244 PHPPSVKPSVPIPPPTKPPPRVASRRPPPP 273 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 33.5 bits (73), Expect = 0.26 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG GG GG G GG G G GGGG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GG G G G GG GG G G GG G G Sbjct: 420 GAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G GG G GG GG G G G Sbjct: 423 GGSSGGGFGGSSGGSFGGSSGGSFGGSGFG 452 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGG 820 G G GGG G GG GG G G G GG Sbjct: 419 GGAFGGSSGGGFGGSSGGSFGGSSGGSFGGSGFGSKSSGGGGGG 462 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 33.1 bits (72), Expect = 0.34 Identities = 22/78 (28%), Positives = 24/78 (30%), Gaps = 3/78 (3%) Frame = +1 Query: 718 VPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP---PPPXXXXP 888 V + P + T P P A P PP PP P P PP Sbjct: 583 VSLKPASATSSSRSPPEPFELRKALPKHESPSPPSRVPPQPETAPKPFPNITPPEVRPSL 642 Query: 889 XXPPPXPPXXPPPXPXPP 942 PP PP P PP Sbjct: 643 PGTPPETKTKPPLAPYPP 660 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 + P P P T PP PP P PP P PP Sbjct: 633 ITPPEVRPSLPGTPPETKTKPPLAPYPPKTSPKTTPKPHIPPAPSRPP 680 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPX-TXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P V P P P T P PP P P P P P P P PP Sbjct: 627 PKPFPNITPPEVRPSLPGTPPETKTKPPLAPYPPKTS-PKTTPKPHIPPAPSRPPPQLPP 685 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGG-GGXGGGXXGXG 863 G GGG GG G GG GG GGG G G Sbjct: 370 GRGGGRGGGRGGFRGGRGGRGGGGRGAG 397 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GGG GG GG G GGGG Sbjct: 368 GGGRGGGRGGGRGGFRGGRGGRGGGG 393 >SB_26475| Best HMM Match : Cadherin (HMM E-Value=0.009) Length = 340 Score = 33.1 bits (72), Expect = 0.34 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPP 926 PPP PPPP P P PP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPP 945 PPP PP PPP P PPP Sbjct: 162 PPPQPP--PPPLPPPPP 176 Score = 30.3 bits (65), Expect = 2.4 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 907 PPXXPPPXPXPPPXP 951 PP PPP P PPP P Sbjct: 162 PPPQPPPPPLPPPPP 176 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXP 934 PP PP PP PPP P Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXXPXPXPPXPPPP 941 PPP P P P PPPP Sbjct: 162 PPPQPPPPPLPPPPPP 177 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEG 603 PPP PP PPP V + F +G Sbjct: 168 PPPLPPPPPPIDLVDMSTLSKFNKG 192 >SB_23149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 33.1 bits (72), Expect = 0.34 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG G GG G GGGG G G GGG Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGG 311 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G G GGGG G G GGGG Sbjct: 270 GNAGGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGG 311 Score = 31.9 bits (69), Expect = 0.78 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GG G G G GG GG G GGG G GG G GG Sbjct: 270 GNAGG-GAGEGSTGGPGGINAGG---GGGDSTTDSDDGAGGGGGGG 311 Score = 30.3 bits (65), Expect = 2.4 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 10/58 (17%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG----------GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG GGG GG GG GGG G GG GGGG Sbjct: 236 GGQGGTSSGGGGYGGETYACLSSTYGKGGDRNQPGNAGGGAGEGSTGGPGGINAGGGG 293 Score = 30.3 bits (65), Expect = 2.4 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GG GG GG GG G GGG N Sbjct: 303 GAGGGGG-GGHFSGGAGGAAATGCTNQYGGSGGIASSTIGACAGGGGSSNCQAGNGGNSC 361 Query: 770 GXXGXXGG 747 G GG Sbjct: 362 QRGGQSGG 369 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 GGG G GGG G GG GG G Sbjct: 397 GGGGGGGGGSAFGIEGGRGGHGG 419 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GGG GGG G G Sbjct: 290 GGGGGDSTTDSDDGAGGGGGGGHFSGGAGG 319 Score = 29.5 bits (63), Expect = 4.2 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG--XGGXGXGGGGXNVXRXAXRXKIGX 765 G G GG GG G GGGG GGGG A + G Sbjct: 355 GNGGNSCQRGGQSGGAAGTASMGGGGGGLQFGNQDYTSRLSYGGGGGGGGGSAFGIEGGR 414 Query: 764 XGXXGGXVWL 735 G GG V L Sbjct: 415 GGHGGGLVLL 424 Score = 28.3 bits (60), Expect = 9.6 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 943 GGGGGXGGXGX-GXXGGGGXGG-----GXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGG G G G G GG GG G GG G G G G T Sbjct: 273 GGGAGEGSTGGPGGINAGGGGGDSTTDSDDGAGGGGGGGHFSGGAGGAAATGCT 326 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 33.1 bits (72), Expect = 0.34 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P PPP PP P PP P PPP Sbjct: 2588 PIVAPMQPPFFGPQLPPPDMFPPQMMPPMVPMMLPPMLPLPPP 2630 Score = 31.5 bits (68), Expect = 1.0 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P PPP P P PP PP P PP Sbjct: 2610 PQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 31.1 bits (67), Expect = 1.4 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P + P + P P P P P P P PP P PP Sbjct: 2610 PQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPPGGPFPP 2654 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = +1 Query: 811 PPPXPXPPX--PXXXXXXXPPPPXXXXPXXP-PPXPPXXPPPXPXPPPXP 951 PPP PP P PP P P P P PPP P PP P Sbjct: 2603 PPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLP-PPGGP 2651 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPX--PPXTXXXXXPXPPXPXXPPPXPPPPXXP-XPXPPXPPPPP 944 P P P PP P P P P P P P P P P PPP Sbjct: 2600 PQLPPPDMFPPQMMPPMVPMMLPPMLPLPPPGLPMQPEAPVQPPPLPPP 2648 >SB_7859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 33.1 bits (72), Expect = 0.34 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GGG G GGG GGG G G G GG G G Sbjct: 166 GDGGGDDDDGGDGDGGGDDGGGADGGGADGGDD---DGGDGDG 205 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 4/51 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXG----GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG G GGG G GGG G G GG Sbjct: 160 GDGGDDGDGGGDDDDGGDGDGGGDDGGGADGGGADGGDDDGGDGDGDDDGG 210 Score = 30.3 bits (65), Expect = 2.4 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 5/55 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG-----XGGXGXGGGGXN 801 G GG GGG GG G G GG G GG GGG N Sbjct: 182 GDDGGGADGGGADGGDDDGGDGDGDDDGGDDDGVVDNGDVVVDDGGGDDDGGGVN 236 >SB_6095| Best HMM Match : 7tm_1 (HMM E-Value=0.013) Length = 872 Score = 33.1 bits (72), Expect = 0.34 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 PP PPPP PP PPP P Sbjct: 791 PPTPPPPPRVMNGLPPSPPPSP 812 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 32.7 bits (71), Expect = 0.45 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PP P PP P PP Sbjct: 301 PQTPPPPQTPPPPQTPAPPQTPAPP 325 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPPP P P P P PP Sbjct: 301 PQTPPPPQTPPPPQTPAP-PQTPAPP 325 >SB_38159| Best HMM Match : Peptidase_M28 (HMM E-Value=4.7e-09) Length = 1049 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G GGG G G G G G G GG G GGG N Sbjct: 237 GDGDGGGDGDGDGDGDGDGDGDGDGDGDGDGDGGVGG-GGGGGSCN 281 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGGGGXGGGXXGXG 863 G G G G G G G GGGG GG G Sbjct: 257 GDGDGDGDGDGDGGVGGGGGGGSCNDKG 284 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 32.7 bits (71), Expect = 0.45 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 8/53 (15%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP--------PXXPPPXPXPPP 945 PPP P P P PP P P P P P PP PPP Sbjct: 24 PPPMPQQPPPLGFDAMGPPQPGGMPMPMPGPYPSSGYPTSVPGAAPPYGGPPP 76 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 32.7 bits (71), Expect = 0.45 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P PP PP P PP P P P P PPP P Sbjct: 210 PLPPTAAPPPPPTTGAP-PPTPVTNKPPPPRPATTQAPPPTAAP 252 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP PPP P P P P PP Sbjct: 210 PLPPTAAP---PPPPTTGAPPPTPVTNKPPPPRPATTQAPP 247 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 T PPPP P PPPP PPP Sbjct: 214 TAAPPPPPTTGAPPPTPVTNKPPPPRPATTQAPPP 248 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PP P P PP P PP P Sbjct: 210 PLPPTAAPPPPPTTGAP-PPTPVTNKPPPPRPATTQAPPPTAAP 252 >SB_50215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 32.7 bits (71), Expect = 0.45 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPP 941 PP P P P PP PPPP Sbjct: 74 PPQPTPPPPRPPTPPPP 90 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPP 926 P P PPPP P P PP Sbjct: 75 PQPTPPPPRPPTPPPP 90 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXP 911 PP P PPP PP P P Sbjct: 74 PPQPTPPPPRPPTPPPP 90 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPP 928 P P PPP PP PPP Sbjct: 74 PPQPTPPPPRPPTPPPP 90 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P PP P P P PP P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALP 62 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P P PP PP P P P P Sbjct: 38 PHGPRPLPPLREPPTPAPTPPP 59 Score = 29.9 bits (64), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P P PP P P P PP P P P P P Sbjct: 38 PHGPRPLPPLRE----PPTPAPTPPPALPSTPTLPLAPRPRP 75 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P P P P PP PP P P P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTP 57 >SB_45113| Best HMM Match : CemA (HMM E-Value=6) Length = 363 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG 884 GGGG GG G G GGGG G Sbjct: 154 GGGGRRGGRGRGGGGGGGEG 173 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/55 (29%), Positives = 18/55 (32%) Frame = +1 Query: 769 PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 P + + R P P P PPP P PPP PPP P Sbjct: 167 PRYSIVDARSVITCSPGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P PPPP PPP PP P PP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 31.1 bits (67), Expect = 1.4 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 3/40 (7%) Frame = +3 Query: 831 PXTXXXXXPXPPXPXXPPPXP---PPPXXPXPXPPXPPPP 941 P + P P PPP P PPP P PPPP Sbjct: 182 PGSPTEDTPWTSVPPPPPPGPGGIPPPPPPIRGGVPPPPP 221 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P PP PP P PPP Sbjct: 195 PPPPPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 32.3 bits (70), Expect = 0.59 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = -2 Query: 920 GXXGGXGGGXXGXXXXGGGGXXXXXXXG-XGGXGXGGG 810 G GG GGG G G GG G GG G GGG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGG 458 Score = 31.5 bits (68), Expect = 1.0 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GGG G GG G G G G G G GG Sbjct: 421 GGRGGPGGGYEGRGRGGRGGPRGGGPRGYDGGYGQGGGYEGYSGG 465 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG G GG GG G G GGG Sbjct: 448 GYDGGYGQGGGYEGYSGGYRDDYGYGGGSYDHYDSYYGGGYDDYYGGG 495 >SB_29930| Best HMM Match : Collagen (HMM E-Value=0.067) Length = 129 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG G GGG G GGG G G G GGG Sbjct: 78 GGCEGGGGSGGCEGGG--GCVGCEGGGGCVGCEGGGGCVGCEGGG 120 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G GGG G G G GG G G Sbjct: 82 GGGGSGGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEGGGGCVGCEG 127 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GGG G GGG G GGG G G G GG Sbjct: 84 GGSGGCEGGGGCVGCEGGG--GCVGCEGGGGCVGCEGGGGCVGCEGG 128 >SB_20016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 32.3 bits (70), Expect = 0.59 Identities = 24/92 (26%), Positives = 32/92 (34%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP 831 P + P+ L+ F+ + P V +P + P P + L PP P P Sbjct: 799 PVIPNTYPSPLNPAFQSST-PDVNAVP-SAPYPQASGVAPPYPLYTPADAAFPPAQAPYP 856 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P PP P PP PPP Sbjct: 857 P-PYPTPAGGYPPDQGGYPLQTMGPPPDAPPP 887 >SB_49744| Best HMM Match : Tubulin_C (HMM E-Value=6.7) Length = 370 Score = 32.3 bits (70), Expect = 0.59 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G G G G G G G GGG GGG G G G G G Sbjct: 244 GDGDGDGDGDGDGDGDGGGGGGGGDGDGDGDGDGDGDGDGDGDG 287 Score = 31.5 bits (68), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGGG GGG G G G Sbjct: 315 GDGDGDGDGDGDGDGGGGDGGGDDGGDGDG 344 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 32.3 bits (70), Expect = 0.59 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXP-XPPPXP 951 PPPP P PPP P P PPP P Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPPPVP 167 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P PPPP P P PP Sbjct: 137 PPPPAKEAPLPPPPAQQEAVPDIPTSPP 164 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P PP P P P P P PP P P Sbjct: 137 PPPPAKEA---PLPPPPAQQEAVPDIPTSPPPVPPLPTEP 173 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 32.3 bits (70), Expect = 0.59 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG G GGG G G G G Sbjct: 1111 GMGGGMGMQGGGMGMQGGGMGMQDGGMGMG 1140 >SB_23696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 559 Score = 32.3 bits (70), Expect = 0.59 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -1 Query: 942 GGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GG G GGG G GGG G G GG G G E E +G Sbjct: 419 GGGGRGGGGGDGGGGGEGVQGTPYTPEEEEGRALQACGRGGGGGECGEKEEGEEEEIKG 477 Score = 29.5 bits (63), Expect = 4.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXG 885 GGG G GGG GG G G G Sbjct: 420 GGGRGGGGGDGGGGGEGVQG 439 >SB_19081| Best HMM Match : Metallothio_2 (HMM E-Value=4.4) Length = 260 Score = 32.3 bits (70), Expect = 0.59 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 GGGG GG G G GG G GG Sbjct: 154 GGGGRGGGRGHGRGGGSGGGG 174 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GGG GGG Sbjct: 154 GGGGRGG-GRGHGRGGGSGGG 173 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 32.3 bits (70), Expect = 0.59 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-PPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P P PPP P PPP PP P Sbjct: 1127 PPPPIPDDDGDDTDSTQLPNPPPDMQLPDPPPPITINVPPMYDRP 1171 >SB_56224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GG G GGG GG Sbjct: 193 GGGGGVGTTGGSTGAAGGGGGG 214 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -3 Query: 943 GGGGGXG--GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGGG G G G GGGG G V G G G + + G Sbjct: 193 GGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSSQSG 249 >SB_48319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.9 bits (69), Expect = 0.78 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 Query: 890 PXPPPXPPXXPPPXPXPP 943 P PPP P PPP P PP Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 898 PPXPPXXPPPXPXPPP 945 PP PP PPP PPP Sbjct: 463 PPPPPMSPPPPTPPPP 478 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 P P PPP P P PP P P Sbjct: 461 PIPPPPPMSPPPPTPPPPATSP 482 Score = 29.5 bits (63), Expect = 4.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPP 902 P PP PPP PPPP Sbjct: 463 PPPPPMSPPPPTPPPP 478 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXP 917 P P PP PPPP P P Sbjct: 461 PIPPPPPMSPPPPTPPPP 478 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 896 PPPXPPXXPPPXPXPPP 946 P P PP PP P PPP Sbjct: 461 PIPPPPPMSPPPPTPPP 477 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXP 917 PP P PPP PPP P Sbjct: 464 PPPPMSPPPPTPPPPATSP 482 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P P P PP PPP P PP PPP Sbjct: 1329 PPWELPLPPS--GLPLPLPRLPL-PPLRLPPPHSRLPLPPPKLPPP 1371 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PP P P PPP P PP PP P P Sbjct: 1336 PPSGLPLPLPRLPLPPLRLPPPHSRLPLPPPKLPPPSRIPLP 1377 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 31.9 bits (69), Expect = 0.78 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GG GG G G GGGG GG G GG Sbjct: 187 GGRGGRGGRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGG 231 Score = 31.9 bits (69), Expect = 0.78 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG G G G GG G G GG G Sbjct: 211 GGGGSGGYGGGSYGGY-GNYGGYSQGGYGGYADNSWSGGYGSYDGGYG 257 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G G G GGG GG G G GG N Sbjct: 194 GRGGGRGAPRGRGGPRGGGGGSGGYGGGSYGGYGNYGGYSQGGYGGYADN 243 >SB_52484| Best HMM Match : AbfB (HMM E-Value=0.011) Length = 782 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GG G GGG GG Sbjct: 239 GGGGGVGTTGGSTGAAGGGGGG 260 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 2/57 (3%) Frame = -3 Query: 943 GGGGGXG--GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGGG G G G GGGG G V G G G + + G Sbjct: 239 GGGGGVGTTGGSTGAAGGGGGGTSTSTGSSGSTGTSMVTSGGGISTSGSSSGSSQSG 295 >SB_43620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1680 Score = 31.9 bits (69), Expect = 0.78 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P P P P P PP P P P Sbjct: 734 PAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P T P P P P P PP P P P Sbjct: 734 PAPTPAPTQAQNPAPTPAPTQAQPPVPSPAPTQAQPPAPSPAP 776 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/63 (25%), Positives = 17/63 (26%) Frame = +1 Query: 757 IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPX 936 +P P L P P P P P P P P PP P Sbjct: 702 VPEVPYPTLSTAAQPTQAQNPAPTPAPTQAQNPAPTPAPTQAQNPAPTPAPTQAQPPVPS 761 Query: 937 PPP 945 P P Sbjct: 762 PAP 764 >SB_40892| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXX-GXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG GG G GGGG GG G G + Sbjct: 24 GGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDD 83 Query: 773 IGXXGXXGG 747 G GG Sbjct: 84 DGYDAAGGG 92 Score = 31.5 bits (68), Expect = 1.0 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG G G GGGG GG G G + Sbjct: 38 GGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHD 97 Query: 770 GXXGXXGG 747 G GG Sbjct: 98 GYDAGGGG 105 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG G G GGGG GG G G + Sbjct: 51 GGGGSDDDGYDAAGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDD 110 Query: 770 GXXGXXGG 747 G GG Sbjct: 111 GYDAAGGG 118 Score = 31.1 bits (67), Expect = 1.4 Identities = 19/68 (27%), Positives = 20/68 (29%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG G G GGGG GG G G + Sbjct: 77 GGGGSDDDGYDAAGGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDD 136 Query: 770 GXXGXXGG 747 G GG Sbjct: 137 GYDAAGGG 144 Score = 31.1 bits (67), Expect = 1.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG G G GGGG GG G G Sbjct: 142 GGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDG 189 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG--XGXGGGG 807 G GG G GG G G GGGG G G G GGG Sbjct: 155 GGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGGGSYDDGDDGGG 204 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG G G GGGG GG G G Sbjct: 129 GDGGSDDDGYDAAGGGGSDDDGDDAGGGGGSDHDGDDAAGGGGSDDDG 176 Score = 29.5 bits (63), Expect = 4.2 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG-XXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GG G GG GG G GGGG GG G G + Sbjct: 11 GGGGDSYDDGDDAGGGGGSDDDGYDAGGGGGSYDDGYDAAGGGGSDDDGYDAAGGGGSDH 70 Query: 773 IGXXGXXGG 747 G GG Sbjct: 71 DGDDAAGGG 79 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/68 (26%), Positives = 19/68 (27%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG G G GGGG G G G + Sbjct: 90 GGGGSDHDGYDAGGGGGSDDDGYDAAGGGGSDHDGYDAVGDGGSDDDGYDAAGGGGSDDD 149 Query: 770 GXXGXXGG 747 G GG Sbjct: 150 GDDAGGGG 157 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG-XGGGXXGXGGXGXXXXXVXGG 827 GGGGG G GGGG G GG G GG Sbjct: 154 GGGGGSDHDGDDAAGGGGSDDDGYDAAGGGGSDDDGDDGG 193 >SB_18074| Best HMM Match : Trypan_PARP (HMM E-Value=0.081) Length = 524 Score = 31.9 bits (69), Expect = 0.78 Identities = 21/74 (28%), Positives = 23/74 (31%), Gaps = 3/74 (4%) Frame = +1 Query: 739 QTXPPXIPXX---PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 Q PP +P P L + P P P P P P P P P P Sbjct: 228 QKAPPPVPQTKRKPPAKLPPRQPVAEPEPERQPEPEPEPEQEPEPEPEPEPEPE-PEPEP 286 Query: 910 PXXPPPXPXPPPXP 951 P P P P P Sbjct: 287 EPEPEPEPVHVPEP 300 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 31.9 bits (69), Expect = 0.78 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PPP P PP PPP Sbjct: 79 PFPPPPPIYMPPPPVYMPPPPVYMPPP 105 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P P PPPP P P PPP Sbjct: 79 PFPPPP--PIYMPPPPVYMPPPPVYMPPP 105 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PP PP PPP P Sbjct: 81 PPPPPIYMPPPPVYMPP---PPVYMPPPMP 107 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPPP P P PPPP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPPPP 99 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P P PPP P PPP PP Sbjct: 75 PMMMPFPPPPPIYMPPPPVYMPP 97 >SB_4771| Best HMM Match : DEAD (HMM E-Value=0.015) Length = 592 Score = 31.9 bits (69), Expect = 0.78 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP PP P PPP PP PPP P P P Sbjct: 64 PPVASTPPAPQPVPNNMGPPPHVNQ-GPPPNSANQAPPPNPGPSP 107 >SB_55248| Best HMM Match : Adeno_E1A (HMM E-Value=7.5) Length = 198 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P PP PPP P PPP P Sbjct: 143 PVSSPPRTPPPEPTPPPTP 161 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 878 PXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP P PPP Sbjct: 137 PYFGDSPVSSPPRTPPPEPTPPP 159 Score = 29.5 bits (63), Expect = 4.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPP 926 P P PPP P PP P P P Sbjct: 143 PVSSPPRTPPPEPTPPPTPPPLRP 166 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPP 945 PP PP P P P PPP Sbjct: 147 PPRTPPPEPTPPPTPPP 163 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPP 938 P PP PPP P P PP PPP Sbjct: 143 PVSSPPRTPPP-EPTP-PPTPPP 163 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 885 PXPPPPXXPXPXPPXPPPPP 944 P PP P P P PP PP Sbjct: 143 PVSSPPRTPPPEPTPPPTPP 162 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXP 923 P P PPP PPPP P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPPPXP 951 PPP PP PPP PP P Sbjct: 143 PPPPPPPSPPPPCHPPALP 161 Score = 30.3 bits (65), Expect = 2.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPP 938 PPP PPPP P P P P Sbjct: 142 PPPPPPPPSPPPPCHPPALP 161 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 890 PXPPPXPPXXPPPXPXP 940 P PPP PP PPP P Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 896 PPPXPPXXPPPXPXPPP 946 PPP PP PP P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 894 PPPXXPXPXPPXPPPPP 944 PPP P P PP P PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 >SB_53385| Best HMM Match : DUF1388 (HMM E-Value=0.66) Length = 264 Score = 31.5 bits (68), Expect = 1.0 Identities = 25/85 (29%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXX 885 L P P+ P ++ P P P L R P P P P P Sbjct: 51 LEPHRPLEP-HRPLEPHRPLEPHRPLEPHRPLEPHRPQEPHRPLEPHRPLEPPRPQEPHR 109 Query: 886 PXXPP-PXPPXXP--PPXPXPPPXP 951 P PP P P P P P PP P Sbjct: 110 PQEPPRPQEPHRPQEPHRPLEPPRP 134 >SB_42662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1054 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GGG G G G G G GG G GG Sbjct: 494 GGTGSGGGHGGEGGPSSLAAGGAGYGSYLLPVHPGSGGGGASGG 537 >SB_38546| Best HMM Match : Trypsin (HMM E-Value=1.90577e-43) Length = 506 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP P P PP PPPP Sbjct: 221 PDAPTPPPPVKTTAAPTPSPPQTPPPP 247 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXP 923 P P PPP PPPP P P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXP 923 P P PPP PPPP P P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPP 938 PPP PPP P P PP P Sbjct: 31 PPPPSPPPSPPPPSPPLDCP 50 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPP 938 PPP PPP P P PP P Sbjct: 154 PPPPSPPPSPPPPSPPLDCP 173 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXXPXPXPPXPPPP 941 PPP P P PP P PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 894 PPPXXPXPXPPXPPPP 941 PPP P P PP P PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPP 942 PPP PP PPP P PP Sbjct: 32 PPPSPPPSPPP-PSPP 46 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXP 940 PP PPP PP PP P Sbjct: 33 PPSPPPSPPPPSPPLDCP 50 Score = 29.1 bits (62), Expect = 5.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 895 PPPXPPXXPPPXPXPP 942 PPP PP PPP P PP Sbjct: 155 PPPSPPPSPPP-PSPP 169 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXP 940 PP PPP PP PP P Sbjct: 156 PPSPPPSPPPPSPPLDCP 173 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 31.5 bits (68), Expect = 1.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPP 943 P P PP P PP PPP PP Sbjct: 122 PSGPRAPPGGPGAPPPPPPPAVVPP 146 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP P P P P PP PPPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPP 141 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 2/31 (6%) Frame = +1 Query: 865 PPPXXXXPXXP--PPXPPXXPPPXPXPPPXP 951 PP P P PP P PPP P P P Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPPPPAVVP 145 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P PPPPP Sbjct: 115 PPAPTSVPSGPRAPPGGPGAPPPPP 139 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPX--PPPPXXPXPXPPXPPPP 941 P P P P P PP PPPP P P PPP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 31.5 bits (68), Expect = 1.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PP P PPPPP Sbjct: 201 PGQPGMWGPPPMGGPPPMGGPPGGYPPPPP 230 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 P P PPP P PP PP PPP P P Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYP 240 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 1/44 (2%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXX-PPPXPPXXPPPXPXPPP 945 P P P PPP P PPP PP PPP Sbjct: 199 PYPGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P P P P PP PPPP P P P Sbjct: 201 PGQPGMWGPPPMGGPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 31.5 bits (68), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPP--XXPXPXPPXPPPP 941 P P P P PP P PP P P P PPPP Sbjct: 47 PGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPPP 90 >SB_15878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1929 Score = 31.5 bits (68), Expect = 1.0 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP PPP P PP P P P Sbjct: 1166 PPQPPPVPSVQAPPAPPPAP 1185 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 885 PXPPPPXXPXPXPPXPPPPP 944 P PPP PP PPP P Sbjct: 1166 PPQPPPVPSVQAPPAPPPAP 1185 >SB_33602| Best HMM Match : Amelogenin (HMM E-Value=0.83) Length = 242 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP----PPXPPPPXXPXPXPPXPPPP 941 P P P P T P P P P P P P P P P P P Sbjct: 52 PTIPSPHDPITPRPHRPTAPRPHDPIAPRPRSPHGPVAPRPHRPISPRP 100 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG G G G G GG G G G G GG Sbjct: 1274 GGGGGYGNYG-GYGGYGGNPQGGYGFAGYGGQYGGPRGG 1311 Score = 30.7 bits (66), Expect = 1.8 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGG GG GGG G GG G GG G G A G Sbjct: 1250 GGGGAFSSRDYRQHRGGSSGGGMHG-GGGGYGNYGGYGGYGGNPQGGYGFAGYGG 1303 Score = 30.7 bits (66), Expect = 1.8 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GGG G GG G G GG G G G G G Sbjct: 1269 GGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGGSG 1314 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GGG G GG G GG G G GGG Sbjct: 1266 GSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGGPRGGG 1312 Score = 28.7 bits (61), Expect = 7.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G GGG GGG G Sbjct: 804 GGGGGYNRGYGSGGGYGGGGYNKRG 828 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GGG GG G GG GG G G Sbjct: 814 GSGGGYGGGGYNKRGGRYSGGSNWGSSPAG 843 Score = 28.3 bits (60), Expect = 9.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG G G G G GG Sbjct: 1266 GSSGGGMHGGGGGYGNYGGYGGYGGNPQGGYGFAGYGGQYGG 1307 >SB_19554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 885 PXPPPPXXPXPXPPXPPPPP 944 P PP P P PP PPP P Sbjct: 108 PFPPKPTVATPPPPLPPPMP 127 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 Query: 898 PPXPPXXPPPXPXPPPXP 951 PP P PP P PPP P Sbjct: 110 PPKPTVATPPPPLPPPMP 127 >SB_14242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/76 (30%), Positives = 25/76 (32%), Gaps = 6/76 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG------XGXGGGGXNVXRX 789 G GG G G GG GG GGGG GG G GGG + Sbjct: 328 GGSGGSGTSEGGFGG-GGATVASRPGGGGGYSGGGLASSGGSTLSSEGGVAGGGGSYNNG 386 Query: 788 AXRXKIGXXGXXGGXV 741 A + I G V Sbjct: 387 ADQKNIAGTNEGDGRV 402 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/59 (30%), Positives = 20/59 (33%) Frame = +1 Query: 769 PIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P+ + R PPP P P P P P P P P P P PPP Sbjct: 930 PLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKP-PTPPP 987 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P P PP P P P PPP Sbjct: 930 PLPEVDIMRSPTPTPPPSPPPKEPTPPP 957 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPP P P P P P Sbjct: 940 PTPTPPPSPPPKEPTPPPSSKPSP 963 Score = 29.5 bits (63), Expect = 4.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 816 PXPXP-PXTXXXXXPXPPXPXXPPP-XPPPPXXPXPXP 923 P P P P P P P PPP P PP P P Sbjct: 926 PSPEPLPEVDIMRSPTPTPPPSPPPKEPTPPPSSKPSP 963 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P P PP PPP PP P Sbjct: 1904 PQPLDVNTNSCPTPPREPTPPPPPPTP 1930 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPPP 944 P PP P P PP P P P Sbjct: 1915 PTPPREPTPPPPPPTPLP 1932 >SB_45593| Best HMM Match : ArfGap (HMM E-Value=3.3e-37) Length = 732 Score = 31.1 bits (67), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG G GGGG GGG G GG G G G Sbjct: 629 GTPGGQQSGFHGGIGGGGMGGGFSGQGGGFPTSQAQADGFGTSQGG 674 >SB_45079| Best HMM Match : RRM_1 (HMM E-Value=0.0027) Length = 253 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGG 893 GGGGG GG G G GGG Sbjct: 165 GGGGGGGGGGGGRRGGG 181 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG 890 GGGGG GG G G GGG Sbjct: 164 GGGGGGGGGGGGGRRGGG 181 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 31.1 bits (67), Expect = 1.4 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPPP P PPPPP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPP 216 Score = 29.1 bits (62), Expect = 5.5 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXX---PPPXPPPPXXPX--PXPPXPPPPP 944 P + P PP PPP PPPP PPPPP Sbjct: 190 PDESPEPTRPPPPLDDLDDLPPPPPPPPEDDSIHNHEDLPPPPP 233 Score = 28.7 bits (61), Expect = 7.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PP P PP PP PPP Sbjct: 194 PEPTRPPPPLDDLDDLPPPPPP---PPEDDSIHNHEDLPPPPPP 234 >SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) Length = 293 Score = 31.1 bits (67), Expect = 1.4 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPPP 946 PP P P PP P P PPP Sbjct: 243 PPTPSPTPPSPTHPSPLPPP 262 Score = 28.7 bits (61), Expect = 7.3 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPP 926 P P P PP P P P PP Sbjct: 243 PPTPSPTPPSPTHPSPLPP 261 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 31.1 bits (67), Expect = 1.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G G G G GG GG GGG G G Sbjct: 752 GDGDGDGDGGSNGGGDGGGDGDGDG 776 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G G G GG GGG G G G Sbjct: 747 GGDDDGDGDGDGDGGSNGGGDGGGDGDG 774 >SB_1366| Best HMM Match : Collagen (HMM E-Value=6.2e-05) Length = 442 Score = 31.1 bits (67), Expect = 1.4 Identities = 24/85 (28%), Positives = 28/85 (32%), Gaps = 3/85 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG---GXNVXRXAXR 780 G GG G GG G G G GG G G GG G N + Sbjct: 24 GIGGNKGIGGNKGIGGNKGIGGNKGIGGNKGIVGNKGIGGNKGIGGNKGIGGNKGIVGNK 83 Query: 779 XKIGXXGXXGGXVWLXGRMGTXGXR 705 +G G GG + G G G + Sbjct: 84 GIVGNKG-IGGNKGIVGNKGIGGNK 107 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 25.4 bits (53), Expect(2) = 1.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPP 941 PPPP P PPPP Sbjct: 237 PPPPPYTSLPPDDPPPP 253 Score = 24.2 bits (50), Expect(2) = 1.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 855 PXPPXPXXPPPXPP 896 P PP P PP PP Sbjct: 195 PEPPEPDNPPASPP 208 >SB_11571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 469 Score = 26.6 bits (56), Expect(2) = 1.7 Identities = 21/73 (28%), Positives = 23/73 (31%), Gaps = 2/73 (2%) Frame = +1 Query: 700 HALXPXVPI--LPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 +AL P P P T PP P R + P P P P PPP Sbjct: 52 NALQPLKPPSNTPQQLTTPPHQSNTPRPLTPPSRQSNNPRPHTP-PSCQSNTPRPLTPPP 110 Query: 874 XXXXPXXPPPXPP 912 PP PP Sbjct: 111 RQSNTTQPPAYPP 123 Score = 22.6 bits (46), Expect(2) = 1.7 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P P P P PPP P Sbjct: 140 PLRPTPRRPSDTPQPFTPPPRP 161 >SB_55828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G G G G G GG G G G GG Sbjct: 121 GGDNNGSGDDDGGGSGSGGSSDDGGSGDNNNGVSSDDDDGSGSGG 165 >SB_49284| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1041 Score = 30.7 bits (66), Expect = 1.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-PPPXXPXPXPPXPPP 938 P P P P PP P PPP P P PP P Sbjct: 412 PPQQQPQQQRQSPPQPSPTGAPPQRPHPPPQQPSPRPPMGVP 453 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 870 PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P P P P Sbjct: 424 PPQPSPTGAPPQRPHPPPQQPSPRP 448 >SB_31707| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 309 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPP-XPXXPPPXPP-PPXXPXPXPPXPP 935 P P P PP P PP P PP P P P PP P Sbjct: 179 PEYPHPYPPLRPEYAHPYPPRRPEYAHLYPPRRPEYPHPYPPRRP 223 >SB_22536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G G G GG G G GGG G GG GGG + A Sbjct: 254 GKAGGMNSGYNGGPPPGAVGGFGGWGGGSEDNGASGGGGGYSGGGSGTLKEQA 306 Score = 29.1 bits (62), Expect = 5.5 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG G GG G GGG G GG GG G Sbjct: 254 GKAGGMNSGYNGGPPPGAVGGFGGW---GGGSEDNGASGGGGGYSGGGSG 300 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPP 938 PPP PP P PP PPP Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 Score = 28.3 bits (60), Expect = 9.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPPP 944 PPP P P P PPPP Sbjct: 197 PPPSGAPPPPPIGAPPPP 214 >SB_16708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GG G G GGG GGG G GG Sbjct: 410 GRGGGRGYYRGGRGGGRGGGGRGGRGG 436 Score = 29.9 bits (64), Expect = 3.2 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGG-GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG G G GGG G G GG G GG G GG G Sbjct: 395 GRGGYRGRGGRGGYRGRGGG-RGYYRGGRGG-------GRGGGGRGGRG 435 >SB_1002| Best HMM Match : OTCace_N (HMM E-Value=0) Length = 563 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 PP P PP P P PP P P PP Sbjct: 106 PPSMPAPPSPRKADRGWPFPPTVHRMTGPEPLPP 139 >SB_53084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 936 Score = 30.7 bits (66), Expect = 1.8 Identities = 21/57 (36%), Positives = 22/57 (38%), Gaps = 6/57 (10%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGG----GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GGG G GGG G GG G G G GG G GGG +V Sbjct: 490 GDGGGDDDGDGGGDDDGDGGVDDDGDGGGDDDGDGGGDDDVGCGCDESSGGGGDDDV 546 >SB_44477| Best HMM Match : IBR (HMM E-Value=0.00086) Length = 627 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPP 938 P PPP PP P P PP PP Sbjct: 150 PSITQPPPRHSPPQTPVPPPPPLPP 174 Score = 29.9 bits (64), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 P PPP P P PPPPP Sbjct: 150 PSITQPPPRHSPPQTPVPPPPP 171 >SB_44353| Best HMM Match : GRP (HMM E-Value=4.9) Length = 361 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG GGG G GGG GG Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG G G G GGGG GGG Sbjct: 153 GGGGRRGGG-GCCGGGGGGGG 172 >SB_41312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 357 Score = 30.7 bits (66), Expect = 1.8 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG 897 G GGG G GGG GG GG Sbjct: 151 GRGGGRGGGGGGCGGGGG 168 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG 890 G GGG GG G G GGGG Sbjct: 151 GRGGGRGGGGGGCGGGGG 168 >SB_19172| Best HMM Match : GRP (HMM E-Value=4.9) Length = 278 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG GGG G GGG GG Sbjct: 68 GRGGGGRRGGGGCCGGGGGGGG 89 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG G G G GGGG GGG Sbjct: 70 GGGGRRGGG-GCCGGGGGGGG 89 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 30.7 bits (66), Expect = 1.8 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 4/46 (8%) Frame = +1 Query: 808 PPPPXPXP----PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPPP P P PPPP PPP PP P Sbjct: 547 PPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGAGQEGPPPP 592 Score = 29.1 bits (62), Expect = 5.5 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 808 PPPPXPXP--PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP P P PPPP PP PP PPP Sbjct: 569 PPPPGAGQGGPPPPGAGQEGPPPPGAGQGGGPP--PPGAGQGWGLPPP 614 Score = 28.3 bits (60), Expect = 9.6 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 6/47 (12%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP------PPPP 944 P PP P PP PPP PP P PPPP Sbjct: 536 PPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPP 582 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 30.7 bits (66), Expect = 1.8 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 6/51 (11%) Frame = +1 Query: 799 TXXPPP------PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 T PPP P P PP PPP P PP PP P Sbjct: 914 TPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPMRSSPLPPPQRKRASTPPSP 964 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P PP P P P PPP PP P Sbjct: 926 PSPSPPRRRRRSPSNSPPPMRSSPLPPPQRKRASTPPSP 964 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 861 PPXPXXPPPXPPPP 902 PP P PPP PPPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.7 bits (66), Expect = 1.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 Query: 887 PPXPPPXPPXXPPP 928 PP PPP PP PPP Sbjct: 211 PPPPPPPPPPPPPP 224 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +3 Query: 891 PPPPXXPXPXPPXPPPPP 944 PPPP P PP PPPPP Sbjct: 211 PPPP----PPPPPPPPPP 224 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPP 926 PPP PPPP P P PP Sbjct: 211 PPPPPPPP--PPPPPP 224 Score = 28.7 bits (61), Expect = 7.3 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 898 PPXPPXXPPPXPXPPP 945 PP PP PPP P PPP Sbjct: 211 PPPPP--PPPPPPPPP 224 >SB_2796| Best HMM Match : RR_TM4-6 (HMM E-Value=1.9) Length = 224 Score = 30.7 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG GGG G GGG GG Sbjct: 151 GRGGGGRRGGGGCCGGGGGGGG 172 Score = 30.7 bits (66), Expect = 1.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG G G G GGGG GGG Sbjct: 153 GGGGRRGGG-GCCGGGGGGGG 172 >SB_56163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP PP P P PPPP Sbjct: 104 PGNP-PYPPVDQYSAFPYPPQDQQAPPYPAQNQYWNPQGTSLPPPP 148 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPP 928 PP P P P PP PPP PP P Sbjct: 125 PPLPRLRLRLTRLTPPQPSPPQPPQPPPQPPDQQGP 160 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 882 PPXPPPPXXPXPXPPXPP 935 PP P PP P P PP PP Sbjct: 139 PPQPSPPQPPQP-PPQPP 155 >SB_48388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXG-XXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG GG GGG GGGG G G GGG Sbjct: 213 GKGGWENGGFGGGGSAMAHPGGGGGYSGGGIEGSETTGSAGGG 255 >SB_42661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1717 Score = 30.3 bits (65), Expect = 2.4 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G G G GG G G GG G GGGG Sbjct: 226 GHGRTAGVGAGSDSGVGSGGGYGGVGGGSGGIAYGSVFKPVDLGSGGGG 274 Score = 29.5 bits (63), Expect = 4.2 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GGG GG GGG G G G GG G GG Sbjct: 236 GSDSGVGSGGGY-GGVGGGSGGIAY-GSVFKPVDLGSGGGGSWGGAGG 281 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P + P P P P PPPP P P P P Sbjct: 432 PPPRPYASQFADAP-PVSPTTATPPPPPPSQPPPQQFIPSP 471 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP PP PPP PP PPP P Sbjct: 432 PPPRPYASQFADAPPVSPTTATPPPPPPSQPPPQQFIP 469 Score = 28.7 bits (61), Expect = 7.3 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P PP PPP P PP P P Sbjct: 433 PPRPYASQFADAPPVSPTTATPPPPPPSQPPPQQFIPSP 471 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXG 869 GGG GG G G GG GGG G Sbjct: 90 GGGSGGFGGGLFGGMPFGGGMGG 112 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P T PP P PPP P P PPP Sbjct: 103 PPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 29.5 bits (63), Expect = 4.2 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P PP PPP P PP PP PPP Sbjct: 99 PTTVPPPVVTDAPTTVPPPVVTDAPTTVPPPVQPTEPPSTRPPP 142 Score = 28.7 bits (61), Expect = 7.3 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P T PP P + T PPPP P PPP P PP P Sbjct: 43 PVADTDPPTNPPSVV----EVTTTQAPPPPPVVTEAPTTV----PPPVVTDAPTTVPP-P 93 Query: 910 PXXPPPXPXPPP 945 P PPP Sbjct: 94 VVTDAPTTVPPP 105 >SB_32850| Best HMM Match : GRP (HMM E-Value=0.089) Length = 676 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GG G G GGGG G G GGG Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGG 594 Score = 29.9 bits (64), Expect = 3.2 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GG GGG G G G G GG G GG Sbjct: 557 GGGGGDYNGGDGDDDDGGG--GGDDDDGDGDGDDDDDGGGGDGDYNGG 602 Score = 29.1 bits (62), Expect = 5.5 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG G G GGG G G GG G G Sbjct: 556 GGGGGGDYNGGDGDDDDGGGGGDDDDGDGDGDDDDDGGGGDG 597 >SB_59679| Best HMM Match : Lectin_C (HMM E-Value=5.3e-10) Length = 849 Score = 30.3 bits (65), Expect = 2.4 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P PP P P P PP P P P P Sbjct: 317 PPTPKPPKMMKFSVQRGPRPHFHVPNWAPPPKPVKPVSAPCTP 359 >SB_32409| Best HMM Match : Oxidored_q2 (HMM E-Value=0.081) Length = 185 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGG GG G GGG GGG G G GG Sbjct: 124 GGGDGGGG-SDGGGGSDGGGGDGEDDDGGDGDDDDGG 159 Score = 30.3 bits (65), Expect = 2.4 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -2 Query: 944 GGGXGXGG--GXXGGXGGGXXGXXXXGGGG 861 GGG G GG G G GGG G GG G Sbjct: 124 GGGDGGGGSDGGGGSDGGGGDGEDDDGGDG 153 >SB_27885| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.051) Length = 421 Score = 30.3 bits (65), Expect = 2.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXP------XXPPPXPPXXPPPXPXPPP 945 PPPP PP PPP PPP PPP PP Sbjct: 156 PPPPGTQPPGQGGYPGYNQPPPGHYPAPGQPGGYYPPPGGYQQPPPGGYAPP 207 >SB_23371| Best HMM Match : SRCR (HMM E-Value=0) Length = 345 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GGG G G GGG G G GG Sbjct: 142 GDGGGDDGNGGDNNGGGDDGNGGDNNGG 169 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 30.3 bits (65), Expect = 2.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP PP P P P PPP P P PPP Sbjct: 360 PPPGTYYPPPPQGNYNQYPVPGGQNYAGAPPP-PYYPPQEYQAPPP 404 >SB_11167| Best HMM Match : Mucin (HMM E-Value=4.9) Length = 297 Score = 30.3 bits (65), Expect = 2.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PP PP PP P Sbjct: 229 PEPPYPLVDQPSAPPSQEAASSPPYHPPSP 258 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 30.3 bits (65), Expect = 2.4 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPP 928 PP P P P PP PPP PP P Sbjct: 143 PPLPRLRLRLTRLTPPQPSPPQPPQPPPQPPDQQGP 178 Score = 28.3 bits (60), Expect = 9.6 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 882 PPXPPPPXXPXPXPPXPP 935 PP P PP P P PP PP Sbjct: 157 PPQPSPPQPPQP-PPQPP 173 >SB_58388| Best HMM Match : Lipocalin (HMM E-Value=7.4) Length = 246 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +1 Query: 865 PPPXXXXPXX-PPPXPPXXPPPXPXPPP 945 PPP P PPP PP P PPP Sbjct: 158 PPPSSSPPLSSPPPPPPSTPSSSLLPPP 185 >SB_50380| Best HMM Match : PMC2NT (HMM E-Value=2.4) Length = 362 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG 884 GGGG GG G G G GG G Sbjct: 154 GGGGRGGGRGHGRGGSGGGG 173 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GG GGG Sbjct: 154 GGGGRGG-GRGHGRGGSGGGG 173 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 3.2 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 4/49 (8%) Frame = +3 Query: 807 PXXPXPXPPX----TXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P P T P P P P P P P P P P P Sbjct: 36 PTKPSPTTPTSTAPTQTTPTPTTPSPTAPTQTTPTPATPTPTTPTPKTP 84 Score = 28.7 bits (61), Expect = 7.3 Identities = 25/100 (25%), Positives = 25/100 (25%), Gaps = 4/100 (4%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP 831 P P PT S P P P T P P L P P P P Sbjct: 49 PTQTTPTPTTPSPTAPTQTTP-TPATPTPTTPTPKTPTPTTSTLTKPTPATTPTPTKPTP 107 Query: 832 ----PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P P P P P P P P P Sbjct: 108 TAHTPTTPTPTAHTPTKPTPKTPTPTTPTPTAHTPTTPTP 147 Score = 28.3 bits (60), Expect = 9.6 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P P T P P P P P P P P P P Sbjct: 100 PTPTKP-TPTAHTPTTPTPTAHTPTKPTPKTPTPTTPTP 137 >SB_35308| Best HMM Match : VWA (HMM E-Value=1.1e-20) Length = 381 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG GG G GGGG G G Sbjct: 297 GGAGGSGGAGGVGGGGGGTGSCDLG 321 Score = 28.7 bits (61), Expect = 7.3 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG 863 GG GG G G G GG GGG G G Sbjct: 291 GGISASGGAG-GSGGAGGVGGGGGGTG 316 Score = 28.3 bits (60), Expect = 9.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXG 863 GG G G G GGGG G G G Sbjct: 297 GGAGGSGGAGGVGGGGGGTGSCDLG 321 >SB_26560| Best HMM Match : 7tm_1 (HMM E-Value=6.3e-09) Length = 556 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 GG G GG GG GG G GGG Sbjct: 520 GGAIGDGGDNGGGDDGGDDGAGNSDGGG 547 Score = 28.3 bits (60), Expect = 9.6 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -2 Query: 944 GGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GG G G G GGG G GGG G G GGG N Sbjct: 504 GGDDGATVDGDDGAIGGGAIGDGGDNGGG-DDGGDDGAGNSDGGGGNDN 551 >SB_10487| Best HMM Match : FGF (HMM E-Value=1.4e-06) Length = 617 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G G GG G GG GG G Sbjct: 523 GGGDDGDGIDCDGGDGGGGSNGDGGGDG 550 >SB_9718| Best HMM Match : Metallothio_2 (HMM E-Value=1.3) Length = 279 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG 884 GGGG GG G G G GG G Sbjct: 71 GGGGRGGGRGHGRGGSGGGG 90 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GG GGG Sbjct: 71 GGGGRGG-GRGHGRGGSGGGG 90 >SB_7559| Best HMM Match : Metallothio_2 (HMM E-Value=2) Length = 532 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG 884 GGGG GG G G G GG G Sbjct: 324 GGGGRGGGRGRGRGGSGGGG 343 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GG GGG Sbjct: 324 GGGGRGG-GRGRGRGGSGGGG 343 >SB_3802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 29.9 bits (64), Expect = 3.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPP 902 P PP PPP PPPP Sbjct: 171 PSPPPSGAPPPPPPPP 186 Score = 29.1 bits (62), Expect = 5.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPP 941 P P PPP P PP PPPP Sbjct: 169 PNPSPPPSGAP---PPPPPPP 186 Score = 29.1 bits (62), Expect = 5.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 890 PXPPPXPPXXPPPXPXPP 943 P P P P PPP P PP Sbjct: 169 PNPSPPPSGAPPPPPPPP 186 >SB_59765| Best HMM Match : Metallothio_2 (HMM E-Value=4.3) Length = 229 Score = 29.9 bits (64), Expect = 3.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG 884 GGGG GG G G G GG G Sbjct: 124 GGGGRGGGRGYGRGGSGGGG 143 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GG GGG Sbjct: 124 GGGGRGG-GRGYGRGGSGGGG 143 >SB_59680| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 412 Score = 29.9 bits (64), Expect = 3.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P PPP PPP P P PP Sbjct: 179 PPPLNPYQPPPFPPPHLM-YPQPTAPP 204 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,707,658 Number of Sequences: 59808 Number of extensions: 648951 Number of successful extensions: 25777 Number of sequences better than 10.0: 309 Number of HSP's better than 10.0 without gapping: 1634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8261 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2788625034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -