BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N23 (951 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S62170-1|AAB26902.1| 112|Drosophila melanogaster acidic ribosom... 135 7e-32 AY069125-1|AAL39270.1| 112|Drosophila melanogaster GH13422p pro... 135 7e-32 AE014134-102|AAF51499.1| 112|Drosophila melanogaster CG4087-PA ... 135 7e-32 Y00504-1|CAA68557.1| 112|Drosophila melanogaster protein ( Dros... 129 6e-30 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 60 6e-09 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 60 6e-09 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 60 6e-09 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 54 2e-07 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 54 2e-07 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 54 3e-07 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 53 5e-07 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 53 5e-07 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 53 5e-07 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 53 5e-07 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 53 5e-07 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 52 2e-06 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 52 2e-06 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 52 2e-06 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 51 2e-06 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 51 2e-06 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 51 2e-06 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 51 2e-06 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 51 3e-06 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 51 3e-06 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 51 3e-06 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 51 3e-06 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 51 3e-06 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 51 3e-06 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 51 3e-06 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 51 3e-06 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 51 3e-06 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 51 3e-06 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 51 3e-06 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 51 3e-06 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 50 4e-06 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 50 4e-06 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 50 4e-06 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 50 4e-06 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 50 4e-06 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 50 4e-06 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 50 5e-06 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 50 5e-06 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 50 5e-06 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 50 5e-06 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 50 5e-06 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 50 6e-06 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 50 6e-06 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 50 6e-06 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 50 6e-06 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 50 6e-06 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 50 6e-06 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 49 8e-06 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 49 8e-06 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 49 1e-05 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 48 1e-05 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 48 2e-05 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 48 2e-05 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 48 2e-05 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 48 2e-05 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 48 3e-05 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 48 3e-05 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 48 3e-05 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 48 3e-05 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 48 3e-05 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 48 3e-05 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 48 3e-05 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 42 3e-05 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 42 3e-05 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 47 4e-05 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 46 6e-05 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 46 6e-05 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 46 6e-05 AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-P... 46 8e-05 AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p pro... 45 1e-04 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 45 1e-04 AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA... 45 1e-04 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 45 1e-04 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 45 2e-04 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 45 2e-04 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 45 2e-04 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 45 2e-04 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 45 2e-04 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 45 2e-04 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 45 2e-04 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 45 2e-04 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 44 2e-04 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 44 2e-04 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 44 2e-04 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 44 2e-04 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 44 2e-04 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 44 2e-04 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 44 2e-04 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 44 3e-04 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 44 3e-04 AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p pro... 44 4e-04 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 44 4e-04 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 44 4e-04 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 44 4e-04 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 44 4e-04 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 44 4e-04 AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA... 44 4e-04 BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p pro... 43 5e-04 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 43 5e-04 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 43 5e-04 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 43 5e-04 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 43 5e-04 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 43 5e-04 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 43 5e-04 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 43 5e-04 AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA... 43 5e-04 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 43 7e-04 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 43 7e-04 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 43 7e-04 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 43 7e-04 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 43 7e-04 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 43 7e-04 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 43 7e-04 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 43 7e-04 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 43 7e-04 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 43 7e-04 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 42 0.001 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 42 0.001 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 42 0.001 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 42 0.001 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 42 0.001 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 42 0.001 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 42 0.002 AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p pro... 42 0.002 AY095057-1|AAM11385.1| 258|Drosophila melanogaster LD46359p pro... 42 0.002 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 42 0.002 AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p pro... 42 0.002 AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 prot... 42 0.002 AJ249466-1|CAB60724.1| 258|Drosophila melanogaster DXl6 protein... 42 0.002 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 42 0.002 AF232774-1|AAF43414.1| 258|Drosophila melanogaster SR family sp... 42 0.002 AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA... 42 0.002 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 42 0.002 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 42 0.002 AE014134-1188|AAF52454.1| 258|Drosophila melanogaster CG10203-P... 42 0.002 AY113614-1|AAM29619.1| 121|Drosophila melanogaster RH62530p pro... 41 0.002 AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p pro... 41 0.002 AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p pro... 41 0.002 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 41 0.002 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 41 0.002 AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-P... 41 0.002 AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA... 41 0.002 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 41 0.002 AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA... 41 0.002 AE013599-1232|AAF58699.1| 121|Drosophila melanogaster CG9080-PA... 41 0.002 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 41 0.003 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 41 0.003 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 41 0.003 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 41 0.003 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 41 0.003 AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA... 41 0.003 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 41 0.003 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 41 0.003 AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA... 41 0.003 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 40 0.004 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 40 0.004 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 40 0.004 BT003569-1|AAO39573.1| 745|Drosophila melanogaster LD44990p pro... 40 0.004 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 40 0.004 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 40 0.004 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 40 0.004 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 40 0.004 AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-P... 40 0.004 AE014298-1795|AAF48187.3| 1470|Drosophila melanogaster CG17762-P... 40 0.004 AE014298-1794|AAF48188.3| 1173|Drosophila melanogaster CG17762-P... 40 0.004 AE014298-1793|AAF48190.3| 1173|Drosophila melanogaster CG17762-P... 40 0.004 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 40 0.004 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 40 0.004 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 40 0.004 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 40 0.004 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 40 0.004 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 40 0.004 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 40 0.004 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 40 0.005 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 40 0.005 AY094834-1|AAM11187.1| 342|Drosophila melanogaster LD42296p pro... 40 0.005 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 40 0.005 AE013599-3979|AAF47289.2| 342|Drosophila melanogaster CG9083-PA... 40 0.005 U62542-1|AAB05771.1| 901|Drosophila melanogaster dead ringer pr... 40 0.007 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 40 0.007 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 40 0.007 AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p pro... 40 0.007 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 40 0.007 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 40 0.007 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 40 0.007 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 40 0.007 AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-P... 40 0.007 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 40 0.007 AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p pro... 39 0.009 AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 prot... 39 0.009 AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 prot... 39 0.009 AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA... 39 0.009 AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB... 39 0.009 AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA... 39 0.009 AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-P... 39 0.009 AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-P... 39 0.009 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 39 0.009 AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein... 39 0.009 AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein... 39 0.009 AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein... 39 0.009 AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein... 39 0.009 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 39 0.012 AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-P... 33 0.014 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 38 0.015 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 38 0.015 AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p pro... 38 0.015 AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p pro... 38 0.015 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 38 0.015 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 38 0.015 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 38 0.015 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 38 0.015 AY071177-1|AAL48799.1| 212|Drosophila melanogaster RE23041p pro... 38 0.015 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 38 0.015 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 38 0.015 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 38 0.015 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 38 0.015 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 38 0.015 AE014297-416|AAF51905.3| 393|Drosophila melanogaster CG10303-PA... 38 0.015 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 38 0.015 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 38 0.015 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 38 0.015 AE013599-3650|AAF47037.3| 906|Drosophila melanogaster CG5403-PA... 38 0.015 AE013599-3649|AAO41347.1| 911|Drosophila melanogaster CG5403-PB... 38 0.015 AE013599-2046|AAF58146.2| 212|Drosophila melanogaster CG8160-PA... 38 0.015 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 38 0.015 X59772-1|CAB36921.1| 850|Drosophila melanogaster ovo protein pr... 38 0.020 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 38 0.020 U11383-1|AAB60216.1| 1028|Drosophila melanogaster Ovo-1028aa pro... 38 0.020 M74121-1|AAC41573.1| 1293|Drosophila melanogaster maleless prote... 38 0.020 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 38 0.020 BT015199-1|AAT94428.1| 335|Drosophila melanogaster RE69682p pro... 38 0.020 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 38 0.020 BT011093-1|AAR82759.1| 236|Drosophila melanogaster RE40656p pro... 38 0.020 BT010267-1|AAQ23585.1| 936|Drosophila melanogaster RE21725p pro... 38 0.020 BT003785-1|AAO41468.1| 936|Drosophila melanogaster LD44547p pro... 38 0.020 BT003575-1|AAO39579.1| 994|Drosophila melanogaster LD33058p pro... 38 0.020 AY119649-1|AAM50303.1| 975|Drosophila melanogaster RE46053p pro... 38 0.020 AY118596-1|AAM49965.1| 165|Drosophila melanogaster LD48005p pro... 38 0.020 AY094838-1|AAM11191.1| 1351|Drosophila melanogaster LD47350p pro... 38 0.020 AY075371-1|AAL68216.1| 165|Drosophila melanogaster GM14667p pro... 38 0.020 AM412888-1|CAL85511.1| 116|Drosophila melanogaster CG9080 prote... 38 0.020 AM412887-1|CAL85510.1| 116|Drosophila melanogaster CG9080 prote... 38 0.020 AM412886-1|CAL85509.1| 116|Drosophila melanogaster CG9080 prote... 38 0.020 AM412885-1|CAL85508.1| 116|Drosophila melanogaster CG9080 prote... 38 0.020 AJ430589-1|CAD23207.1| 1222|Drosophila melanogaster ovoA protein... 38 0.020 AJ430588-1|CAD23206.1| 1354|Drosophila melanogaster shavenbaby p... 38 0.020 AF314193-1|AAK00302.1| 3109|Drosophila melanogaster Toutatis pro... 38 0.020 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 38 0.020 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 38 0.020 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 38 0.020 AE014298-2533|AAF48705.1| 209|Drosophila melanogaster CG5070-PA... 38 0.020 AE014298-2505|AAF48684.1| 335|Drosophila melanogaster CG13001-P... 38 0.020 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 38 0.020 AE014298-702|AAF46002.2| 975|Drosophila melanogaster CG6824-PA,... 38 0.020 AE014298-701|ABC67174.1| 1028|Drosophila melanogaster CG6824-PD,... 38 0.020 AE014298-700|AAF46003.2| 1222|Drosophila melanogaster CG6824-PC,... 38 0.020 AE014298-699|AAF46001.2| 1351|Drosophila melanogaster CG6824-PB,... 38 0.020 AE014297-1603|AAF54881.2| 1013|Drosophila melanogaster CG31342-P... 38 0.020 AE013599-3513|AAN16117.1| 165|Drosophila melanogaster CG3800-PA... 38 0.020 AE013599-1322|AAF58638.2| 3080|Drosophila melanogaster CG10897-P... 38 0.020 AE013599-124|AAM68335.1| 936|Drosophila melanogaster CG11680-PC... 38 0.020 AE013599-123|AAF57297.1| 1293|Drosophila melanogaster CG11680-PA... 38 0.020 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 38 0.027 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 38 0.027 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 38 0.027 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 38 0.027 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 38 0.027 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 38 0.027 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 38 0.027 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 38 0.027 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 37 0.035 BT024335-1|ABC86397.1| 257|Drosophila melanogaster IP09958p pro... 37 0.035 BT003516-1|AAO39520.1| 153|Drosophila melanogaster RE25364p pro... 37 0.035 AY075314-1|AAL68181.1| 474|Drosophila melanogaster GH04404p pro... 37 0.035 AY069304-1|AAL39449.1| 587|Drosophila melanogaster HL07962p pro... 37 0.035 AE014298-1675|AAF48083.2| 587|Drosophila melanogaster CG1841-PB... 37 0.035 AE014298-1674|AAN09296.1| 587|Drosophila melanogaster CG1841-PA... 37 0.035 AE014297-2377|AAF55442.2| 153|Drosophila melanogaster CG14327-P... 37 0.035 AE014297-1444|AAF54744.1| 474|Drosophila melanogaster CG31358-P... 37 0.035 AE014296-2979|ABC66133.1| 329|Drosophila melanogaster CG34002-P... 37 0.035 AE013599-1467|AAF58524.2| 259|Drosophila melanogaster CG30042-P... 37 0.035 X54251-1|CAA38152.1| 1596|Drosophila melanogaster nuclear protei... 37 0.047 U88570-1|AAB53050.1| 3190|Drosophila melanogaster CREB-binding p... 37 0.047 M83931-1|AAB04680.1| 1595|Drosophila melanogaster son of sevenle... 37 0.047 M77501-1|AAA28904.1| 1596|Drosophila melanogaster son of sevenle... 37 0.047 DQ991915-1|ABJ09588.1| 2176|Drosophila melanogaster eyes shut pr... 37 0.047 DQ780942-1|ABH07112.1| 2165|Drosophila melanogaster spacemaker p... 37 0.047 BT023751-1|AAZ41759.1| 1594|Drosophila melanogaster RH56202p pro... 37 0.047 BT015294-1|AAT94523.1| 1596|Drosophila melanogaster GH01796p pro... 37 0.047 BT010035-1|AAQ22504.1| 1596|Drosophila melanogaster LD47819p pro... 37 0.047 AY051892-1|AAK93316.1| 349|Drosophila melanogaster LD38046p pro... 37 0.047 AY047507-1|AAK77239.1| 390|Drosophila melanogaster GH01592p pro... 37 0.047 AL023874-7|CAA19643.1| 552|Drosophila melanogaster EG:100G10.1 ... 37 0.047 AE014298-2938|AAN09519.1| 1596|Drosophila melanogaster CG12701-P... 37 0.047 AE014298-2937|AAF49020.1| 1596|Drosophila melanogaster CG12701-P... 37 0.047 AE014298-1424|AAF46566.2| 349|Drosophila melanogaster CG2961-PA... 37 0.047 AE014298-1361|AAF46516.2| 3276|Drosophila melanogaster CG15319-P... 37 0.047 AE014298-449|AAF45812.1| 552|Drosophila melanogaster CG2685-PA ... 37 0.047 AE014134-2404|AAF53336.2| 1596|Drosophila melanogaster CG7793-PA... 37 0.047 AE014134-390|AAZ83988.1| 1984|Drosophila melanogaster CG33955-PB... 37 0.047 AE013599-2490|AAS64820.1| 390|Drosophila melanogaster CG4847-PE... 37 0.047 AE013599-2489|AAM70882.1| 390|Drosophila melanogaster CG4847-PC... 37 0.047 AE013599-2488|AAM70881.1| 390|Drosophila melanogaster CG4847-PB... 37 0.047 AE013599-2487|AAF57850.1| 390|Drosophila melanogaster CG4847-PA... 37 0.047 AE013599-2486|AAM70880.1| 420|Drosophila melanogaster CG4847-PD... 37 0.047 AE013599-1817|AAF58300.2| 1594|Drosophila melanogaster CG8118-PB... 37 0.047 AE013599-1816|AAF58299.1| 1594|Drosophila melanogaster CG8118-PA... 37 0.047 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 36 0.062 BT021376-1|AAX33524.1| 758|Drosophila melanogaster LD46788p pro... 36 0.062 BT003571-1|AAO39575.1| 285|Drosophila melanogaster LD41821p pro... 36 0.062 BT001610-1|AAN71365.1| 279|Drosophila melanogaster RE31819p pro... 36 0.062 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 36 0.062 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 36 0.062 AY084171-1|AAL89909.1| 286|Drosophila melanogaster RE40851p pro... 36 0.062 AY070499-1|AAL47970.1| 428|Drosophila melanogaster GH07841p pro... 36 0.062 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 36 0.062 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 36 0.062 AJ243904-1|CAB64937.1| 773|Drosophila melanogaster SF1 protein ... 36 0.062 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 36 0.062 AE014298-2546|AAF48714.1| 250|Drosophila melanogaster CG10597-P... 36 0.062 AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA... 36 0.062 AE014298-972|AAF46216.3| 758|Drosophila melanogaster CG33691-PA... 36 0.062 AE014298-971|AAZ52507.1| 702|Drosophila melanogaster CG33691-PC... 36 0.062 AE014297-3971|AAN14080.1| 279|Drosophila melanogaster CG6447-PB... 36 0.062 AE014297-3970|AAF56603.2| 285|Drosophila melanogaster CG6447-PA... 36 0.062 AE014297-3969|AAF56602.1| 286|Drosophila melanogaster CG6478-PA... 36 0.062 AE014296-3128|AAF49173.1| 224|Drosophila melanogaster CG14089-P... 36 0.062 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 36 0.062 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 36 0.062 AE013599-1819|AAS64855.1| 433|Drosophila melanogaster CG8118-PC... 36 0.062 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 36 0.082 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 36 0.082 BT001726-1|AAN71481.1| 440|Drosophila melanogaster RE69884p pro... 36 0.082 AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p pro... 36 0.082 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 36 0.082 AE014298-2027|AAN09585.1| 2148|Drosophila melanogaster CG1517-PC... 36 0.082 AE014298-2026|AAF48365.2| 2196|Drosophila melanogaster CG1517-PB... 36 0.082 AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P... 36 0.082 AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P... 36 0.082 AE014298-979|AAF46221.2| 1027|Drosophila melanogaster CG14431-PA... 36 0.082 AE014297-778|AAF54262.1| 798|Drosophila melanogaster CG9748-PA ... 36 0.082 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 36 0.082 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 36 0.082 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 36 0.082 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 36 0.082 AE013599-1671|AAF58402.1| 440|Drosophila melanogaster CG4663-PA... 36 0.082 U42699-1|AAA96754.1| 924|Drosophila melanogaster trachealess pr... 36 0.11 AY071379-1|AAL49001.1| 288|Drosophila melanogaster RE40518p pro... 36 0.11 AL031583-7|CAB41346.1| 359|Drosophila melanogaster EG:34F3.10 p... 36 0.11 AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH0604... 36 0.11 AE014298-2781|AAF48895.2| 1868|Drosophila melanogaster CG7282-PA... 36 0.11 AE014298-1582|AAF48018.1| 267|Drosophila melanogaster CG12625-P... 36 0.11 AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA ... 36 0.11 AE014298-111|AAF45553.2| 359|Drosophila melanogaster CG13358-PA... 36 0.11 AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA... 36 0.11 AE014297-3967|AAF56600.1| 288|Drosophila melanogaster CG5468-PA... 36 0.11 AE014297-1933|AAF55130.1| 537|Drosophila melanogaster CG3984-PA... 36 0.11 AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA... 36 0.11 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 35 0.14 M71251-1|AAA28503.1| 159|Drosophila melanogaster EDG-91 protein. 35 0.14 M71250-1|AAA28502.1| 159|Drosophila melanogaster EDG-91 protein. 35 0.14 DQ138920-1|ABA86526.1| 1505|Drosophila melanogaster CG17766 prot... 35 0.14 BT028784-1|ABI34165.1| 800|Drosophila melanogaster IP07646p pro... 35 0.14 BT023264-1|AAY55680.1| 154|Drosophila melanogaster IP02678p pro... 35 0.14 BT015183-1|AAT94412.1| 1525|Drosophila melanogaster SD05962p pro... 35 0.14 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 35 0.14 AY075226-1|AAL68093.1| 495|Drosophila melanogaster AT17674p pro... 35 0.14 AY069647-1|AAL39792.1| 337|Drosophila melanogaster LD41395p pro... 35 0.14 AL021086-3|CAA15934.1| 1471|Drosophila melanogaster EG:86E4.3 pr... 35 0.14 AE014298-295|AAF45693.1| 1525|Drosophila melanogaster CG17766-PA... 35 0.14 AE014297-2769|AAF55745.3| 1314|Drosophila melanogaster CG34139-P... 35 0.14 AE014297-2375|AAF55440.1| 159|Drosophila melanogaster CG7539-PA... 35 0.14 AE014297-1087|AAF54491.1| 695|Drosophila melanogaster CG12809-P... 35 0.14 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 35 0.14 AE014296-2974|AAF49295.1| 337|Drosophila melanogaster CG5546-PA... 35 0.14 AE014134-1764|ABI31305.1| 778|Drosophila melanogaster CG34109-P... 35 0.14 AE014134-1754|AAF52849.2| 1317|Drosophila melanogaster CG13131-P... 35 0.14 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 35 0.14 X76210-1|CAA53803.1| 389|Drosophila melanogaster homeotic ultra... 35 0.19 X05723-1|CAA29194.1| 389|Drosophila melanogaster Ultrabithorax ... 35 0.19 U75467-2|AAB18342.1| 579|Drosophila melanogaster Rga protein. 35 0.19 U31961-13|AAA84410.1| 346|Drosophila melanogaster UBXIVA protein. 35 0.19 U31961-12|AAA84409.1| 363|Drosophila melanogaster UBXIIA protein. 35 0.19 U31961-11|AAA84408.1| 380|Drosophila melanogaster UBXIA protein. 35 0.19 U31961-10|AAA84411.1| 372|Drosophila melanogaster UBXIIB protein. 35 0.19 U31961-9|AAA84412.1| 389|Drosophila melanogaster UBXIB protein. 35 0.19 BT025208-1|ABF17899.1| 585|Drosophila melanogaster FI01108p pro... 35 0.19 BT011461-1|AAR99119.1| 638|Drosophila melanogaster RE27685p pro... 35 0.19 BT011351-1|AAR96143.1| 638|Drosophila melanogaster RE74788p pro... 35 0.19 BT010241-1|AAQ23559.1| 380|Drosophila melanogaster RE43738p pro... 35 0.19 BT003529-1|AAO39533.1| 987|Drosophila melanogaster RE18590p pro... 35 0.19 BT001672-1|AAN71427.1| 315|Drosophila melanogaster RE50346p pro... 35 0.19 AY094772-1|AAM11125.1| 585|Drosophila melanogaster GM14102p pro... 35 0.19 AY069684-1|AAL39829.1| 238|Drosophila melanogaster LD45549p pro... 35 0.19 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 35 0.19 AJ238947-1|CAB64936.1| 496|Drosophila melanogaster heterogeneou... 35 0.19 AF275629-1|AAF78762.1| 508|Drosophila melanogaster bancal prote... 35 0.19 AF192484-1|AAF27346.1| 440|Drosophila melanogaster discs overgr... 35 0.19 AF142631-1|AAF00596.1| 490|Drosophila melanogaster hnRNP K prot... 35 0.19 AF132558-1|AAD27857.1| 440|Drosophila melanogaster double-time ... 35 0.19 AF055583-1|AAC39134.1| 440|Drosophila melanogaster casein kinas... 35 0.19 AE014297-4701|AAF57109.1| 440|Drosophila melanogaster CG2048-PC... 35 0.19 AE014297-4700|AAF57108.1| 440|Drosophila melanogaster CG2048-PB... 35 0.19 AE014297-4699|AAF57110.1| 440|Drosophila melanogaster CG2048-PA... 35 0.19 AE014297-2261|AAF55355.2| 389|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-2260|AAN13719.1| 372|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-2259|AAS65158.1| 355|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-2258|AAN13718.1| 380|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-2257|AAN13717.1| 363|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-2256|AAF55356.1| 346|Drosophila melanogaster CG10388-P... 35 0.19 AE014297-952|AAF54387.1| 632|Drosophila melanogaster CG9373-PA ... 35 0.19 AE014297-461|AAN13377.1| 646|Drosophila melanogaster CG1021-PB,... 35 0.19 AE014297-460|AAF54123.2| 646|Drosophila melanogaster CG1021-PA,... 35 0.19 AE014297-302|AAF51992.2| 585|Drosophila melanogaster CG2161-PA,... 35 0.19 AE014297-301|AAN13250.1| 579|Drosophila melanogaster CG2161-PB,... 35 0.19 AE014296-2682|AAF49505.1| 206|Drosophila melanogaster CG13048-P... 35 0.19 AE013599-3307|AAF46785.2| 204|Drosophila melanogaster CG13499-P... 35 0.19 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 35 0.19 AE013599-3039|AAS64908.1| 315|Drosophila melanogaster CG13425-P... 35 0.19 AE013599-3038|AAM68390.2| 413|Drosophila melanogaster CG13425-P... 35 0.19 AE013599-3036|AAF57450.2| 496|Drosophila melanogaster CG13425-P... 35 0.19 AE013599-3035|AAM68389.2| 502|Drosophila melanogaster CG13425-P... 35 0.19 X52846-1|CAA37037.1| 575|Drosophila melanogaster protein ( Dros... 34 0.25 X12945-1|CAA31405.1| 661|Drosophila melanogaster vasa protein. 34 0.25 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 34 0.25 U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor ... 34 0.25 M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha rec... 34 0.25 M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha rec... 34 0.25 M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha rec... 34 0.25 M25545-4|AAA28621.1| 361|Drosophila melanogaster protein ( D.me... 34 0.25 M25545-3|AAA28624.1| 365|Drosophila melanogaster protein ( D.me... 34 0.25 M25545-2|AAA28623.1| 360|Drosophila melanogaster protein ( D.me... 34 0.25 M25545-1|AAA28622.1| 364|Drosophila melanogaster protein ( D.me... 34 0.25 M23560-1|AAA29013.1| 648|Drosophila melanogaster protein ( D.me... 34 0.25 M15766-1|AAA70426.1| 365|Drosophila melanogaster unknown protei... 34 0.25 BT030124-1|ABN49263.1| 655|Drosophila melanogaster IP13804p pro... 34 0.25 BT023944-1|ABB36448.1| 834|Drosophila melanogaster LD32364p pro... 34 0.25 BT015209-1|AAT94438.1| 575|Drosophila melanogaster RE56857p pro... 34 0.25 BT011476-1|AAR99134.1| 719|Drosophila melanogaster RE11923p pro... 34 0.25 BT001716-1|AAN71471.1| 578|Drosophila melanogaster RE68337p pro... 34 0.25 AY122212-1|AAM52724.1| 658|Drosophila melanogaster LP07906p pro... 34 0.25 AY118297-1|AAM48326.1| 659|Drosophila melanogaster GH07242p pro... 34 0.25 AY113357-1|AAM29362.1| 445|Drosophila melanogaster GM14473p pro... 34 0.25 AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p pro... 34 0.25 AY061579-1|AAL29127.1| 613|Drosophila melanogaster SD02991p pro... 34 0.25 AY061448-1|AAL28996.1| 361|Drosophila melanogaster LD38464p pro... 34 0.25 AY061169-1|AAL28717.1| 346|Drosophila melanogaster LD13761p pro... 34 0.25 AF247763-1|AAF74194.1| 613|Drosophila melanogaster SCAR protein. 34 0.25 AE014298-2513|AAF48690.2| 834|Drosophila melanogaster CG8949-PA... 34 0.25 AE014298-1814|AAF48205.2| 963|Drosophila melanogaster CG32648-P... 34 0.25 AE014298-478|AAN09091.2| 627|Drosophila melanogaster CG3588-PC,... 34 0.25 AE014298-477|AAZ52489.1| 655|Drosophila melanogaster CG3588-PD,... 34 0.25 AE014298-476|AAN09092.1| 655|Drosophila melanogaster CG3588-PA,... 34 0.25 AE014297-4248|AAN14144.1| 361|Drosophila melanogaster CG9983-PF... 34 0.25 AE014297-4247|AAN14143.1| 361|Drosophila melanogaster CG9983-PD... 34 0.25 AE014297-4246|AAN14142.1| 365|Drosophila melanogaster CG9983-PC... 34 0.25 AE014297-4245|AAF56801.1| 365|Drosophila melanogaster CG9983-PB... 34 0.25 AE014297-4244|AAN14141.1| 360|Drosophila melanogaster CG9983-PE... 34 0.25 AE014297-4243|AAF56800.2| 364|Drosophila melanogaster CG9983-PA... 34 0.25 AE014297-2460|AAN13763.1| 445|Drosophila melanogaster CG7187-PC... 34 0.25 >S62170-1|AAB26902.1| 112|Drosophila melanogaster acidic ribosomal protein rpA2 protein. Length = 112 Score = 135 bits (327), Expect = 7e-32 Identities = 70/112 (62%), Positives = 76/112 (67%) Frame = +3 Query: 93 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 272 M +KAELACVY++LILVDDDVAVTGEKI+TILKAA V+VEPYWPGLFAKALEGINV+DLI Sbjct: 1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLI 60 Query: 273 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 428 TNIGSGV SDDDMGFGLFD Sbjct: 61 TNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112 >AY069125-1|AAL39270.1| 112|Drosophila melanogaster GH13422p protein. Length = 112 Score = 135 bits (327), Expect = 7e-32 Identities = 70/112 (62%), Positives = 76/112 (67%) Frame = +3 Query: 93 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 272 M +KAELACVY++LILVDDDVAVTGEKI+TILKAA V+VEPYWPGLFAKALEGINV+DLI Sbjct: 1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLI 60 Query: 273 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 428 TNIGSGV SDDDMGFGLFD Sbjct: 61 TNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112 >AE014134-102|AAF51499.1| 112|Drosophila melanogaster CG4087-PA protein. Length = 112 Score = 135 bits (327), Expect = 7e-32 Identities = 70/112 (62%), Positives = 76/112 (67%) Frame = +3 Query: 93 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 272 M +KAELACVY++LILVDDDVAVTGEKI+TILKAA V+VEPYWPGLFAKALEGINV+DLI Sbjct: 1 MSTKAELACVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEGINVKDLI 60 Query: 273 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 428 TNIGSGV SDDDMGFGLFD Sbjct: 61 TNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112 >Y00504-1|CAA68557.1| 112|Drosophila melanogaster protein ( Drosophila melanogastermRNA for A-type ribosomal protein rp21C. ). Length = 112 Score = 129 bits (311), Expect = 6e-30 Identities = 68/112 (60%), Positives = 74/112 (66%) Frame = +3 Query: 93 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 272 M +KAELA VY++LILVDDDVAVTGEKI+TILKAA V+VEPYWPGLFAKALE INV+DLI Sbjct: 1 MSTKAELASVYASLILVDDDVAVTGEKINTILKAANVEVEPYWPGLFAKALEAINVKDLI 60 Query: 273 TNIGSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDDDMGFGLFD 428 TNIGSGV SDDDMGFGLFD Sbjct: 61 TNIGSGVGAAPAGGAAPAAAAAAPAAESKKEEKKKEEESDQSDDDMGFGLFD 112 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 59.7 bits (138), Expect = 6e-09 Identities = 37/102 (36%), Positives = 40/102 (39%), Gaps = 7/102 (6%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPX---PP 834 P P S K + P P P ++ P P P P F PPPP P PP Sbjct: 96 PPPRPASPK----VEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPP 151 Query: 835 XPXXXXXXXPPPPXXXXPXXPPPXPPXXPP---PXPXPPPXP 951 P PPPP PPP PP PP P P PPP P Sbjct: 152 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Score = 51.6 bits (118), Expect = 2e-06 Identities = 41/145 (28%), Positives = 42/145 (28%), Gaps = 5/145 (3%) Frame = +1 Query: 532 PPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALX 711 PP PP P P P E P P P Sbjct: 94 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 153 Query: 712 PXVP-ILPXNQTXPPXI-PXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXXXXXPPPPX 876 P P I P PP + P P PPPP P PP P PPPP Sbjct: 154 PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPP 213 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P Sbjct: 214 APTELEPPP-PPAPPKVELPPPPAP 237 Score = 51.2 bits (117), Expect = 2e-06 Identities = 41/150 (27%), Positives = 44/150 (29%), Gaps = 6/150 (4%) Frame = +1 Query: 520 IXXPPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFR 699 + PP P PPP P P +P P P Sbjct: 86 VPAPPKVNPPPPPRPASPKVEPPP---PAPPGVESPPGPQPPASPRFDPPPP-------- 134 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H + P P P PP P P PP P PP P PPPP Sbjct: 135 HTIEPPPPPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 193 Query: 880 XXPXXPPPXPP--XXPPPXPXP----PPXP 951 PPP P PPP P P PP P Sbjct: 194 TKVEPPPPPAPAEVEPPPPPAPTELEPPPP 223 Score = 49.2 bits (112), Expect = 8e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P P PPPP P P PPPPP Sbjct: 157 PTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P L P P P P T P PP P P PPPP P P PPP P Sbjct: 146 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 44.8 bits (101), Expect = 2e-04 Identities = 40/146 (27%), Positives = 42/146 (28%), Gaps = 9/146 (6%) Frame = +3 Query: 525 PPPPXXPXPPXXXP---STXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXTXXLIXQI 695 PPPP P P P + G SP S P P P PP P L+ Sbjct: 94 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPAPPTLVPPP 152 Query: 696 SSCXXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXXPX----PXPPXTXXXXXPXP 863 P P P P P PP P P Sbjct: 153 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 212 Query: 864 PXPXX--PPPXPPPPXXPXPXPPXPP 935 P P PPP P PP P PP PP Sbjct: 213 PAPTELEPPPPPAPPKVELPPPPAPP 238 Score = 35.9 bits (79), Expect = 0.082 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXX---PXPXPP-----XPPPP 941 P PP P P P PP P PP P P PP PPPP Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPP 134 Score = 35.1 bits (77), Expect = 0.14 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXX--PPPXPPXXP-PPXPXPPPXP 951 P P P P PPPP P PPP PP PP P PP P Sbjct: 81 PEPVQVPAPPKVNP---PPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 127 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXP-PPXPXPP 943 P PP P P P P PPP PP PP P PP Sbjct: 199 PPPPAPAEVEPP----PPPAPTELEPPPPPAPPKVELPPPPAPP 238 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 59.7 bits (138), Expect = 6e-09 Identities = 37/102 (36%), Positives = 40/102 (39%), Gaps = 7/102 (6%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPX---PP 834 P P S K + P P P ++ P P P P F PPPP P PP Sbjct: 359 PPPRPASPK----VEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPP 414 Query: 835 XPXXXXXXXPPPPXXXXPXXPPPXPPXXPP---PXPXPPPXP 951 P PPPP PPP PP PP P P PPP P Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 51.6 bits (118), Expect = 2e-06 Identities = 41/145 (28%), Positives = 42/145 (28%), Gaps = 5/145 (3%) Frame = +1 Query: 532 PPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALX 711 PP PP P P P E P P P Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 416 Query: 712 PXVP-ILPXNQTXPPXI-PXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXXXXXPPPPX 876 P P I P PP + P P PPPP P PP P PPPP Sbjct: 417 PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P Sbjct: 477 APTELEPPP-PPAPPKVELPPPPAP 500 Score = 51.2 bits (117), Expect = 2e-06 Identities = 41/150 (27%), Positives = 44/150 (29%), Gaps = 6/150 (4%) Frame = +1 Query: 520 IXXPPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFR 699 + PP P PPP P P +P P P Sbjct: 349 VPAPPKVNPPPPPRPASPKVEPPP---PAPPGVESPPGPQPPASPRFDPPPP-------- 397 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H + P P P PP P P PP P PP P PPPP Sbjct: 398 HTIEPPPPPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Query: 880 XXPXXPPPXPP--XXPPPXPXP----PPXP 951 PPP P PPP P P PP P Sbjct: 457 TKVEPPPPPAPAEVEPPPPPAPTELEPPPP 486 Score = 49.2 bits (112), Expect = 8e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P P PPPP P P PPPPP Sbjct: 420 PTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P L P P P P T P PP P P PPPP P P PPP P Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 44.8 bits (101), Expect = 2e-04 Identities = 40/146 (27%), Positives = 42/146 (28%), Gaps = 9/146 (6%) Frame = +3 Query: 525 PPPPXXPXPPXXXP---STXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXTXXLIXQI 695 PPPP P P P + G SP S P P P PP P L+ Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPAPPTLVPPP 415 Query: 696 SSCXXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXXPX----PXPPXTXXXXXPXP 863 P P P P P PP P P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Query: 864 PXPXX--PPPXPPPPXXPXPXPPXPP 935 P P PPP P PP P PP PP Sbjct: 476 PAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 35.9 bits (79), Expect = 0.082 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXX---PXPXPP-----XPPPP 941 P PP P P P PP P PP P P PP PPPP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPP 397 Score = 35.1 bits (77), Expect = 0.14 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXX--PPPXPPXXP-PPXPXPPPXP 951 P P P P PPPP P PPP PP PP P PP P Sbjct: 344 PEPVQVPAPPKVNP---PPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 390 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXP-PPXPXPP 943 P PP P P P P PPP PP PP P PP Sbjct: 462 PPPPAPAEVEPP----PPPAPTELEPPPPPAPPKVELPPPPAPP 501 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 59.7 bits (138), Expect = 6e-09 Identities = 37/102 (36%), Positives = 40/102 (39%), Gaps = 7/102 (6%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPX---PP 834 P P S K + P P P ++ P P P P F PPPP P PP Sbjct: 359 PPPRPASPK----VEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPP 414 Query: 835 XPXXXXXXXPPPPXXXXPXXPPPXPPXXPP---PXPXPPPXP 951 P PPPP PPP PP PP P P PPP P Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Score = 51.6 bits (118), Expect = 2e-06 Identities = 41/145 (28%), Positives = 42/145 (28%), Gaps = 5/145 (3%) Frame = +1 Query: 532 PPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALX 711 PP PP P P P E P P P Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPP 416 Query: 712 PXVP-ILPXNQTXPPXI-PXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXXXXXPPPPX 876 P P I P PP + P P PPPP P PP P PPPP Sbjct: 417 PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPP 476 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PPP P Sbjct: 477 APTELEPPP-PPAPPKVELPPPPAP 500 Score = 51.2 bits (117), Expect = 2e-06 Identities = 41/150 (27%), Positives = 44/150 (29%), Gaps = 6/150 (4%) Frame = +1 Query: 520 IXXPPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFR 699 + PP P PPP P P +P P P Sbjct: 349 VPAPPKVNPPPPPRPASPKVEPPP---PAPPGVESPPGPQPPASPRFDPPPP-------- 397 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 H + P P P PP P P PP P PP P PPPP Sbjct: 398 HTIEPPPPPAPPTLVPPPP-PAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAP 456 Query: 880 XXPXXPPPXPP--XXPPPXPXP----PPXP 951 PPP P PPP P P PP P Sbjct: 457 TKVEPPPPPAPAEVEPPPPPAPTELEPPPP 486 Score = 49.2 bits (112), Expect = 8e-06 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P P PPPP P P PPPPP Sbjct: 420 PTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/59 (37%), Positives = 22/59 (37%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P L P P P P T P PP P P PPPP P P PPP P Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 44.8 bits (101), Expect = 2e-04 Identities = 40/146 (27%), Positives = 42/146 (28%), Gaps = 9/146 (6%) Frame = +3 Query: 525 PPPPXXPXPPXXXP---STXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXTXXLIXQI 695 PPPP P P P + G SP S P P P PP P L+ Sbjct: 357 PPPPPRPASPKVEPPPPAPPGVESPPGPQPPAS-PRFDPPPPHTIEPPPPPAPPTLVPPP 415 Query: 696 SSCXXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXXPX----PXPPXTXXXXXPXP 863 P P P P P PP P P Sbjct: 416 PPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPP 475 Query: 864 PXPXX--PPPXPPPPXXPXPXPPXPP 935 P P PPP P PP P PP PP Sbjct: 476 PAPTELEPPPPPAPPKVELPPPPAPP 501 Score = 35.9 bits (79), Expect = 0.082 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 8/48 (16%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXX---PXPXPP-----XPPPP 941 P PP P P P PP P PP P P PP PPPP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPP 397 Score = 35.1 bits (77), Expect = 0.14 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXX--PPPXPPXXP-PPXPXPPPXP 951 P P P P PPPP P PPP PP PP P PP P Sbjct: 344 PEPVQVPAPPKVNP---PPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 390 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXP-PPXPXPP 943 P PP P P P P PPP PP PP P PP Sbjct: 462 PPPPAPAEVEPP----PPPAPTELEPPPPPAPPKVELPPPPAPP 501 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/71 (40%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 QT PP P P A R + PP P PP PPPP P PPP PP Sbjct: 72 QTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP 131 Query: 916 XP-PPXPXPPP 945 P P P PPP Sbjct: 132 QPTPSAPAPPP 142 Score = 51.6 bits (118), Expect = 2e-06 Identities = 43/148 (29%), Positives = 47/148 (31%), Gaps = 7/148 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP PP P P P P + P P + Sbjct: 126 PPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Query: 709 XPXVPILPXNQTXP---PXIPXXPIFXLXAXRXTXX--PPPPXPXPPXPXXXXXXXPP-P 870 P LP +Q P P P P + T PPPP P PP P PP P Sbjct: 186 QPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPP-PPKPQPTPGYGPPTP 244 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPP-PXP 951 P P P P PP PP P PP P P Sbjct: 245 PPGPGPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 51.2 bits (117), Expect = 2e-06 Identities = 43/147 (29%), Positives = 45/147 (30%), Gaps = 6/147 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP P P P P P P P + Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGP-PQTPPPRPPPQP 133 Query: 709 XPXVPILPXN----QTXPPXIPXXPIFXLXAXR-XTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + QT PP P P A P PP P PP P P P Sbjct: 134 TPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP----PSPQPGP 189 Query: 874 XXXXPXXPPPXP-PXXPPPXPXPPPXP 951 P P P P P P P P PPP P Sbjct: 190 EYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 9/77 (11%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP------PPXXXXPXXPPPXP 909 P P P + PPPP P P P PP PP P P P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 910 PXXPP---PXPXPPPXP 951 P P P P PPP P Sbjct: 117 PSYGPPQTPPPRPPPQP 133 Score = 44.8 bits (101), Expect = 2e-04 Identities = 41/146 (28%), Positives = 43/146 (29%), Gaps = 6/146 (4%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PS----XHPPPXLPXTXXLIXQ 692 PP P P PS +P TP PS PPP P Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAP 163 Query: 693 ISSCXXXXXXXXXXXXXXXXTXSXXP-YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXP-P 866 S + P YL P P P P PP P P P Sbjct: 164 APSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPP-----PPPRPQP 218 Query: 867 XPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P P P PP P Sbjct: 219 TPGYGPPPPPPPPKPQPTPGYGPPTP 244 Score = 44.0 bits (99), Expect = 3e-04 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P T P P P A T P PP P P P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPA---PAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAP 357 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 P PP P P P P P Sbjct: 358 TYQPQPPAPPAPAPGPTYQP 377 Score = 43.2 bits (97), Expect = 5e-04 Identities = 41/144 (28%), Positives = 44/144 (30%), Gaps = 2/144 (1%) Frame = +3 Query: 519 HXPPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPP-PXLPXTXXLIXQI 695 + PPPP P PP P T G G P P P P+ PP P P Q Sbjct: 222 YGPPPP--PPPPKPQP-TPGYGPPT------PPPGPGPAQPAPQPPRPQPPRPQPPRPQP 272 Query: 696 SSCXXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXX-PXPXPPXTXXXXXPXPPXP 872 S + P P A P P P P P P Sbjct: 273 GSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRP 332 Query: 873 XXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P PP PP PP Sbjct: 333 PAPPAPAPGPTYQ-PRPPSPPAPP 355 Score = 42.3 bits (95), Expect = 0.001 Identities = 37/141 (26%), Positives = 39/141 (27%), Gaps = 2/141 (1%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 P P PP P P P + P P P P + Sbjct: 258 PRPQPPRPQPPRPQPGSEYLP--PPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPR 315 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP-PPPXPXPPXPXXXXXXXPPPPXXXX 885 P P T P P P A T P PP P PP P PP Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPA---PAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPG 372 Query: 886 PXXPP-PXPPXXPPPXPXPPP 945 P P P P P P PPP Sbjct: 373 PTYQPRPPAPPAPTPEYGPPP 393 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP-PPXXPXPXPPXPPPPP 944 P P P T P PP P P P PP P P P PPPP Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPX-PXPPXPPPPP 944 P A P P PP P P P PP PP P P P P PPP Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP--PXXPXP--XPPXPP 935 P P P P P PP P P PPP P P P P P PP P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Query: 936 PP 941 PP Sbjct: 126 PP 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 6/86 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP---PPXPXPPXPXXXXXXXPPP-PXX 879 P P P Q P P P + PP PP P PP P PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENE 284 Query: 880 XXPXXPPPXPPXXP--PPXPXPPPXP 951 P P P P PP P PP P Sbjct: 285 VTPTQPQPTAPVPEYGPPPPAPPAGP 310 Score = 37.1 bits (82), Expect = 0.035 Identities = 34/141 (24%), Positives = 38/141 (26%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP P P P + P P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P ++ PP P + T P P PP P P PP P Sbjct: 269 RPQ----PGSEYLPP--PGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAP 322 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 P P P P P P P P Sbjct: 323 APGPTYQPRPPAP-PAPAPGP 342 Score = 36.3 bits (80), Expect = 0.062 Identities = 36/139 (25%), Positives = 38/139 (27%) Frame = +1 Query: 535 PXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALXP 714 P PP PPP P P TP P P + A P Sbjct: 206 PQPPPPPPPRPQPTPGYGP--------PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQP 257 Query: 715 XVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXX 894 P P Q PP + P P P P P PPPP Sbjct: 258 PRPQPPRPQ--PPRPQPGSEYLPPPGENEVTPTQPQPTAPVP----EYGPPPPAPPAGPT 311 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P PP P P P P P Sbjct: 312 YQPRPPAPPAPAPGPTYQP 330 Score = 36.3 bits (80), Expect = 0.062 Identities = 32/127 (25%), Positives = 33/127 (25%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP P P A + P P PT R Sbjct: 278 PPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQP---RPPA 334 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P Q PP P P T P PP P P P PP P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAPPA-------PTYQPQPPAPPAPAPGPTYQPRPPAPPAPTP 387 Query: 889 XXPPPXP 909 PP P Sbjct: 388 EYGPPPP 394 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +3 Query: 816 PXPXPPXTXXXXXPX---PPXPXXPP-PXPPPP----XXPXPXPPXPPPPP 944 P P P P PP P PP P PP P P PP PPP P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQP 107 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP + P P P P P P PPPPP Sbjct: 37 PSVPFP-PPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPP 81 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 PP N P P P P PP PP P PPP Sbjct: 43 PPGSGNGIEDSGIGPGPAPSA--PAPSYGPPQTRPPPPPPPP 82 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 54.4 bits (125), Expect = 2e-07 Identities = 29/71 (40%), Positives = 30/71 (42%), Gaps = 2/71 (2%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 QT PP P P A R + PP P PP PPPP P PPP PP Sbjct: 72 QTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPP 131 Query: 916 XP-PPXPXPPP 945 P P P PPP Sbjct: 132 QPTPSAPAPPP 142 Score = 51.6 bits (118), Expect = 2e-06 Identities = 43/148 (29%), Positives = 47/148 (31%), Gaps = 7/148 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP PP P P P P + P P + Sbjct: 126 PPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSP 185 Query: 709 XPXVPILPXNQTXP---PXIPXXPIFXLXAXRXTXX--PPPPXPXPPXPXXXXXXXPP-P 870 P LP +Q P P P P + T PPPP P PP P PP P Sbjct: 186 QPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPP-PPKPQPTPGYGPPTP 244 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPP-PXP 951 P P P P PP PP P PP P P Sbjct: 245 PPGPGPAQPAPQPPRPQPPRPQPPRPQP 272 Score = 51.2 bits (117), Expect = 2e-06 Identities = 43/147 (29%), Positives = 45/147 (30%), Gaps = 6/147 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP P P P P P P P + Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGP-PQTPPPRPPPQP 133 Query: 709 XPXVPILPXN----QTXPPXIPXXPIFXLXAXR-XTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + QT PP P P A P PP P PP P P P Sbjct: 134 TPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSP----PSPQPGP 189 Query: 874 XXXXPXXPPPXP-PXXPPPXPXPPPXP 951 P P P P P P P P PPP P Sbjct: 190 EYLPPDQPKPRPTPSRPQPPPPPPPRP 216 Score = 44.8 bits (101), Expect = 2e-04 Identities = 26/77 (33%), Positives = 27/77 (35%), Gaps = 9/77 (11%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP------PPXXXXPXXPPPXP 909 P P P + PPPP P P P PP PP P P P P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Query: 910 PXXPP---PXPXPPPXP 951 P P P P PPP P Sbjct: 117 PSYGPPQTPPPRPPPQP 133 Score = 44.8 bits (101), Expect = 2e-04 Identities = 41/146 (28%), Positives = 43/146 (29%), Gaps = 6/146 (4%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PS----XHPPPXLPXTXXLIXQ 692 PP P P PS +P TP PS PPP P Sbjct: 104 PPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAP 163 Query: 693 ISSCXXXXXXXXXXXXXXXXTXSXXP-YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXP-P 866 S + P YL P P P P PP P P P Sbjct: 164 APSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPP-----PPPRPQP 218 Query: 867 XPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P P P PP P Sbjct: 219 TPGYGPPPPPPPPKPQPTPGYGPPTP 244 Score = 44.0 bits (99), Expect = 3e-04 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P P T P P P A T P PP P P P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPA---PAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAP 357 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 P PP P P P P P Sbjct: 358 TYQPQPPAPPAPAPGPTYQP 377 Score = 43.2 bits (97), Expect = 5e-04 Identities = 41/144 (28%), Positives = 44/144 (30%), Gaps = 2/144 (1%) Frame = +3 Query: 519 HXPPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPP-PXLPXTXXLIXQI 695 + PPPP P PP P T G G P P P P+ PP P P Q Sbjct: 222 YGPPPP--PPPPKPQP-TPGYGPPT------PPPGPGPAQPAPQPPRPQPPRPQPPRPQP 272 Query: 696 SSCXXXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXX-PXPXPPXTXXXXXPXPPXP 872 S + P P A P P P P P P Sbjct: 273 GSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRP 332 Query: 873 XXPPPXPPPPXXPXPXPPXPPPPP 944 PP P P P PP PP PP Sbjct: 333 PAPPAPAPGPTYQ-PRPPSPPAPP 355 Score = 42.3 bits (95), Expect = 0.001 Identities = 37/141 (26%), Positives = 39/141 (27%), Gaps = 2/141 (1%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 P P PP P P P + P P P P + Sbjct: 258 PRPQPPRPQPPRPQPGSEYLP--PPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPR 315 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP-PPPXPXPPXPXXXXXXXPPPPXXXX 885 P P T P P P A T P PP P PP P PP Sbjct: 316 PPAPPAPAPGPTYQPRPPAPPA---PAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPG 372 Query: 886 PXXPP-PXPPXXPPPXPXPPP 945 P P P P P P PPP Sbjct: 373 PTYQPRPPAPPAPTPEYGPPP 393 Score = 40.7 bits (91), Expect = 0.003 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP-PPXXPXPXPPXPPPPP 944 P P P T P PP P P P PP P P P PPPP Sbjct: 348 PPSPPAPPAPTYQPQPPAPPAPAPGPTYQPRPPAPPAPTPEYGPPPP 394 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPX-PXPPXPPPPP 944 P A P P PP P P P PP PP P P P P PPP Sbjct: 61 PSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPP 116 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP--PXXPXP--XPPXPP 935 P P P P P PP P P PPP P P P P P PP P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP 125 Query: 936 PP 941 PP Sbjct: 126 PP 127 Score = 39.9 bits (89), Expect = 0.005 Identities = 28/86 (32%), Positives = 29/86 (33%), Gaps = 6/86 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP---PPXPXPPXPXXXXXXXPPP-PXX 879 P P P Q P P P + PP PP P PP P PPP Sbjct: 225 PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSEYLPPPGENE 284 Query: 880 XXPXXPPPXPPXXP--PPXPXPPPXP 951 P P P P PP P PP P Sbjct: 285 VTPTQPQPTAPVPEYGPPPPAPPAGP 310 Score = 37.1 bits (82), Expect = 0.035 Identities = 34/141 (24%), Positives = 38/141 (26%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP P P P + P P P Sbjct: 209 PPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPP 268 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P ++ PP P + T P P PP P P PP P Sbjct: 269 RPQ----PGSEYLPP--PGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAP 322 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 P P P P P P P P Sbjct: 323 APGPTYQPRPPAP-PAPAPGP 342 Score = 36.3 bits (80), Expect = 0.062 Identities = 36/139 (25%), Positives = 38/139 (27%) Frame = +1 Query: 535 PXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALXP 714 P PP PPP P P TP P P + A P Sbjct: 206 PQPPPPPPPRPQPTPGYGP--------PPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQP 257 Query: 715 XVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXX 894 P P Q PP + P P P P P PPPP Sbjct: 258 PRPQPPRPQ--PPRPQPGSEYLPPPGENEVTPTQPQPTAPVP----EYGPPPPAPPAGPT 311 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P PP P P P P P Sbjct: 312 YQPRPPAPPAPAPGPTYQP 330 Score = 36.3 bits (80), Expect = 0.062 Identities = 32/127 (25%), Positives = 33/127 (25%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP P P A + P P PT R Sbjct: 278 PPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQPRPPAPPAPAPGPTYQP---RPPA 334 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P Q PP P P T P PP P P P PP P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAPPA-------PTYQPQPPAPPAPAPGPTYQPRPPAPPAPTP 387 Query: 889 XXPPPXP 909 PP P Sbjct: 388 EYGPPPP 394 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/51 (39%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +3 Query: 816 PXPXPPXTXXXXXPX---PPXPXXPP-PXPPPP----XXPXPXPPXPPPPP 944 P P P P PP P PP P PP P P PP PPP P Sbjct: 57 PGPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQP 107 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP + P P P P P P PPPPP Sbjct: 37 PSVPFP-PPGSGNGIEDSGIGPGPAPSAPAPSYGPPQTRPPPPPPP 81 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 821 PPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 PP N P P P P PP PP P PPP Sbjct: 43 PPGSGNGIEDSGIGPGPAPSA--PAPSYGPPQTRPPPPPPPP 82 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 54.0 bits (124), Expect = 3e-07 Identities = 44/141 (31%), Positives = 44/141 (31%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G GGG G GGGG G GG GGG KI Sbjct: 55 GSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKI 114 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G GG G G G G G G IK Sbjct: 115 ISLGGGGG-----GHSGGGGG------WSSGGGGGGWSSGGSGGHGSSGGGDTKVIKIIK 163 Query: 590 GXXXAXGTXXXGGGXGGXGGG 528 G GGG GG GGG Sbjct: 164 LSSGGHGGAGGGGGHGGGGGG 184 Score = 40.3 bits (90), Expect = 0.004 Identities = 41/144 (28%), Positives = 47/144 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG GG GG G GG G G G GG + + Sbjct: 60 GGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGG 119 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G+ GG G G G + GS GG KVIK + L Sbjct: 120 GGGGHSGGG---GGWSSGGGGGGWSSG---GSGGHGSSGGGDTKVIK-------IIKLSS 166 Query: 591 GXXXGPRYXXXXXGGXGXGGGXGY 520 G G GG G GGG G+ Sbjct: 167 GGHGG----AGGGGGHGGGGGGGW 186 Score = 36.7 bits (81), Expect = 0.047 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG-GXXGXGGXG 854 GGGGG G G G GGG GG G GG G Sbjct: 119 GGGGGHSGGGGGWSSGGGGGGWSSGGSGGHG 149 Score = 35.5 bits (78), Expect = 0.11 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG---XXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G GG G GG G GGG G G G GGGG + Sbjct: 15 GGGSSWSSGGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGG 74 Query: 779 XKIGXXGXXGGXVWLXGRMG 720 G GG W G G Sbjct: 75 GGWSSGGGGGGGGWSSGGGG 94 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGX--GGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GGG GGG G G G G G Sbjct: 15 GGGSSWSSGGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGG 62 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG GGG GG Sbjct: 167 GGHGGAGGGGGHGGGGGGGWQPAGG 191 Score = 29.1 bits (62), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GG GG GG G G GG GG Sbjct: 170 GGAGGGGGHGGGGGGGWQPAGG 191 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P P+ A PPPP P P PPPP PPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 910 PXXPPPXPXPPPXP 951 PPP P Sbjct: 530 APIEGGGGIPPPPP 543 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = +1 Query: 724 ILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 + P PP P P+ A PPPP P PP PP P PPP Sbjct: 488 VAPPPPPPPPPPPPPPLANYGA------PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 541 Query: 904 XPPXXPPP-----XPXPPPXP 951 PP P P P P P Sbjct: 542 PPPMSASPSKTTISPAPLPDP 562 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 485 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 527 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P P+ A PPPP P P PPPP PPP P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Query: 910 PXXPPPXPXPPPXP 951 PPP P Sbjct: 540 APIEGGGGIPPPPP 553 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = +1 Query: 724 ILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 + P PP P P+ A PPPP P PP PP P PPP Sbjct: 498 VAPPPPPPPPPPPPPPLANYGA------PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 551 Query: 904 XPPXXPPP-----XPXPPPXP 951 PP P P P P P Sbjct: 552 PPPMSASPSKTTISPAPLPDP 572 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 475 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P P+ A PPPP P P PPPP PPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 910 PXXPPPXPXPPPXP 951 PPP P Sbjct: 530 APIEGGGGIPPPPP 543 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = +1 Query: 724 ILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 + P PP P P+ A PPPP P PP PP P PPP Sbjct: 488 VAPPPPPPPPPPPPPPLANYGA------PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 541 Query: 904 XPPXXPPP-----XPXPPPXP 951 PP P P P P P Sbjct: 542 PPPMSASPSKTTISPAPLPDP 562 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 633 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 675 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P P+ A PPPP P P PPPP PPP P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Query: 910 PXXPPPXPXPPPXP 951 PPP P Sbjct: 688 APIEGGGGIPPPPP 701 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = +1 Query: 724 ILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 + P PP P P+ A PPPP P PP PP P PPP Sbjct: 646 VAPPPPPPPPPPPPPPLANYGA------PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 699 Query: 904 XPPXXPPP-----XPXPPPXP 951 PP P P P P P Sbjct: 700 PPPMSASPSKTTISPAPLPDP 720 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 53.2 bits (122), Expect = 5e-07 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 580 PPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPP 622 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/74 (32%), Positives = 25/74 (33%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P PP P P+ A PPPP P P PPPP PPP P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Query: 910 PXXPPPXPXPPPXP 951 PPP P Sbjct: 635 APIEGGGGIPPPPP 648 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/81 (32%), Positives = 28/81 (34%), Gaps = 5/81 (6%) Frame = +1 Query: 724 ILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 + P PP P P+ A PPPP P PP PP P PPP Sbjct: 593 VAPPPPPPPPPPPPPPLANYGA------PPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPP 646 Query: 904 XPPXXPPP-----XPXPPPXP 951 PP P P P P P Sbjct: 647 PPPMSASPSKTTISPAPLPDP 667 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 51.6 bits (118), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G GG GG G GGGG G GG G GGGG Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 GGG G GGG GG GG G G GGGG G GG GGGG R Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGG---- 267 Query: 770 GXXGXXGGXV 741 G G GG V Sbjct: 268 GGGGGGGGNV 277 Score = 46.8 bits (106), Expect = 4e-05 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXX---GXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG G GGG GG GGG G G GG GG G GGGG NV Sbjct: 224 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 277 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 315 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 372 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 373 NGGGRGGRGGG 383 Score = 43.2 bits (97), Expect = 5e-04 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG GG G G G G G G R RG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGG---RFDRGGGGGGNGGGGGGRYDRGG---- 266 Query: 771 RGXGNXWGGCLVXGEDGD 718 G G GG V DGD Sbjct: 267 -GGGGGGGGGNVQPRDGD 283 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 338 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 386 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 58 GGSGNGGGG-GGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Score = 33.1 bits (72), Expect = 0.58 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GG G GG G GG G GG G GG Sbjct: 65 GGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 308 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 363 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 951 GXGGGXGXGGG---XXGGXGGGXGGXXGXXG 868 G GGG G GGG GGG GG G G Sbjct: 355 GGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 385 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGG 105 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 51.6 bits (118), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G GG GG G GGGG G GG G GGGG Sbjct: 175 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 222 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 GGG G GGG GG GG G G GGGG G GG GGGG R Sbjct: 174 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGG---- 229 Query: 770 GXXGXXGGXV 741 G G GG V Sbjct: 230 GGGGGGGGNV 239 Score = 46.8 bits (106), Expect = 4e-05 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXX---GXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG G GGG GG GGG G G GG GG G GGGG NV Sbjct: 186 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 239 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 277 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 334 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 335 NGGGRGGRGGG 345 Score = 41.5 bits (93), Expect = 0.002 Identities = 29/78 (37%), Positives = 30/78 (38%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG GG G G G G G G R RG Sbjct: 176 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGG---RFDRGGGGGGNGGGGGGRYDRGG---- 228 Query: 771 RGXGNXWGGCLVXGEDGD 718 G G GG V DG+ Sbjct: 229 -GGGGGGGGGNVQPRDGE 245 Score = 36.7 bits (81), Expect = 0.047 Identities = 36/128 (28%), Positives = 42/128 (32%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGGXVWLX 732 GG GGG GGGG GG G GGGG R G G GG + Sbjct: 174 GGGGGG-------GGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDR 226 Query: 731 GRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGXXXAXGTXXXGG 552 G G G N+ + G+ + + KG GG Sbjct: 227 GGGGGGGGGG-GNVQPR---DGEWKCNSCNNTNFAWRNECNRCKTPKGDDEGSSGGGGGG 282 Query: 551 GXGGXGGG 528 G GG GGG Sbjct: 283 GYGGGGGG 290 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 300 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 348 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 20 GGSGNGGGG-GGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 63 Score = 33.1 bits (72), Expect = 0.58 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GG GG G GG G GG G GG G GG G N Sbjct: 27 GGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGG--GGGGGGGGGSGGN 74 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 7 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 66 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 270 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 325 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 23 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGG 67 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 51.6 bits (118), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G GG GG G GGGG G GG G GGGG Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGG 260 Score = 50.8 bits (116), Expect = 3e-06 Identities = 30/70 (42%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG--GXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 GGG G GGG GG GG G G GGGG G GG GGGG R Sbjct: 212 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGG---- 267 Query: 770 GXXGXXGGXV 741 G G GG V Sbjct: 268 GGGGGGGGNV 277 Score = 46.8 bits (106), Expect = 4e-05 Identities = 25/54 (46%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXX---GXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG G GGG GG GGG G G GG GG G GGGG NV Sbjct: 224 GFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGRYDRGGGGGGGGGGGNV 277 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 315 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 372 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 373 NGGGRGGRGGG 383 Score = 43.2 bits (97), Expect = 5e-04 Identities = 30/78 (38%), Positives = 30/78 (38%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG GG G G G G G G R RG Sbjct: 214 GGGGGGGGRGGFGGRRGGGGGGGGGGGGGG---RFDRGGGGGGNGGGGGGRYDRGG---- 266 Query: 771 RGXGNXWGGCLVXGEDGD 718 G G GG V DGD Sbjct: 267 -GGGGGGGGGNVQPRDGD 283 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 338 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 386 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 58 GGSGNGGGG-GGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGG 101 Score = 33.1 bits (72), Expect = 0.58 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG GG G GG G GG G GG G GG Sbjct: 65 GGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGGGGGSGG 111 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 308 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 363 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 951 GXGGGXGXGGG---XXGGXGGGXGGXXGXXG 868 G GGG G GGG GGG GG G G Sbjct: 355 GGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 385 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGPGGYSGGGGGGGGG 105 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 51.2 bits (117), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G G GG Sbjct: 69 GQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGG 116 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/69 (36%), Positives = 26/69 (37%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG GG GGG GG G G G GG G G Sbjct: 55 GPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGF 114 Query: 771 RGXGNXWGG 745 G G +GG Sbjct: 115 GGPGGGFGG 123 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG GGG G GG G G GG G GG R G Sbjct: 50 GGGFGGPGGGFGGPGGGFGG--QGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGF 107 Query: 764 XGXXGG 747 G GG Sbjct: 108 GGPGGG 113 Score = 39.1 bits (87), Expect = 0.009 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G GG GG GG G GGG G G GG G GG G Sbjct: 51 GGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGP 110 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 111 GGGFGGPGGG 120 Score = 38.3 bits (85), Expect = 0.015 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -2 Query: 950 GXGGGXGX-GGGX--XGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GG G G GG G GGG Sbjct: 76 GPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGG-GFGGG 124 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 GGG G GG GG GGG GG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFG 126 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 937 GGGXGGXGXGXXG-GGGXGGGXXG 869 GGG GG G G G GGG GGG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFGG 127 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 51.2 bits (117), Expect = 2e-06 Identities = 32/77 (41%), Positives = 33/77 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG G GGG G GGGG G GG G GG R A + Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGG----GGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRG 65 Query: 770 GXXGXXGGXVWLXGRMG 720 G G GG GR G Sbjct: 66 GGGGRGGGGRGGGGRGG 82 Score = 46.4 bits (105), Expect = 6e-05 Identities = 27/68 (39%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG G GG G GGG G GG G GG G R Sbjct: 29 GGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGG- 87 Query: 770 GXXGXXGG 747 G G GG Sbjct: 88 GAGGFKGG 95 Score = 43.6 bits (98), Expect = 4e-04 Identities = 28/68 (41%), Positives = 28/68 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G GGG GG GGG G GGGG G GG G GGGG R Sbjct: 2 GKPGFSPRGGGGGGGGGGG--GFRGRGGGGGGGGGGFG-GGRGRGGGGDRGGRGGFGGGR 58 Query: 770 GXXGXXGG 747 G G GG Sbjct: 59 GAFGGRGG 66 Score = 43.2 bits (97), Expect = 5e-04 Identities = 26/69 (37%), Positives = 26/69 (37%), Gaps = 2/69 (2%) Frame = -1 Query: 945 GGGXGXGGGXXG--GXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 GGG G GGG G G GGG GG G G G G GG G Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGG 69 Query: 771 RGXGNXWGG 745 RG G GG Sbjct: 70 RGGGGRGGG 78 Score = 42.7 bits (96), Expect = 7e-04 Identities = 31/86 (36%), Positives = 32/86 (37%), Gaps = 1/86 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXE-XE 775 G GGG G G GG GGG GG G G G GG G R G Sbjct: 15 GGGGGGGFRGRGGGG-GGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGG 73 Query: 774 DRGXGNXWGGCLVXGEDGDXGXKGMT 697 RG G GG G G G K +T Sbjct: 74 GRGGGGRGGGGRGGGAGGFKGGKTVT 99 Score = 41.5 bits (93), Expect = 0.002 Identities = 33/80 (41%), Positives = 34/80 (42%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG GG GGG G GGGG G GG G GG G R + Sbjct: 18 GGGGFRGRGGGG-GGGGGGFGGGRGRGGGG----DRGGRGGFG-GGRGAFGGRGGGGGR- 70 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 71 GGGGRGGGGRGGGGRGGGAG 90 Score = 35.5 bits (78), Expect = 0.11 Identities = 27/74 (36%), Positives = 28/74 (37%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G G G GGG G GGGG G GG G GGG R + G G Sbjct: 2 GKPGFSPRGGGGGGGG----GGGGFRGRGGGGGGGGGGFGGGRG--RGGGGDRGGRGGFG 55 Query: 752 GGXVWLXGRMGTXG 711 GG GR G G Sbjct: 56 GGRGAFGGRGGGGG 69 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 51.2 bits (117), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G G GG Sbjct: 69 GQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGG 116 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/69 (36%), Positives = 26/69 (37%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG GG GGG GG G G G GG G G Sbjct: 55 GPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGF 114 Query: 771 RGXGNXWGG 745 G G +GG Sbjct: 115 GGPGGGFGG 123 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG GGG G GG G G GG G GG R G Sbjct: 50 GGGFGGPGGGFGGPGGGFGG--QGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGF 107 Query: 764 XGXXGG 747 G GG Sbjct: 108 GGPGGG 113 Score = 39.1 bits (87), Expect = 0.009 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G GG GG GG G GGG G G GG G GG G Sbjct: 51 GGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGP 110 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 111 GGGFGGPGGG 120 Score = 38.3 bits (85), Expect = 0.015 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -2 Query: 950 GXGGGXGX-GGGX--XGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GG G G GG G GGG Sbjct: 76 GPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGG-GFGGG 124 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 GGG G GG GG GGG GG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFG 126 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 937 GGGXGGXGXGXXG-GGGXGGGXXG 869 GGG GG G G G GGG GGG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFGG 127 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 51.2 bits (117), Expect = 2e-06 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G G GG Sbjct: 69 GQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGG 116 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/69 (36%), Positives = 26/69 (37%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG GG GGG GG G G G GG G G Sbjct: 55 GPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGF 114 Query: 771 RGXGNXWGG 745 G G +GG Sbjct: 115 GGPGGGFGG 123 Score = 41.5 bits (93), Expect = 0.002 Identities = 26/66 (39%), Positives = 26/66 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG GGG G GG G G GG G GG R G Sbjct: 50 GGGFGGPGGGFGGPGGGFGG--QGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGF 107 Query: 764 XGXXGG 747 G GG Sbjct: 108 GGPGGG 113 Score = 39.1 bits (87), Expect = 0.009 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G GG GG GG G GGG G G GG G GG G Sbjct: 51 GGFGGPGGGFGGPGGGFGGQGGGFGGPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGP 110 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 111 GGGFGGPGGG 120 Score = 38.3 bits (85), Expect = 0.015 Identities = 24/50 (48%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = -2 Query: 950 GXGGGXGX-GGGX--XGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG GGG G GG G G GG G GGG Sbjct: 76 GPGGGFGGQGGGFGGQGGFGGGGFGGRPGGGFGGPGGGFGGPGG-GFGGG 124 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 GGG G GG GG GGG GG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFG 126 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Frame = -3 Query: 937 GGGXGGXGXGXXG-GGGXGGGXXG 869 GGG GG G G G GGG GGG G Sbjct: 104 GGGFGGPGGGFGGPGGGFGGGFGG 127 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GG GG GGG G GGG GG G GGGG N R Sbjct: 174 GGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGR 226 Score = 48.4 bits (110), Expect = 1e-05 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G G G GG GGG G GGGG G G GGGG R + G Sbjct: 172 GGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGG--GGFNRGRGGG 229 Query: 764 XGXXGG 747 G GG Sbjct: 230 GGGGGG 235 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/47 (51%), Positives = 24/47 (51%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG G G G GGGG G GG G GGG Sbjct: 10 GGGGGRGFGGGG-GGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 55 Score = 45.6 bits (103), Expect = 1e-04 Identities = 25/55 (45%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGG-GXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGG GG G G GGG G GGG G GG G G G G G A G Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTG 62 Score = 45.6 bits (103), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG G GGGG G GG G GGGG Sbjct: 188 GRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGGGG 235 Score = 44.4 bits (100), Expect = 2e-04 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG--XXXXXXXGXGGXGXGGGGXNVXRXA 786 G G G GGG G GGG G GGGG G GG G GGGG R A Sbjct: 2 GFGKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGA 58 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = -2 Query: 887 GXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G GGGG G GG G GGGG R G G GG Sbjct: 4 GKPRGGGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGG 50 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG G GGG GG G G Sbjct: 34 GGGGGRGGGGGF-GRGGGGRGGGRGAFDTG 62 Score = 30.7 bits (66), Expect = 3.1 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 G GG GGG G GGG G GG GGGG R G G G Sbjct: 4 GKPRGGGGGGGRGFGGGGGG----RGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 57 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 50.8 bits (116), Expect = 3e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXX-----PPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP P PPP P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 537 Score = 49.2 bits (112), Expect = 8e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 V P P P PP P PP P PPP PP P PP PPPP Sbjct: 483 VAPPPPPPPPPLPAFVAPPPPPPP--PPPPPPLANYGAPPPPPPPPP 527 Score = 49.2 bits (112), Expect = 8e-06 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPPP PP PPPPP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPP-PPPPLANYGAPPPPPPPP 526 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P PPPP P P PPPP PPP P Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 544 Query: 928 XPXPPPXP 951 PPP P Sbjct: 545 GGIPPPPP 552 Score = 44.0 bits (99), Expect = 3e-04 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P LP PP P P A PPPP P PP PP P Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANYGA--PPPPPPPPPGSGSAPPPPPPAPIEGGGG 546 Query: 892 XPPPXPPXXPPP-----XPXPPPXP 951 PPP PP P P P P P Sbjct: 547 IPPPPPPMSASPSKTTISPAPLPDP 571 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPX---PXPPXPPPPP 944 P PPP PPPP P P PP PPPPP Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPP 509 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 871 PXXXXPXXPPPXPP----XXPPPXPXPPPXP 951 P P PPP PP PPP P PPP P Sbjct: 480 PHAVAPPPPPPPPPLPAFVAPPPPPPPPPPP 510 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 50.8 bits (116), Expect = 3e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXX-----PPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP P PPP P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 632 Score = 49.6 bits (113), Expect = 6e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 V P P P PP P PP P PPP PP P PP PPPP Sbjct: 578 VAPPPPPPPPPLPAFVAPPPPPPP--PPPPPPMANYGAPPPPPPPPP 622 Score = 49.6 bits (113), Expect = 6e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPP PP PPPPP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P PPPP P P PPPP PPP P Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 639 Query: 928 XPXPPPXP 951 PPP P Sbjct: 640 GGIPPPPP 647 Score = 44.0 bits (99), Expect = 3e-04 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P LP PP P P A PPPP P PP PP P Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANYGA--PPPPPPPPPGSGSAPPPPPPAPIEGGGG 641 Query: 892 XPPPXPPXXPPP-----XPXPPPXP 951 PPP PP P P P P P Sbjct: 642 IPPPPPPMSASPSKTTISPAPLPDP 666 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 50.8 bits (116), Expect = 3e-06 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPP PPPP P P P PPP P Sbjct: 219 PGTGPPGPPGPPGTTYPQPPPPP-PPPPPPPPSYPYPPYPYPPPGP 263 Score = 49.6 bits (113), Expect = 6e-06 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX-----PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP T P PP P PPP PPPP P PP P PPP Sbjct: 212 PPGP-PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 261 Score = 49.2 bits (112), Expect = 8e-06 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PPPPX---PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXPXPPPXP 951 P PP P PP P PPPP P PPP PP P PP P PPP P Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPP----PPPPPPPPPSYPYPPYPYPPPGP 263 Score = 46.8 bits (106), Expect = 4e-05 Identities = 43/144 (29%), Positives = 44/144 (30%), Gaps = 3/144 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRH-- 702 PPP PP PPP P P P P H Sbjct: 153 PPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP----PQKGEHGHHHHHKG 208 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 + P P P T PP P P T P PP P PP P PPPP Sbjct: 209 SKGPPGPPGPPG-TGPPGPPGPP--------GTTYPQPPPPPPPPP-------PPPPSYP 252 Query: 883 XPXXPPPXPPXXPPPX-PXPPPXP 951 P P P P P P P P P P Sbjct: 253 YPPYPYPPPGPYPGPWIPLPVPVP 276 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P PPPP P P PP PP P P P Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP 194 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P + P PPP PPPP PP PP PP Sbjct: 35 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPP 77 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPPPPXXPXPXPPXPPPPP 944 P P PP P PP PP P PPP P P P P P P Sbjct: 230 PGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 276 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP 917 P P P PP P PP P PP P P P Sbjct: 55 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPP P PP P P PP P PP P P P Sbjct: 54 PPPPPPPPPPPQHCNCPPGPP---GPPGPPGLPGTPGPQGP 91 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 PPPP P PP P PP P P P P Sbjct: 54 PPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 31.9 bits (69), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXP---PPXPXPPPXP 951 P P PP P PPP PP PP P PP P Sbjct: 37 PAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP 79 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP 926 P P PP PP P PP P P P P P Sbjct: 55 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 30.7 bits (66), Expect(2) = 0.61 Identities = 17/60 (28%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPXPP 912 Q P P + + PPPP P PP P PP P P P P Sbjct: 32 QAAPAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PP PP PP P P P P P Sbjct: 54 PPPPPPP------PPPPQHCNCPPGPPGPPGPPGLPGTPGP 88 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP PP P PPPP P P P PP P P Sbjct: 48 PPQHYYPPPPPP-----PPPPPQHCNCPPGPPGPPGPPGLPGTP 86 Score = 21.0 bits (42), Expect(2) = 0.61 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPP 942 P P P PP P PP Sbjct: 113 PGQPGEPGPIGPPGLPGPP 131 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 50.8 bits (116), Expect = 3e-06 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXX-----PPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P PPP PP P PPP P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPP 765 Score = 49.6 bits (113), Expect = 6e-06 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 V P P P PP P PP P PPP PP P PP PPPP Sbjct: 711 VAPPPPPPPPPLPAFVAPPPPPPP--PPPPPPMANYGAPPPPPPPPP 755 Score = 49.6 bits (113), Expect = 6e-06 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP PP P PPP PPP PP PPPPP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 44.4 bits (100), Expect = 2e-04 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P PPPP P P PPPP PPP P Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 772 Query: 928 XPXPPPXP 951 PPP P Sbjct: 773 GGIPPPPP 780 Score = 44.0 bits (99), Expect = 3e-04 Identities = 29/85 (34%), Positives = 29/85 (34%), Gaps = 5/85 (5%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P LP PP P P A PPPP P PP PP P Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANYGA--PPPPPPPPPGSGSAPPPPPPAPIEGGGG 774 Query: 892 XPPPXPPXXPPP-----XPXPPPXP 951 PPP PP P P P P P Sbjct: 775 IPPPPPPMSASPSKTTISPAPLPDP 799 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 50.8 bits (116), Expect = 3e-06 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GGG G G GG G G G GGGG + G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 764 XGXXGG 747 G GG Sbjct: 87 GGGGGG 92 Score = 48.0 bits (109), Expect = 2e-05 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G G GG G GGGG G GG GG G Sbjct: 59 GFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Query: 770 GXXGXXGGXVWL 735 G G GG L Sbjct: 119 GGGGGGGGGTTL 130 Score = 47.2 bits (107), Expect = 3e-05 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G G GG GG GGG G GG G G GG GGGG Sbjct: 39 GLGGGFGGGSSGGFGGGIGGG-FGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGF 97 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG G +G G Sbjct: 98 GGGSGGGSGGGFGGGGSIGGFG 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG-GGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GGG G G GGG G GG G GG Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 46.4 bits (105), Expect = 6e-05 Identities = 28/85 (32%), Positives = 29/85 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G G G GGG GG GGG GG G G G GG G G Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGG 104 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMT 697 G G GG + G G G T Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGGTT 129 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GG G G GG G G GGGG Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGG 80 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 922 GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGGG GG G G G GG G G G Sbjct: 20 GYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGG 58 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 GGG G G G GG GGG G GGG G GG G GGGG R A Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGA 60 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG G G G GGGG G GG G GGG Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 45.6 bits (103), Expect = 1e-04 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGGG G G G GG G GGG G GG G G G G G A G Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTG 64 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 G GG GGG G GGGG G GG GGGG R G G G Sbjct: 4 GKPRGGGGGGGRGFGGGGGGGGRGFG--GGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 50.8 bits (116), Expect = 3e-06 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GGG G G GG G G G GGGG + G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 764 XGXXGG 747 G GG Sbjct: 87 GGGGGG 92 Score = 48.0 bits (109), Expect = 2e-05 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G G GG G GGGG G GG GG G Sbjct: 59 GFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Query: 770 GXXGXXGGXVWL 735 G G GG L Sbjct: 119 GGGGGGGGATTL 130 Score = 47.2 bits (107), Expect = 3e-05 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G G GG GG GGG G GG G G GG GGGG Sbjct: 39 GLGGGFGGGSSGGFGGGIGGG-FGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGF 97 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG G +G G Sbjct: 98 GGGSGGGSGGGFGGGGSIGGFG 119 Score = 46.8 bits (106), Expect = 4e-05 Identities = 29/85 (34%), Positives = 30/85 (35%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G G G GGG GG GGG GG G G G GG G G Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGG 104 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMT 697 G G GG + G G G G T Sbjct: 105 SG-GGFGGGGSIGGFGGGGGGGGAT 128 Score = 46.4 bits (105), Expect = 6e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG-GGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GGG G G GGG G GG G GG Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GG G G GG G G GGGG Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGG 80 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 922 GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGGG GG G G G GG G G G Sbjct: 20 GYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGG 58 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 50.8 bits (116), Expect = 3e-06 Identities = 27/66 (40%), Positives = 28/66 (42%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GGG G G GG G G G GGGG + G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 764 XGXXGG 747 G GG Sbjct: 87 GGGGGG 92 Score = 48.0 bits (109), Expect = 2e-05 Identities = 26/72 (36%), Positives = 26/72 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G G GG G GGGG G GG GG G Sbjct: 59 GFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGF 118 Query: 770 GXXGXXGGXVWL 735 G G GG L Sbjct: 119 GGGGGGGGGTTL 130 Score = 47.2 bits (107), Expect = 3e-05 Identities = 31/82 (37%), Positives = 32/82 (39%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G G GG GG GGG G GG G G GG GGGG Sbjct: 39 GLGGGFGGGSSGGFGGGIGGG-FGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGF 97 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG G +G G Sbjct: 98 GGGSGGGSGGGFGGGGSIGGFG 119 Score = 46.4 bits (105), Expect = 6e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG-GGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GGG G G GGG G GG G GG Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 46.4 bits (105), Expect = 6e-05 Identities = 28/85 (32%), Positives = 29/85 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G G G GGG GG GGG GG G G G GG G G Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGG 104 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMT 697 G G GG + G G G T Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGGTT 129 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GG G G GG G G GGGG Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGG 80 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 922 GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGGG GG G G G GG G G G Sbjct: 20 GYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGG 58 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 50.8 bits (116), Expect = 3e-06 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPP PPPP P P P PPP P Sbjct: 221 PGTGPPGPPGPPGTTYPQPPPPP-PPPPPPPPSYPYPPYPYPPPGP 265 Score = 49.6 bits (113), Expect = 6e-06 Identities = 24/51 (47%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX-----PXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP T P PP P PPP PPPP P PP P PPP Sbjct: 214 PPGP-PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPP 263 Score = 49.2 bits (112), Expect = 8e-06 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PPPPX---PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXPXPPPXP 951 P PP P PP P PPPP P PPP PP P PP P PPP P Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPP----PPPPPPPPPSYPYPPYPYPPPGP 265 Score = 46.8 bits (106), Expect = 4e-05 Identities = 43/144 (29%), Positives = 44/144 (30%), Gaps = 3/144 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRH-- 702 PPP PP PPP P P P P H Sbjct: 155 PPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP----PQKGEHGHHHHHKG 210 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 + P P P T PP P P T P PP P PP P PPPP Sbjct: 211 SKGPPGPPGPPG-TGPPGPPGPP--------GTTYPQPPPPPPPPP-------PPPPSYP 254 Query: 883 XPXXPPPXPPXXPPPX-PXPPPXP 951 P P P P P P P P P P Sbjct: 255 YPPYPYPPPGPYPGPWIPLPVPVP 278 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P PPPP P P PP PP P P P Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLP 196 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P + P PPP PPPP PP PP PP Sbjct: 37 PAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPP 79 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPPPPXXPXPXPPXPPPPP 944 P P PP P PP PP P PPP P P P P P P Sbjct: 232 PGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVP 278 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP 917 P P P PP P PP P PP P P P Sbjct: 57 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 32.7 bits (71), Expect = 0.76 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPP P PP P P PP P PP P P P Sbjct: 56 PPPPPPPPPPPQHCNCPPGPP---GPPGPPGLPGTPGPQGP 93 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 PPPP P PP P PP P P P P Sbjct: 56 PPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 31.9 bits (69), Expect = 1.3 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +1 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXP---PPXPXPPPXP 951 P P PP P PPP PP PP P PP P Sbjct: 39 PAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGP 81 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP 926 P P PP PP P PP P P P P P Sbjct: 57 PPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 30.7 bits (66), Expect(2) = 0.61 Identities = 17/60 (28%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 739 QTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPXPP 912 Q P P + + PPPP P PP P PP P P P P Sbjct: 34 QAAPAPAPAQSVIYKLPPQHYYPPPPPPPPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PP PP PP P P P P P Sbjct: 56 PPPPPPP------PPPPQHCNCPPGPPGPPGPPGLPGTPGP 90 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP PP P PPPP P P P PP P P Sbjct: 50 PPQHYYPPPPPP-----PPPPPQHCNCPPGPPGPPGPPGLPGTP 88 Score = 21.0 bits (42), Expect(2) = 0.61 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPP 942 P P P PP P PP Sbjct: 115 PGQPGEPGPIGPPGLPGPP 133 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 50.8 bits (116), Expect = 3e-06 Identities = 18/28 (64%), Positives = 18/28 (64%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP PPPP P PP PPPPP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 50.4 bits (115), Expect = 4e-06 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P PPP PPPP P P PP PP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 50.0 bits (114), Expect = 5e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP PPPP P PP PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 50.0 bits (114), Expect = 5e-06 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PPP PP PPP P PPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 42.3 bits (95), Expect = 0.001 Identities = 22/42 (52%), Positives = 22/42 (52%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPPP P PP P PPPP P PPP PP PPP P Sbjct: 463 PPPPPPPPPPP-------PPPP---PPTEPPPPPP--PPPEP 492 Score = 40.3 bits (90), Expect = 0.004 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 P PP P PP P PPP PPPP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP--PPPP 944 P P P P PP PPPP P P PP P PPPP Sbjct: 438 PSYPDDSYPDVIYDDHPHHHHHVHHPPPPPPPPPPPPPPPPPTEPPPP 485 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP--PPXP 951 P P P P PPP PP PPP P P PP P Sbjct: 438 PSYPDDSYPDVIYDDHPHHHHHVHHPPPPPPPPPPPPPPPPPTEPPPP 485 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P P P PP P P P PPP PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPP--PPPPPPEP 492 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 50.8 bits (116), Expect = 3e-06 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 GGG G G G GG GGG G GGG G GG G GGGG R A Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGA 60 Score = 48.4 bits (110), Expect = 1e-05 Identities = 26/51 (50%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGXGG-GXXGGXGGGXX--GXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG G GG GGG G GGGG G GG G GGGG Sbjct: 183 GRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Score = 48.0 bits (109), Expect = 2e-05 Identities = 24/48 (50%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGG-GXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG GG G G G GGGG G GG G GGG Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGG 57 Score = 47.2 bits (107), Expect = 3e-05 Identities = 26/64 (40%), Positives = 27/64 (42%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXG 759 G G GGG GG GGG G GGGG G G GGGG R + G G Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGG---GFNRGRGGGGG 229 Query: 758 XXGG 747 GG Sbjct: 230 GGGG 233 Score = 47.2 bits (107), Expect = 3e-05 Identities = 25/53 (47%), Positives = 25/53 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GG GG GGG G G GG G G G GGGG N R Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRG-GGGGRGGGGFRGGAGRNGGGGGGGGFNRGR 224 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GGG GGG G GG GG G G Sbjct: 176 GGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGG 218 Score = 46.0 bits (104), Expect = 8e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG G G GGGG G GG G GG G Sbjct: 190 GGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRG 235 Score = 45.6 bits (103), Expect = 1e-04 Identities = 24/55 (43%), Positives = 24/55 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGGG G G G GG G GGG G GG G G G G G A G Sbjct: 10 GGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTG 64 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/62 (38%), Positives = 24/62 (38%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG G GGG GG G G G G GG G R G Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGG 233 Query: 771 RG 766 RG Sbjct: 234 RG 235 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 G GG GGG G GGGG G GG GGGG R G G G Sbjct: 4 GKPRGGGGGGGRGFGGGGGGGGRGFG--GGGGGRGGGGGRGGGGGFGRGGGGRGGGRG 59 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 50.4 bits (115), Expect = 4e-06 Identities = 41/141 (29%), Positives = 43/141 (30%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G GG GG G G GG G G G GG Sbjct: 178 GGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQ 237 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG GR G+ G + G GQ G P Sbjct: 238 GGGGGYGGAGGGAGRGGSPGGPG--SPGGGGFG-GQGGAGGGYGGGGGGGRGGGGAPGAP 294 Query: 590 GXXXAXGTXXXGGGXGGXGGG 528 G G GGG G GGG Sbjct: 295 GSPGGGGFGGQGGGGGFGGGG 315 Score = 49.6 bits (113), Expect = 6e-06 Identities = 44/144 (30%), Positives = 45/144 (31%), Gaps = 3/144 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GG G GGG GG G GG G G GG G GG G G G R Sbjct: 166 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 225 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSI 594 G G GG G G G G G G Sbjct: 226 PGAPG-GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGG 284 Query: 593 KGXXXAXGT--XXXGGGXGGXGGG 528 +G A G GGG GG GGG Sbjct: 285 RGGGGAPGAPGSPGGGGFGGQGGG 308 Score = 48.4 bits (110), Expect = 1e-05 Identities = 42/142 (29%), Positives = 42/142 (29%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GG GGGG G GG G GG Sbjct: 272 GAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 331 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSI 594 G G GG G G G G G G P Sbjct: 332 YGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGG--FGGQGGGGGFGGGGGRGGAPGA 389 Query: 593 KGXXXAXGTXXXGGGXGGXGGG 528 G G GGG GG GGG Sbjct: 390 PGSPGGGGFGGQGGG-GGYGGG 410 Score = 44.8 bits (101), Expect = 2e-04 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG--GXGXGGGGXNVXRXAXRX 777 G GGG G GGG GG G G GGG G G G G GG Sbjct: 337 GAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGG 396 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 397 GFGGQGGGGGYGGGAGRGGAPG 418 Score = 42.7 bits (96), Expect = 7e-04 Identities = 40/139 (28%), Positives = 41/139 (29%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G G G GGG G GG G G G G GG G G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG----------GG 210 Query: 764 XGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGX 585 G GG G G G + G G G P G Sbjct: 211 YGSGGGS-GRGGAPGGPGAPGGGGFGGQGGGGGYGGAG-----GGAGRGGSPGGPGSPGG 264 Query: 584 XXAXGTXXXGGGXGGXGGG 528 G GGG GG GGG Sbjct: 265 GGFGGQGGAGGGYGGGGGG 283 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/81 (37%), Positives = 32/81 (39%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG GG GGG G GGG G GG G GGG R Sbjct: 265 GGFGGQGGAGGGYGGGGGGGRG----GGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGA 320 Query: 770 -GXXGXXGGXVWLXGRMGTXG 711 G G GG + G+ G G Sbjct: 321 PGAPGSPGGGGY-GGQGGAGG 340 Score = 41.5 bits (93), Expect = 0.002 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGGXXXXXXXGXG-GXGXG-GGGXNVXRXAXR 780 G GG G GGG GG G GG G GGG G G G G G GG Sbjct: 366 GGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGG 425 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 426 GGFGGQGGGGGFGAGGGRGGAGG 448 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/80 (31%), Positives = 26/80 (32%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G GGG G GGG G G GG Sbjct: 378 GGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGF 437 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G G GG G G+ G Sbjct: 438 GAGGGRGGAGGAPGGPGSPG 457 Score = 39.5 bits (88), Expect = 0.007 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGG--GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G GG G G GGG G GGG G GG G GG G Sbjct: 406 GYGGGAGRGGAPGAPGSPGGGGFGGQGGGGG-------FGAGG-GRGGAGGAPGGPGSPG 457 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 458 GPGYGGGAGGPGGAGGRPGGPG 479 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G G G GGG GG GG G GG G G Sbjct: 425 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGG 470 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/100 (31%), Positives = 32/100 (32%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GG GGG GG GG GG G G G G GG G G Sbjct: 257 GGPGSPGGGGFGGQGGAGGGYGGGGGGG---------RGGGGAPGAPGSPGGGGFGGQGG 307 Query: 765 XGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G GG G G G G + G G GGG Sbjct: 308 GGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGG 347 Score = 37.5 bits (83), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXR 799 G GG G GGG G GGG GG G G G GG G R Sbjct: 424 GGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGR 474 Score = 37.1 bits (82), Expect = 0.035 Identities = 28/83 (33%), Positives = 30/83 (36%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GG G GGG G GGG GG G G G GG G R Sbjct: 364 GGGGFGGQGGGGGFGGGGGRGGAPGAPG-SPGGGGFGGQGGGGGYGGGAGRGGAPGAPGS 422 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G +GG G G G +G Sbjct: 423 PG-GGGFGGQGGGGGFGAGGGRG 444 Score = 36.3 bits (80), Expect = 0.062 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GGG GG GGG G GG GG G GGG Sbjct: 1 GFGGGPGGGGAGGFGGGNNGL-----GGFANGRPIAPGGGGGGGG 40 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 931 GXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GG G G G GG GGG G GG GG G G Sbjct: 1 GFGG-GPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 38 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G GG GG GG G G G G Sbjct: 432 GGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPG 476 Score = 33.1 bits (72), Expect = 0.58 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 1/92 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGG-GXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXE 775 G GGG G GGG G G G G G G G G GG G Sbjct: 343 GGGGGRG-GGGAPGAPGAPGSPGGGGFGGQG-GGGGFGGGGGRGGAPGAPGSPGGGGFGG 400 Query: 774 DRGXGNXWGGCLVXGEDGDXGXKGMTKFXG*G 679 G G GG G G G G F G G Sbjct: 401 QGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 432 Score = 33.1 bits (72), Expect = 0.58 Identities = 30/103 (29%), Positives = 31/103 (30%), Gaps = 1/103 (0%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGG-GXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXE 775 G GGG G GGG G G G G G G G G G G + Sbjct: 372 GGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQ 431 Query: 774 DRGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G GG G G G G G G GG Sbjct: 432 GGGGGFGAGGGR-GGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 473 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G GG G G G GG GG GG G Sbjct: 451 GGPGSPGGPGYG-GGAGGPGGAGGRPGGPG 479 Score = 29.5 bits (63), Expect = 7.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG-XGGXGXGG 813 G G G G GG G G G GGG G GG G G Sbjct: 436 GFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPG 482 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 50.4 bits (115), Expect = 4e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G GGGG Sbjct: 225 GFGGRRGGGGG--GGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GG GGG G GG G GG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGG 255 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 310 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 367 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 368 NGGGRGGRGGG 378 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GGG GG GG G GGGG G G GGGG R G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGG----GGGGGG 268 Query: 752 GGXV 741 GG V Sbjct: 269 GGNV 272 Score = 35.9 bits (79), Expect = 0.082 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG GG G GG G GG G GG G G GG ++ Sbjct: 65 GGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDM 115 Score = 35.1 bits (77), Expect = 0.14 Identities = 41/139 (29%), Positives = 45/139 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GG GGGG GG G GGGG R Sbjct: 213 GGGGGGGGGGRGGFGG------RRGGGG---------GGGGGGGGGGRFDRGG------- 250 Query: 764 XGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGX 585 G GG G G G N+ + G + + KG Sbjct: 251 -GGGGGRYDRGGGGGGGGGGG--NVQPRD---GDWKCNSCNNTNFAWRNECNRCKTPKGD 304 Query: 584 XXAXGTXXXGGGXGGXGGG 528 GGG GG GGG Sbjct: 305 DEGSSGGGGGGGYGGGGGG 323 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 333 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 381 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 58 GGSGNGGG-GGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG 101 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 303 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 951 GXGGGXGXGGG---XXGGXGGGXGGXXGXXG 868 G GGG G GGG GGG GG G G Sbjct: 350 GGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 380 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGG 105 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 50.4 bits (115), Expect = 4e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G GGGG Sbjct: 225 GFGGRRGGGGG--GGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GG GGG G GG G GG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGG 255 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 310 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 367 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 368 NGGGRGGRGGG 378 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GGG GG GG G GGGG G G GGGG R G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGG----GGGGGG 268 Query: 752 GGXV 741 GG V Sbjct: 269 GGNV 272 Score = 35.9 bits (79), Expect = 0.082 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG GG G GG G GG G GG G G GG ++ Sbjct: 65 GGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDM 115 Score = 35.1 bits (77), Expect = 0.14 Identities = 41/139 (29%), Positives = 45/139 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GG GGGG GG G GGGG R Sbjct: 213 GGGGGGGGGGRGGFGG------RRGGGG---------GGGGGGGGGGRFDRGG------- 250 Query: 764 XGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGX 585 G GG G G G N+ + G + + KG Sbjct: 251 -GGGGGRYDRGGGGGGGGGGG--NVQPRD---GDWKCNSCNNTNFAWRNECNRCKTPKGD 304 Query: 584 XXAXGTXXXGGGXGGXGGG 528 GGG GG GGG Sbjct: 305 DEGSSGGGGGGGYGGGGGG 323 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 333 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 381 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 58 GGSGNGGG-GGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG 101 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 303 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 951 GXGGGXGXGGG---XXGGXGGGXGGXXGXXG 868 G GGG G GGG GGG GG G G Sbjct: 350 GGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 380 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGG 105 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 50.4 bits (115), Expect = 4e-06 Identities = 25/48 (52%), Positives = 25/48 (52%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GGG G GGGG G GG G GGGG Sbjct: 225 GFGGRRGGGGG--GGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGG 270 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G G GG GGG G GG G GG G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGG 255 Score = 46.0 bits (104), Expect = 8e-05 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGX---GGXGXGGGGXNVXRXAXR 780 G GGG G GGG GG GG G GGG G GG G GGGG R Sbjct: 310 GGGGGGGYGGG--GGGGGYDRGNDRGSGGGGYHNRDRGGNSQGGGGGGGGGGGYSRFNDN 367 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 368 NGGGRGGRGGG 378 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/64 (39%), Positives = 25/64 (39%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GGG GG GG G GGGG G G GGGG R G G Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGG----GGGGGG 268 Query: 752 GGXV 741 GG V Sbjct: 269 GGNV 272 Score = 35.9 bits (79), Expect = 0.082 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G GG GG G GG G GG G GG G G GG ++ Sbjct: 65 GGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGGGGGGSGGNDM 115 Score = 35.1 bits (77), Expect = 0.14 Identities = 41/139 (29%), Positives = 45/139 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG GG GGGG GG G GGGG R Sbjct: 213 GGGGGGGGGGRGGFGG------RRGGGG---------GGGGGGGGGGRFDRGG------- 250 Query: 764 XGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGX 585 G GG G G G N+ + G + + KG Sbjct: 251 -GGGGGRYDRGGGGGGGGGGG--NVQPRD---GDWKCNSCNNTNFAWRNECNRCKTPKGD 304 Query: 584 XXAXGTXXXGGGXGGXGGG 528 GGG GG GGG Sbjct: 305 DEGSSGGGGGGGYGGGGGG 323 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G G GGG G G G GGGG N Sbjct: 333 GSGGG-GYHNRDRGGNSQGGGGGGGGGGGYSRFNDNNGGGRGGRGGGGGN 381 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG GG G GG G GG GGGG Sbjct: 58 GGSGNGGG-GGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGG 101 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 19/60 (31%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGG G G G GGGG G G GG + G G GG Sbjct: 45 GGGYDSGSGHRGSGGSGNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGG 104 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/59 (32%), Positives = 21/59 (35%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 G G GGG G GGGG G GGGG + + G G GG Sbjct: 303 GDDEGSSGGGGGGGYGGGGGGGGYDR---GNDRGSGGGGYHNRDRGGNSQGGGGGGGGG 358 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 3/31 (9%) Frame = -1 Query: 951 GXGGGXGXGGG---XXGGXGGGXGGXXGXXG 868 G GGG G GGG GGG GG G G Sbjct: 350 GGGGGGGGGGGYSRFNDNNGGGRGGRGGGGG 380 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG GG GG G G GG G G G Sbjct: 61 GNGGGGGGSWNDRGGNSYGNGGASKDSYNKGHGGYSGGGGGGGGG 105 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 50.4 bits (115), Expect = 4e-06 Identities = 38/138 (27%), Positives = 39/138 (28%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP PP P P T P PT A Sbjct: 315 PPPPPPRTPPPTRPPTKP--PTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPPTRAS 372 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P LP P P P+ R T P PP PP PP P Sbjct: 373 TPAPTYLP-----PTNKPLPPVTVRTTVRTTPRPTPPPTKPPTRPPTTYLPPPTVRTTRP 427 Query: 889 XXPPPXPPXXPPPXPXPP 942 PP PP PP PP Sbjct: 428 PPPPTRPPTKPPTTYLPP 445 Score = 43.2 bits (97), Expect = 5e-04 Identities = 40/147 (27%), Positives = 42/147 (28%), Gaps = 6/147 (4%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP PP PP P P T L P P+ + Sbjct: 229 PPPPPPRTPPPTRPPTRP--PTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPP----- 281 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP---PPXX 879 P P T PP P T PPPP P P PP PP Sbjct: 282 -PTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPAT 340 Query: 880 XXP---XXPPPXPPXXPPPXPXPPPXP 951 P PPP P P P PP P Sbjct: 341 YLPPTNKPPPPVTTRRPTPPPTRPPPP 367 Score = 41.9 bits (94), Expect = 0.001 Identities = 29/81 (35%), Positives = 29/81 (35%), Gaps = 1/81 (1%) Frame = +1 Query: 712 PXVPI-LPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P VP LP T PP P R PP P PP P PP Sbjct: 172 PDVPFDLPVRTTQPPTRPPTR----PPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTR- 226 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 PPP PP PPP PP P Sbjct: 227 LPPPPPPPRTPPP-TRPPTRP 246 Score = 41.5 bits (93), Expect = 0.002 Identities = 29/86 (33%), Positives = 29/86 (33%), Gaps = 9/86 (10%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP---------PP 873 P LP T PP P R T PPPP P P PP PP Sbjct: 504 PTLPP--TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYL--PPVTVRTTRATPP 559 Query: 874 XXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP PP PPP P P Sbjct: 560 PTRPPTRPPTPPPTRPPPPPTRASTP 585 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP T PPP PP P P P PPPPP Sbjct: 534 PTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPP 579 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P P PP PP PPPP P P P PP Sbjct: 206 PTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPP 247 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP P PP PP P P PP PPPP Sbjct: 190 PTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPP 234 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP T P PP P PPP PP P PP PP Sbjct: 257 PPTNKPLPPVTTRLPPP-PPSPRTPPPTRPPTRPPTTRPPATYLPP 301 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP T P PP P PPP PP P PP PP Sbjct: 300 PPTNKPLPPVTTRLPPPPPP-PRTPPPTRPPTKPPTTRPPATYLPP 344 Score = 39.1 bits (87), Expect = 0.009 Identities = 35/144 (24%), Positives = 40/144 (27%), Gaps = 3/144 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP PP PP P P + P P PT + Sbjct: 238 PPTRPPTRPPTTRPPATYLPPTNK----PLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTR 293 Query: 709 XPXVPILPXNQTXPPX---IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 P + P N+ PP +P P PP PP PPPP Sbjct: 294 PPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVT 353 Query: 880 XXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PPP P P Sbjct: 354 TRRPTPPPTR-PPPPPTRASTPAP 376 Score = 39.1 bits (87), Expect = 0.009 Identities = 27/92 (29%), Positives = 28/92 (30%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXX 846 P PT A P LP P P P+ R T P P PP Sbjct: 570 PPPTRPPPPPTRASTPAPTYLP-----PTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPP 624 Query: 847 XXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P PP PP PP PP Sbjct: 625 TTYLPPPSVRTTRPPPPPTRPPTKPPTTYLPP 656 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P P+ R T P P PP PP P PP PP PP Sbjct: 798 PTNKPLPPVTVRTTVRTTPRPTLPPTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPPT 857 Query: 928 XPXPP 942 PP Sbjct: 858 TYLPP 862 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P P+ R T P P PP PP P PP PP PP Sbjct: 484 PTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPT 543 Query: 928 XPXPP 942 PP Sbjct: 544 TYLPP 548 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P P P+ R T P P PP PP P PP PP PP Sbjct: 695 PTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPT 754 Query: 928 XPXPP 942 PP Sbjct: 755 TYLPP 759 Score = 37.9 bits (84), Expect = 0.020 Identities = 25/80 (31%), Positives = 25/80 (31%), Gaps = 6/80 (7%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP---PPXXXXPXXPP 900 P PP P T PPPP P P PP PP P Sbjct: 202 PTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNK 261 Query: 901 PXPP---XXPPPXPXPPPXP 951 P PP PPP P P P Sbjct: 262 PLPPVTTRLPPPPPSPRTPP 281 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXX--PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP T P PP PP PPPP P P P PP Sbjct: 290 PTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPP 333 Score = 37.5 bits (83), Expect = 0.027 Identities = 39/149 (26%), Positives = 42/149 (28%), Gaps = 10/149 (6%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP PP PP P P + P P PT K Sbjct: 281 PPTRPPTRPPTTRPPATYLPPTNK----PLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTR 336 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX-PXPPXPXXXXXXXPP-PP--- 873 P + P N+ PP P T PPPP P P P PP Sbjct: 337 PPATYLPPTNKPPPPVTTRRP-----TPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTV 391 Query: 874 -----XXXXPXXPPPXPPXXPPPXPXPPP 945 P PP PP PP PPP Sbjct: 392 RTTVRTTPRPTPPPTKPPTRPPTTYLPPP 420 Score = 37.5 bits (83), Expect = 0.027 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 742 TXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 T PP P P T PP P PP P P PP PP P Sbjct: 569 TPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTP-----RPTLPPTKPPTRP 623 Query: 922 PPXPXPPP 945 P PPP Sbjct: 624 PTTYLPPP 631 Score = 37.1 bits (82), Expect = 0.035 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 11/91 (12%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP---PPXXX 882 P P+ T PP P P T PP P PP P PP Sbjct: 348 PPPPVTTRRPTPPPTRPPPPPTRASTPAPTYLPPTNKPLPPVTVRTTVRTTPRPTPPPTK 407 Query: 883 XPXXPPPX---PPXX-----PPPXPXPPPXP 951 P PP PP PPP PP P Sbjct: 408 PPTRPPTTYLPPPTVRTTRPPPPPTRPPTKP 438 Score = 36.7 bits (81), Expect = 0.047 Identities = 36/146 (24%), Positives = 37/146 (25%), Gaps = 5/146 (3%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP PP PP P T P P R Sbjct: 185 PPTRPPTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPT 244 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP---PPXX 879 P P P P P+ T PPPP P PP PP Sbjct: 245 RPPTTRPPATYLPPTNKPLPPV-------TTRLPPPPPSPRTPPPTRPPTRPPTTRPPAT 297 Query: 880 XXPXXPPPXPPXXP--PPXPXPPPXP 951 P P PP PP P PP P Sbjct: 298 YLPPTNKPLPPVTTRLPPPPPPPRTP 323 Score = 36.7 bits (81), Expect = 0.047 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXP 909 P T PP P R T PPP P P PPPP P Sbjct: 531 PPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPPTRASTPAPTYL 590 Query: 910 PXXPPPXPXPP 942 P P P PP Sbjct: 591 P--PTNKPLPP 599 Score = 36.3 bits (80), Expect = 0.062 Identities = 24/73 (32%), Positives = 25/73 (34%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP T PP P + R T PPPP P P PP PP Sbjct: 612 PTLPP--TKPPTRPPTTYLPPPSVRTTRPPPPPTRPPTKPPTTYL--PPVTVRTTRATPP 667 Query: 901 PXPPXXPPPXPXP 939 P P PP P Sbjct: 668 PTRPPTRPPTYPP 680 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/73 (32%), Positives = 24/73 (32%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP T PP P R T PPPP P P PP PP Sbjct: 715 PTLPP--TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYL--PPVTVRTTRATPP 770 Query: 901 PXPPXXPPPXPXP 939 P P PP P Sbjct: 771 PTRPPTRPPTYPP 783 Score = 35.5 bits (78), Expect = 0.11 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXP----PXPPPPP 944 P P PP T P P PP PP PP P P PPPPP Sbjct: 483 PPTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPP 534 Score = 35.5 bits (78), Expect = 0.11 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXP----PXPPPPP 944 P P PP T P P PP PP PP P P PPPPP Sbjct: 694 PPTNKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLPPPTVRTTRPPPPP 745 Score = 35.1 bits (77), Expect = 0.14 Identities = 29/100 (29%), Positives = 31/100 (31%), Gaps = 7/100 (7%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXX--PIFX-----LXAXRXTXXPPPPXP 825 P PT K P V + T PP P P + L T PP P Sbjct: 429 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKP 488 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PP PP PP PPP Sbjct: 489 LPPVTVRTTVRTTP-----RPTLPPTKPPTRPPTTYLPPP 523 Score = 35.1 bits (77), Expect = 0.14 Identities = 29/100 (29%), Positives = 31/100 (31%), Gaps = 7/100 (7%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXX--PIFX-----LXAXRXTXXPPPPXP 825 P PT K P V + T PP P P + L T PP P Sbjct: 640 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKP 699 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PP PP PP PPP Sbjct: 700 LPPVTVRTTVRTTP-----RPTLPPTKPPTRPPTTYLPPP 734 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +1 Query: 742 TXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 T PP P R T PPPP P P PP PPP P Sbjct: 406 TKPPTRPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTYL--PPVTVRTTRATPPPTRPPTR 463 Query: 922 PPXPXP 939 PP P Sbjct: 464 PPTYPP 469 Score = 33.1 bits (72), Expect = 0.58 Identities = 32/139 (23%), Positives = 37/139 (26%) Frame = +3 Query: 528 PPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPPXLPXTXXLIXQISSCX 707 PPP PP P+T P+ +TP P P PP P T L + Sbjct: 741 PPPPPTRPPTKPPTTYL--PPVTVRTTRATPP--PTRPPTRPPTYPPTTRRLTTPAPTYL 796 Query: 708 XXXXXXXXXXXXXXXTXSXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP 887 + P P P P P P P PP Sbjct: 797 PPTNKPLPPVTVRTTVRTTPRPTLPPTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPP 856 Query: 888 XPPPPXXPXPXPPXPPPPP 944 P PPPPP Sbjct: 857 TTYLPPVTVVRTTRPPPPP 875 Score = 32.3 bits (70), Expect = 1.0 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXPPXPPP 938 P P P PP PP PP PP P PP PPP Sbjct: 170 PPPDVPFDLPVRTTQPPT--RPPTRPPTRPPTRPPTRPPTPPP 210 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P PP P PP PP PP P PP Sbjct: 170 PPPDVPFDLPVRTTQPPTRP-PTRPPTRPPTRPPTRPPTPP 209 Score = 31.5 bits (68), Expect = 1.8 Identities = 37/147 (25%), Positives = 42/147 (28%), Gaps = 8/147 (5%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPX-LXCPXPTXLSXKFRHA 705 PP PP PP +P T L P PT L + Sbjct: 744 PPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKPL 803 Query: 706 LXPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPP------PXPXPPXPXXXXXXXP 864 P V + +T P P +P P T PPP P P P P Sbjct: 804 --PPVTVRTTVRTTPRPTLP--PTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKPPTTY 859 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP PP PP PPP Sbjct: 860 LPPVTVVRTTRPPPPPTRRTTVYVPPP 886 Score = 29.9 bits (64), Expect = 5.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 YL P P P P P T PP PPP P PP PP Sbjct: 416 YLPPPTVRTTRPP--PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPP 469 Score = 29.9 bits (64), Expect = 5.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 YL P P P P P T PP PPP P PP PP Sbjct: 627 YLPPPSVRTTRPP--PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPP 680 Score = 29.9 bits (64), Expect = 5.4 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 YL P P P P P T PP PPP P PP PP Sbjct: 730 YLPPPTVRTTRPP--PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPP 783 Score = 29.5 bits (63), Expect = 7.1 Identities = 31/114 (27%), Positives = 33/114 (28%), Gaps = 19/114 (16%) Frame = +1 Query: 667 PXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXX--PIFX-----LXAXRXTXXPPPPXP 825 P PT K P V + T PP P P + L T PP P Sbjct: 743 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNKP 802 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXX------------PPPXPXPPPXP 951 PP P P P PP PP PPP PP P Sbjct: 803 LPPVTVRTTVRTTPRPTLP-PTRPPTKPPTTYLPPPTVRTTRPPPPPTRPPTKP 855 Score = 29.5 bits (63), Expect = 7.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +1 Query: 808 PP--PPXPXPPXPXXXXXXXPPPPXXXXPXXPPP--XPPXXPPPXPXPPPXP 951 PP PP P P PPPP P PP PP PPP P Sbjct: 825 PPTKPPTTYLPPPTVRTT-RPPPPPTRPPTKPPTTYLPPVTVVRTTRPPPPP 875 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 50.4 bits (115), Expect = 4e-06 Identities = 41/141 (29%), Positives = 43/141 (30%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G GG GG G G GG G G G GG Sbjct: 250 GGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQ 309 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG GR G+ G + G GQ G P Sbjct: 310 GGGGGYGGAGGGAGRGGSPGGPG--SPGGGGFG-GQGGAGGGYGGGGGGGRGGGGAPGAP 366 Query: 590 GXXXAXGTXXXGGGXGGXGGG 528 G G GGG G GGG Sbjct: 367 GSPGGGGFGGQGGGGGFGGGG 387 Score = 49.6 bits (113), Expect = 6e-06 Identities = 28/69 (40%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN-VXRXAXRXK 774 G GGG G GGG GG GG G GG G GG G GGG N + A Sbjct: 42 GPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRP 101 Query: 773 IGXXGXXGG 747 I G GG Sbjct: 102 IAPGGGGGG 110 Score = 49.6 bits (113), Expect = 6e-06 Identities = 44/144 (30%), Positives = 45/144 (31%), Gaps = 5/144 (3%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG---GXNVXRXAXRXK 774 GG G G G GG G G G GGGG G GG G GGG G R Sbjct: 238 GGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGG 297 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSI 594 G G GG G G G G G G Sbjct: 298 PGAPG-GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGG 356 Query: 593 KGXXXAXGT--XXXGGGXGGXGGG 528 +G A G GGG GG GGG Sbjct: 357 RGGGGAPGAPGSPGGGGFGGQGGG 380 Score = 48.4 bits (110), Expect = 1e-05 Identities = 42/142 (29%), Positives = 42/142 (29%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GG GGGG G GG G GG Sbjct: 344 GAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGG 403 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSI 594 G G GG G G G G G G P Sbjct: 404 YGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGG--FGGQGGGGGFGGGGGRGGAPGA 461 Query: 593 KGXXXAXGTXXXGGGXGGXGGG 528 G G GGG GG GGG Sbjct: 462 PGSPGGGGFGGQGGG-GGYGGG 482 Score = 44.8 bits (101), Expect = 2e-04 Identities = 29/82 (35%), Positives = 29/82 (35%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG--GXGXGGGGXNVXRXAXRX 777 G GGG G GGG GG G G GGG G G G G GG Sbjct: 409 GAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGG 468 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 469 GFGGQGGGGGYGGGAGRGGAPG 490 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGG--GGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G G GG GG GGG G GG GG G G Sbjct: 66 GGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 110 Score = 42.7 bits (96), Expect = 7e-04 Identities = 40/139 (28%), Positives = 41/139 (29%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G G G GGG G GG G G G G GG G G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGG----------GG 282 Query: 764 XGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKGX 585 G GG G G G + G G G P G Sbjct: 283 YGSGGGS-GRGGAPGGPGAPGGGGFGGQGGGGGYGGAG-----GGAGRGGSPGGPGSPGG 336 Query: 584 XXAXGTXXXGGGXGGXGGG 528 G GGG GG GGG Sbjct: 337 GGFGGQGGAGGGYGGGGGG 355 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/81 (37%), Positives = 32/81 (39%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG GG GGG G GGG G GG G GGG R Sbjct: 337 GGFGGQGGAGGGYGGGGGGGRG----GGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGA 392 Query: 770 -GXXGXXGGXVWLXGRMGTXG 711 G G GG + G+ G G Sbjct: 393 PGAPGSPGGGGY-GGQGGAGG 412 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G G G GGGG GGG G G G GG G G G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGG 80 Score = 41.5 bits (93), Expect = 0.002 Identities = 31/83 (37%), Positives = 31/83 (37%), Gaps = 3/83 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGGXXXXXXXGXG-GXGXG-GGGXNVXRXAXR 780 G GG G GGG GG G GG G GGG G G G G G GG Sbjct: 438 GGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGG 497 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 498 GGFGGQGGGGGFGAGGGRGGAGG 520 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG---GGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GG GG GGG G G GG GG G GGGG R Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGG-GGGGAPAPR 117 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/80 (31%), Positives = 26/80 (32%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G G G GGG G GGG G G GG Sbjct: 450 GGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGF 509 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G G GG G G+ G Sbjct: 510 GAGGGRGGAGGAPGGPGSPG 529 Score = 39.5 bits (88), Expect = 0.007 Identities = 31/82 (37%), Positives = 31/82 (37%), Gaps = 2/82 (2%) Frame = -2 Query: 950 GXGGGXGXGG--GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G GG G G GGG G GGG G GG G GG G Sbjct: 478 GYGGGAGRGGAPGAPGSPGGGGFGGQGGGGG-------FGAGG-GRGGAGGAPGGPGSPG 529 Query: 776 KIGXXGXXGGXVWLXGRMGTXG 711 G G GG GR G G Sbjct: 530 GPGYGGGAGGPGGAGGRPGGPG 551 Score = 38.7 bits (86), Expect = 0.012 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 941 GGXGXGGGX--XGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GGG GG GGG G GGGG G G G G GG Sbjct: 39 GLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGG 85 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G G G GGG GG GG G GG G G Sbjct: 497 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGG 542 Score = 37.5 bits (83), Expect = 0.027 Identities = 31/100 (31%), Positives = 32/100 (32%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GG GGG GG GG GG G G G G GG G G Sbjct: 329 GGPGSPGGGGFGGQGGAGGGYGGGGGGG---------RGGGGAPGAPGSPGGGGFGGQGG 379 Query: 765 XGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G GG G G G G + G G GGG Sbjct: 380 GGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGG 419 Score = 37.5 bits (83), Expect = 0.027 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXR 799 G GG G GGG G GGG GG G G G GG G R Sbjct: 496 GGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGR 546 Score = 37.1 bits (82), Expect = 0.035 Identities = 28/83 (33%), Positives = 30/83 (36%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GG G GGG G GGG GG G G G GG G R Sbjct: 436 GGGGFGGQGGGGGFGGGGGRGGAPGAPG-SPGGGGFGGQGGGGGYGGGAGRGGAPGAPGS 494 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G +GG G G G +G Sbjct: 495 PG-GGGFGGQGGGGGFGAGGGRG 516 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -1 Query: 951 GXGGGX--GXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GGG G GGG GG GG GG G G G G GG G Sbjct: 65 GGGGGPAGGFGGGPGGGGAGGFGG--GNNGLGGFANGRPIAPGGGGGG 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG G G G G GG GG GG G G G G Sbjct: 504 GGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPG 548 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G GGG GGG G GG G GG G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFG 75 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG------GGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G G GGG G GG G GG G GG G G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAG 84 Score = 33.1 bits (72), Expect = 0.58 Identities = 30/92 (32%), Positives = 30/92 (32%), Gaps = 1/92 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGG-GXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXE 775 G GGG G GGG G G G G G G G G GG G Sbjct: 415 GGGGGRG-GGGAPGAPGAPGSPGGGGFGGQG-GGGGFGGGGGRGGAPGAPGSPGGGGFGG 472 Query: 774 DRGXGNXWGGCLVXGEDGDXGXKGMTKFXG*G 679 G G GG G G G G F G G Sbjct: 473 QGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQG 504 Score = 33.1 bits (72), Expect = 0.58 Identities = 30/103 (29%), Positives = 31/103 (30%), Gaps = 1/103 (0%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGG-GXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXE 775 G GGG G GGG G G G G G G G G G G + Sbjct: 444 GGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQ 503 Query: 774 DRGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G GG G G G G G G GG Sbjct: 504 GGGGGFGAGGGR-GGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 545 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G GG G G G GG GG GG G Sbjct: 523 GGPGSPGGPGYG-GGAGGPGGAGGRPGGPG 551 Score = 29.5 bits (63), Expect = 7.1 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG-XGGXGXGG 813 G G G G GG G G G GGG G GG G G Sbjct: 508 GFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPGLPG 554 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 4/72 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG----GXXXXXXXGXGGXGXGGGGXNVXRXAX 783 G GGG G GGG G GGG G GGG G G G G GGGG Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGG 77 Query: 782 RXKIGXXGXXGG 747 R G G GG Sbjct: 78 RGAFGGRGGGGG 89 Score = 48.4 bits (110), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG GGGG G GG G GG G Sbjct: 60 GFGGGRG-GGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRG 106 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXX----GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGG Sbjct: 42 GFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGG 93 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/77 (40%), Positives = 32/77 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G GGG GG GGG G G G G GG G GGGG R A + Sbjct: 28 GFRGRGGGGGGGGGGFGGG-RGRGGGGDRGGRGGFGGGRGGGGRGGGGGG-GRGAFGGRG 85 Query: 770 GXXGXXGGXVWLXGRMG 720 G G GG GR G Sbjct: 86 GGGGRGGGGRGGGGRGG 102 Score = 46.4 bits (105), Expect = 6e-05 Identities = 30/78 (38%), Positives = 31/78 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG G G G GG G GG G GG G R + G Sbjct: 34 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR-GG 92 Query: 764 XGXXGGXVWLXGRMGTXG 711 G GG GR G G Sbjct: 93 GGRGGGGRGGGGRGGGAG 110 Score = 46.0 bits (104), Expect = 8e-05 Identities = 30/83 (36%), Positives = 31/83 (37%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G GGG GG G G G G GG G RG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRG----- 71 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G GG G G G +G Sbjct: 72 ---GGGGGGRGAFGGRGGGGGRG 91 Score = 44.0 bits (99), Expect = 3e-04 Identities = 33/89 (37%), Positives = 34/89 (38%), Gaps = 4/89 (4%) Frame = -1 Query: 951 GXGGGX-GXGGGXXGGXGGGXGGXXGXXG--XGXXXXXXXXXXGXGGXGXXXXRXXRGXE 781 G GGG G GGG GG G G GG G G G G GG G R G Sbjct: 31 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 90 Query: 780 -XEDRGXGNXWGGCLVXGEDGDXGXKGMT 697 RG G GG G G G K +T Sbjct: 91 GGGGRGGGGRGGGGRGGGAGGFKGGKTVT 119 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/88 (34%), Positives = 31/88 (35%), Gaps = 5/88 (5%) Frame = -1 Query: 951 GXGGGXGXG-----GGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRG 787 G GGG G G GG GG GGG GG G G G G GG G Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 78 Query: 786 XEXEDRGXGNXWGGCLVXGEDGDXGXKG 703 RG G GG G G +G Sbjct: 79 GAFGGRGGGGGRGGGGRGGGGRGGGGRG 106 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GGGG GGG G G G Sbjct: 82 GGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 111 Score = 41.5 bits (93), Expect = 0.002 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXG 759 G G GGG GG G G GGGG G GG G GG R G G Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG----GRGG 72 Query: 758 XXGGXVWLXGRMGTXGXR 705 GG G G G R Sbjct: 73 GGGGGRGAFGGRGGGGGR 90 Score = 37.9 bits (84), Expect = 0.020 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRGXGNXWG 748 GGG GG GGG G G G G G GG R RG RG G G Sbjct: 18 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG-----DRGGRGGFGGGRGGGGRGG 72 Query: 747 GCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G G G +G G G GGG Sbjct: 73 G--GGGGRGAFGGRGGGGGRGGGGRGGGGRGGGG 104 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 50.0 bits (114), Expect = 5e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGGG GGG G G G GG G G G Sbjct: 24 GGGGGGGGYGGG--GGGGYGGGGGGQSGYGGGGQK-NGGGGHGGGG 66 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG--XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G GGG G GGGG GG G GG G Sbjct: 35 GGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQG 84 Score = 44.0 bits (99), Expect = 3e-04 Identities = 28/69 (40%), Positives = 29/69 (42%), Gaps = 2/69 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG--XGGXGXGGGGXNVXRXAXRX 777 G GG G GGG GG GGG G GGGG G GG G GGGG + Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGG----GGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQG 76 Query: 776 KIGXXGXXG 750 G G G Sbjct: 77 GHGGGGQGG 85 Score = 37.5 bits (83), Expect = 0.027 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGG--GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G G GG GG G G G GGG G GG GGG Sbjct: 43 GGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQGGWQKKGGG 92 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -1 Query: 942 GGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRGX 763 G G GGG G GGG GG G G G GG G G G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Query: 762 GNXWG 748 G G Sbjct: 81 GGQGG 85 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 50.0 bits (114), Expect = 5e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGGG GGG G G G GG G G G Sbjct: 24 GGGGGGGGYGGG--GGGGYGGGGGGQSGYGGGGQK-NGGGGHGGGG 66 Score = 33.1 bits (72), Expect = 0.58 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G G G GG GG G GG G GG G Sbjct: 36 GGGGYGGG-GGGQSGYGG-GGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 872 GGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGGG G GG GGGG K G G GG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGGG G G G GGGG Sbjct: 21 GLLGGGGGG-GGYGGGGGGGYGGGGGGQSGYGGGG 54 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 50.0 bits (114), Expect = 5e-06 Identities = 25/49 (51%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-XXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGG Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 45.2 bits (102), Expect = 1e-04 Identities = 24/46 (52%), Positives = 24/46 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G G GGGG GGG G G G GG G G G Sbjct: 24 GGGGGGGGYGGG--GGGGYGGGGGGQSGYGGGGQK-NGGGGHGGGG 66 Score = 33.1 bits (72), Expect = 0.58 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G G G GG GG G GG G GG G Sbjct: 36 GGGGYGGG-GGGQSGYGG-GGQKNGGGGHGGGGQGSYGGGSQG 76 Score = 29.9 bits (64), Expect = 5.4 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 872 GGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GGGG G GG GGGG K G G GG Sbjct: 24 GGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGG 65 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGGG G G G GGGG Sbjct: 21 GLLGGGGGG-GGYGGGGGGGYGGGGGGQSGYGGGG 54 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 50.0 bits (114), Expect = 5e-06 Identities = 29/72 (40%), Positives = 29/72 (40%), Gaps = 4/72 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG----GXXXXXXXGXGGXGXGGGGXNVXRXAX 783 G GGG G GGG G GGG G GGG G G G G GGGG Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGG 70 Query: 782 RXKIGXXGXXGG 747 R G G GG Sbjct: 71 RGAFGGRGGGGG 82 Score = 48.4 bits (110), Expect = 1e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG GGGG G GG G GG G Sbjct: 53 GFGGGRG-GGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRG 99 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/52 (48%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXX----GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG GG GGG G GGGG G GG G GGG Sbjct: 35 GFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGRGGG 86 Score = 46.4 bits (105), Expect = 6e-05 Identities = 31/77 (40%), Positives = 32/77 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G GGG GG GGG G G G G GG G GGGG R A + Sbjct: 21 GFRGRGGGGGGGGGGFGGG-RGRGGGGDRGGRGGFGGGRGGGGRGGGGGG-GRGAFGGRG 78 Query: 770 GXXGXXGGXVWLXGRMG 720 G G GG GR G Sbjct: 79 GGGGRGGGGRGGGGRGG 95 Score = 46.4 bits (105), Expect = 6e-05 Identities = 30/78 (38%), Positives = 31/78 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GGG GG G G G GG G GG G GG G R + G Sbjct: 27 GGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR-GG 85 Query: 764 XGXXGGXVWLXGRMGTXG 711 G GG GR G G Sbjct: 86 GGRGGGGRGGGGRGGGAG 103 Score = 46.0 bits (104), Expect = 8e-05 Identities = 30/83 (36%), Positives = 31/83 (37%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G GGG GG G G G G GG G RG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRG----- 64 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G GG G G G +G Sbjct: 65 ---GGGGGGRGAFGGRGGGGGRG 84 Score = 44.8 bits (101), Expect = 2e-04 Identities = 31/80 (38%), Positives = 31/80 (38%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G GGG GG GGG G GGGG G GG G GGGG R Sbjct: 2 GKPGFSPRGGGGGGGGGGG--GFRGRGGGGGGGGGGFG-GGRGRGGGGDRGGRGGFGGGR 58 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 G G GG G G G Sbjct: 59 GGGGRGGGGGGGRGAFGGRG 78 Score = 44.0 bits (99), Expect = 3e-04 Identities = 33/89 (37%), Positives = 34/89 (38%), Gaps = 4/89 (4%) Frame = -1 Query: 951 GXGGGX-GXGGGXXGGXGGGXGGXXGXXG--XGXXXXXXXXXXGXGGXGXXXXRXXRGXE 781 G GGG G GGG GG G G GG G G G G GG G R G Sbjct: 24 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 83 Query: 780 -XEDRGXGNXWGGCLVXGEDGDXGXKGMT 697 RG G GG G G G K +T Sbjct: 84 GGGGRGGGGRGGGGRGGGAGGFKGGKTVT 112 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/88 (34%), Positives = 31/88 (35%), Gaps = 5/88 (5%) Frame = -1 Query: 951 GXGGGXGXG-----GGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRG 787 G GGG G G GG GG GGG GG G G G G GG G Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 71 Query: 786 XEXEDRGXGNXWGGCLVXGEDGDXGXKG 703 RG G GG G G +G Sbjct: 72 GAFGGRGGGGGRGGGGRGGGGRGGGGRG 99 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GGGG GGG G G G Sbjct: 75 GGRGGGGGRGGGGRGGGGRGGGGRGGGAGG 104 Score = 41.5 bits (93), Expect = 0.002 Identities = 28/78 (35%), Positives = 28/78 (35%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXG 759 G G GGG GG G G GGGG G GG G GG R G G Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG----GRGG 65 Query: 758 XXGGXVWLXGRMGTXGXR 705 GG G G G R Sbjct: 66 GGGGGRGAFGGRGGGGGR 83 Score = 37.9 bits (84), Expect = 0.020 Identities = 32/94 (34%), Positives = 33/94 (35%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRGXGNXWG 748 GGG GG GGG G G G G G GG R RG RG G G Sbjct: 11 GGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGG-----DRGGRGGFGGGRGGGGRGG 65 Query: 747 GCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G G G +G G G GGG Sbjct: 66 G--GGGGRGAFGGRGGGGGRGGGGRGGGGRGGGG 97 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 49.6 bits (113), Expect = 6e-06 Identities = 30/68 (44%), Positives = 30/68 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GGG G GG G G GG G GGGG NV Sbjct: 119 GGGYGGGHGGGYGGGYGGGSSG-GYSGGHGGGWSSGGGYGGGGYGGGG-NVKIIKVISDA 176 Query: 770 GXXGXXGG 747 G G GG Sbjct: 177 GSSGGYGG 184 Score = 43.6 bits (98), Expect = 4e-04 Identities = 27/80 (33%), Positives = 29/80 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG GGG G G GG G GG G GGGG K+ Sbjct: 48 GAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKV 107 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 GG + G G G Sbjct: 108 ITDSGAGGGGYGGGYGGGHG 127 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG--XGGXGXXXXXVXGGXGXGXXG 806 GGG G G GGG GGG G GG G GG G G G Sbjct: 46 GGGAGGSALSSGWSSGGG-GGGYSGGYSGGHGGGGGYGGGGYGGGGYG 92 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 9/57 (15%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXX-------GXGGXGXGGGG 807 G GGG G G GG GG GGG GGGG G G GGG Sbjct: 129 GYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGGYGGGGNVKIIKVISDAGSSGGYGGG 185 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GGGG G GG G GGG Sbjct: 45 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGG 84 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 49.6 bits (113), Expect = 6e-06 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP + PP +P + PPPP PP PPPP P P Sbjct: 334 PPLPPARQPPPAVP------VTVPGAARAPPPPNRPPPISTA-----PPPPPVSAPVVAP 382 Query: 901 PXPPXXPP---PXPXPPPXP 951 P PP PP P P PPP P Sbjct: 383 PPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP + P PP P P PPPP P P P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 11/66 (16%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP-----------XPPPPXXPXPXPP 926 P A + P P P P P PPP PPPP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 927 XPPPPP 944 PPPPP Sbjct: 369 APPPPP 374 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 10/57 (17%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPP-PPXXXXPXXPP---------PXPPXXPPPXPXPPPXP 951 PPP P PP PP P P P PP PPP PP P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 Score = 29.1 bits (62), Expect = 9.4 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX------PXPPXPXXXXXXXPPPP 873 P VP+ P P P T PPPP P PP PPPP Sbjct: 344 PAVPVTVPGAARAPPPPNRP-----PPISTAPPPPPVSAPVVAPPPP--------PPPPP 390 Query: 874 XXXXPXXPPPXP 909 P PPP P Sbjct: 391 AAVPPPPPPPMP 402 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 49.6 bits (113), Expect = 6e-06 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP + PP +P + PPPP PP PPPP P P Sbjct: 301 PPLPPARQPPPAVP------VTVPGAARAPPPPNRPPPISTA-----PPPPPVSAPVVAP 349 Query: 901 PXPPXXPP---PXPXPPPXP 951 P PP PP P P PPP P Sbjct: 350 PPPPPPPPAAVPPPPPPPMP 369 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP + P PP P P PPPP P P P Sbjct: 338 PPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 374 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 11/66 (16%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP-----------XPPPPXXPXPXPP 926 P A + P P P P P PPP PPPP P P Sbjct: 276 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 335 Query: 927 XPPPPP 944 PPPPP Sbjct: 336 APPPPP 341 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 10/57 (17%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPP-PPXXXXPXXPP---------PXPPXXPPPXPXPPPXP 951 PPP P PP PP P P P PP PPP PP P Sbjct: 284 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 340 Score = 29.1 bits (62), Expect = 9.4 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX------PXPPXPXXXXXXXPPPP 873 P VP+ P P P T PPPP P PP PPPP Sbjct: 311 PAVPVTVPGAARAPPPPNRP-----PPISTAPPPPPVSAPVVAPPPP--------PPPPP 357 Query: 874 XXXXPXXPPPXP 909 P PPP P Sbjct: 358 AAVPPPPPPPMP 369 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 49.6 bits (113), Expect = 6e-06 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP + PP +P + PPPP PP PPPP P P Sbjct: 334 PPLPPARQPPPAVP------VTVPGAARAPPPPNRPPPISTA-----PPPPPVSAPVVAP 382 Query: 901 PXPPXXPP---PXPXPPPXP 951 P PP PP P P PPP P Sbjct: 383 PPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP + P PP P P PPPP P P P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 11/66 (16%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP-----------XPPPPXXPXPXPP 926 P A + P P P P P PPP PPPP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 927 XPPPPP 944 PPPPP Sbjct: 369 APPPPP 374 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 10/57 (17%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPP-PPXXXXPXXPP---------PXPPXXPPPXPXPPPXP 951 PPP P PP PP P P P PP PPP PP P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 Score = 29.1 bits (62), Expect = 9.4 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX------PXPPXPXXXXXXXPPPP 873 P VP+ P P P T PPPP P PP PPPP Sbjct: 344 PAVPVTVPGAARAPPPPNRP-----PPISTAPPPPPVSAPVVAPPPP--------PPPPP 390 Query: 874 XXXXPXXPPPXP 909 P PPP P Sbjct: 391 AAVPPPPPPPMP 402 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 49.6 bits (113), Expect = 6e-06 Identities = 29/80 (36%), Positives = 32/80 (40%), Gaps = 3/80 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P LP + PP +P + PPPP PP PPPP P P Sbjct: 334 PPLPPARQPPPAVP------VTVPGAARAPPPPNRPPPISTA-----PPPPPVSAPVVAP 382 Query: 901 PXPPXXPP---PXPXPPPXP 951 P PP PP P P PPP P Sbjct: 383 PPPPPPPPAAVPPPPPPPMP 402 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP + P PP P P PPPP P P P Sbjct: 371 PPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 Score = 35.1 bits (77), Expect = 0.14 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 11/66 (16%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPP-----------XPPPPXXPXPXPP 926 P A + P P P P P PPP PPPP P P Sbjct: 309 PTETAAPMPPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPIST 368 Query: 927 XPPPPP 944 PPPPP Sbjct: 369 APPPPP 374 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 10/57 (17%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPP-PPXXXXPXXPP---------PXPPXXPPPXPXPPPXP 951 PPP P PP PP P P P PP PPP PP P Sbjct: 317 PPPVPTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPP 373 Score = 29.1 bits (62), Expect = 9.4 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX------PXPPXPXXXXXXXPPPP 873 P VP+ P P P T PPPP P PP PPPP Sbjct: 344 PAVPVTVPGAARAPPPPNRP-----PPISTAPPPPPVSAPVVAPPPP--------PPPPP 390 Query: 874 XXXXPXXPPPXP 909 P PPP P Sbjct: 391 AAVPPPPPPPMP 402 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 49.6 bits (113), Expect = 6e-06 Identities = 28/69 (40%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN-VXRXAXRXK 774 G GGG G GGG GG GG G GG G GG G GGG N + A Sbjct: 42 GPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRP 101 Query: 773 IGXXGXXGG 747 I G GG Sbjct: 102 IAPGGGGGG 110 Score = 44.0 bits (99), Expect = 3e-04 Identities = 22/45 (48%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGG--GGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G G GG GG GGG G GG GG G G Sbjct: 66 GGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGGGG 110 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G G G GGGG GGG G G G GG G G G Sbjct: 37 GAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGG 80 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/56 (42%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGG---GGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GG GG GGG G G GG GG G GGGG R Sbjct: 63 GGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGG-GGGGAPAPR 117 Score = 38.7 bits (86), Expect = 0.012 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -2 Query: 941 GGXGXGGGX--XGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GGG GG GGG G GGGG G G G G GG Sbjct: 39 GLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGG 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -1 Query: 951 GXGGGX--GXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GGG G GGG GG GG GG G G G G GG G Sbjct: 65 GGGGGPAGGFGGGPGGGGAGGFGG--GNNGLGGFANGRPIAPGGGGGG 110 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G GGG GGG G GG G GG G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFG 75 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG------GGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G G GGG G GG G GG G GG G G G Sbjct: 33 GGSPGAGLQGPGGGFGGGGGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAG 84 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 49.2 bits (112), Expect = 8e-06 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P P P P P P PP PPP P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 48.0 bits (109), Expect = 2e-05 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPP P PP PP P P P PPP P Sbjct: 642 PPPPPPPPPP-------PPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 681 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PP PPP PP P P P P P Sbjct: 644 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 691 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXPPXPPPPP 944 V P P P PP P PP P PP PP P P PP PPPPP Sbjct: 637 VDPSYPPPPPPPPP----PPPPQTCCAPVRPPYAPPVRPLPPPP-PPPPP 681 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXP---XPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P PP T PP PPP PPPP P P P P Sbjct: 646 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 691 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P PP P P PP P P P P PP P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 35.1 bits (77), Expect = 0.14 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P P P PP PPP P P P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 33.1 bits (72), Expect = 0.58 Identities = 20/55 (36%), Positives = 20/55 (36%), Gaps = 7/55 (12%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG-------XXXXXXXGXGGXGXGGGG 807 G G G G GG GGG GGG G GG G GGGG Sbjct: 441 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGG 495 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G GG G G GG G GG N Sbjct: 455 GFGGGADANSGANGGGGSAGANAGANGGFGGFG----GFGGGGGGGANAN 500 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP PP P PP Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPP 664 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 49.2 bits (112), Expect = 8e-06 Identities = 20/44 (45%), Positives = 20/44 (45%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P P P P P P PP PPP P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 48.0 bits (109), Expect = 2e-05 Identities = 22/47 (46%), Positives = 22/47 (46%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPP P PP PP P P P PPP P Sbjct: 782 PPPPPPPPPP-------PPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 821 Score = 46.4 bits (105), Expect = 6e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PP PPP PP P P P P P Sbjct: 784 PPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 831 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXPPXPPPPP 944 V P P P PP P PP P PP PP P P PP PPPPP Sbjct: 777 VDPSYPPPPPPPPP----PPPPQTCCAPVRPPYAPPVRPLPPPP-PPPPP 821 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXP---XPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P PP T PP PPP PPPP P P P P Sbjct: 786 PPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTPIYP 831 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P PP P P PP P P P P PP P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 35.1 bits (77), Expect = 0.14 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP P P P P P PP PPP P P P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG G GG G G GG G GGGG Sbjct: 592 GFGGGADANSGANGGGGSAGANAGANGGFGGFG----GFGGFGGGGGG 635 Score = 32.7 bits (71), Expect = 0.76 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GG GGG GGG G G G GG Sbjct: 578 GGGVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGG 625 Score = 30.3 bits (65), Expect = 4.1 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G G GG GG G GGGG G G G R + KI Sbjct: 605 GGGGSAGANAGANGGFGG-FGGFGGFGGGGGGGANANSNAFGGYDGFGFFGLRQRAQQKI 663 Score = 30.3 bits (65), Expect = 4.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP PP P PP Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPP 804 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 48.8 bits (111), Expect = 1e-05 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G G GG G G G GGGG Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGG 72 Score = 46.8 bits (106), Expect = 4e-05 Identities = 27/67 (40%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGG-XXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 G G G GGG GG GGG G GGGG G GG G GGG G Sbjct: 51 GFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFG 110 Query: 767 XXGXXGG 747 G GG Sbjct: 111 GGGSIGG 117 Score = 46.4 bits (105), Expect = 6e-05 Identities = 23/49 (46%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG-GGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GGG G G GGG G GG G GG Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGG 77 Score = 46.0 bits (104), Expect = 8e-05 Identities = 34/97 (35%), Positives = 36/97 (37%), Gaps = 5/97 (5%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG---GXGXGGGGXNVXRXA 786 G GGG G G GG GG GGG G G GG G G G G GGGG Sbjct: 39 GLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFG 98 Query: 785 XRXKIGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXV 675 G G GG + G G G L K + Sbjct: 99 GGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLVQKHI 135 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GGG GG GG G G GG G G GGGG Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGG 80 Score = 42.7 bits (96), Expect = 7e-04 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G GG GG G G GG G G GG GGGG Sbjct: 31 GSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGG 79 Score = 42.7 bits (96), Expect = 7e-04 Identities = 29/83 (34%), Positives = 30/83 (36%), Gaps = 3/83 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG---GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G G GGG GG G GG G GG G G GG G GG Sbjct: 37 GGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGG 96 Query: 779 XKIGXXGXXGGXVWLXGRMGTXG 711 G G GG G +G G Sbjct: 97 FGGGSGGGSGGGFGGGGSIGGFG 119 Score = 42.7 bits (96), Expect = 7e-04 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G G G GGG GG GGG GG G G GG G G Sbjct: 45 GGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGG 104 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMT 697 G G GG + G G G T Sbjct: 105 SGGGFGGGGSIGGFGGGGGGGGGTT 129 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 922 GXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGGG GG G G G GG G G G Sbjct: 20 GYNYNRPGGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGG 58 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 48.4 bits (110), Expect = 1e-05 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG GGGG G GG GGGG Sbjct: 38 GGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGG 85 Score = 46.8 bits (106), Expect = 4e-05 Identities = 23/43 (53%), Positives = 23/43 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GGGG GGG G GG G GG G G Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKH--GGGNGGG 77 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GGG GGGG G GG G GGG Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 46.0 bits (104), Expect = 8e-05 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG G GGG G GGGG GG GGGG Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGG 84 Score = 45.6 bits (103), Expect = 1e-04 Identities = 29/70 (41%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXX--GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GGG G GG GG GGG G GGGG G G G GGGG + Sbjct: 23 GGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGG----GGGGKHGGGGGGGGKHGGGNGGGG 78 Query: 776 KIGXXGXXGG 747 K G G GG Sbjct: 79 KHGGGGGGGG 88 Score = 45.2 bits (102), Expect = 1e-04 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG GGG GG GG G GGG G GG G GGGG Sbjct: 44 GQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGG 91 Score = 44.0 bits (99), Expect = 3e-04 Identities = 24/53 (45%), Positives = 24/53 (45%), Gaps = 5/53 (9%) Frame = -2 Query: 950 GXGGGXGXGGG-----XXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G G GG GGG G GGGG G GG G GGG Sbjct: 21 GGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGG 73 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG G GGG G GGGG G GG GGGG Sbjct: 55 GGGGKHGGGGGGGGKHGGGNGGGGKHGGGG-----GGGGGGGKHGGGG 97 Score = 42.3 bits (95), Expect = 0.001 Identities = 26/77 (33%), Positives = 27/77 (35%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXX 762 GG G GGG GG G G GG G GG GGGG G Sbjct: 21 GGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKH 80 Query: 761 GXXGGXVWLXGRMGTXG 711 G GG G+ G G Sbjct: 81 GGGGGGGGGGGKHGGGG 97 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/69 (33%), Positives = 23/69 (33%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GG GGG GG G G G GG G G Sbjct: 22 GGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHG 81 Query: 771 RGXGNXWGG 745 G G GG Sbjct: 82 GGGGGGGGG 90 Score = 36.7 bits (81), Expect = 0.047 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGG 820 G GGG GGG GG GG G G G G G GG Sbjct: 54 GGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGGG 97 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 161 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 203 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 221 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 263 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 231 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 290 Query: 770 GXXGXXGG 747 G G GG Sbjct: 291 GFKGGYGG 298 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 141 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 190 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 191 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 247 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 248 GGGFGPGIGGGGGGFGPGIGGG 269 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 59 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 116 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 117 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 175 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 176 GPGFGGGIGGGGGHSGGGGG 195 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 155 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 197 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 222 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 280 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 281 HKHKGHGGGGGFKGGYGGGGG 301 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 259 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 318 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 319 G-GGPGGGGSYGGGYGGGSGASA 340 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 184 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 228 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 161 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 219 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 220 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 279 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 280 SHKHKGHGGGGGFKGGYGGGGGGGGG 305 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 35 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 94 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 95 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 150 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 151 GGYSGGGGGIGGGGGHSGGG 170 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 195 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 254 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 255 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 311 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 312 IGPAVSLGGGPGGGGSYGGGYGGGSG 337 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 285 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 344 Query: 773 IGXXGXXGG 747 G GG Sbjct: 345 SASAGAGGG 353 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 32 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 91 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 92 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 140 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 141 GIGDGPGFGSGGYSGGGGGIGGGGGH 166 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 48.0 bits (109), Expect = 2e-05 Identities = 21/43 (48%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG G G G GG G GGG G GG + GG G G Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFG 189 Score = 47.2 bits (107), Expect = 3e-05 Identities = 22/43 (51%), Positives = 22/43 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G G G GG GGG G GG G GG G G Sbjct: 207 GGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFG 249 Score = 46.8 bits (106), Expect = 4e-05 Identities = 26/68 (38%), Positives = 27/68 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG G GGG G GGGG G G G GGG + Sbjct: 217 GGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGG 276 Query: 770 GXXGXXGG 747 G G GG Sbjct: 277 GFKGGYGG 284 Score = 46.0 bits (104), Expect = 8e-05 Identities = 43/142 (30%), Positives = 47/142 (33%), Gaps = 1/142 (0%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G G G G GGG G GGG G GG GGGG + Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHS---------- 176 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIK 591 G G GG G +G G A ++ G G G P Sbjct: 177 GGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHG-GGGFGPGGGGGGGFGPG-- 233 Query: 590 GXXXAXGTXXXGGGXG-GXGGG 528 G G GGG G G GGG Sbjct: 234 GGGFGPGIGGGGGGFGPGIGGG 255 Score = 45.2 bits (102), Expect = 1e-04 Identities = 42/140 (30%), Positives = 44/140 (31%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 GGG G GG GG G G G G GG G GG G GGG A I Sbjct: 45 GGGDG-GGKLGGGYGSGGHGSGGLGSGGFGSGGDLGLGGGGVGGGPF-AGGHAGGGVISG 102 Query: 764 XGXXGGXVWLXGRMG-TXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG G G G + + D G G I G Sbjct: 103 GGHSGGGGGFGGGPGFGSGGHSGGGIGD-GPGFGSGGYSGGGGGIGGGGGHSGGGSGIGG 161 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 G GGG G GGG Sbjct: 162 GPGFGGGIGGGGGHSGGGGG 181 Score = 44.8 bits (101), Expect = 2e-04 Identities = 21/43 (48%), Positives = 21/43 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGGG GG G GG G GGG GG G GG G G Sbjct: 141 GGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIG 183 Score = 44.8 bits (101), Expect = 2e-04 Identities = 30/81 (37%), Positives = 31/81 (38%), Gaps = 1/81 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXK 774 G GG G GGG G GGG G GGGG G GG G G GGG Sbjct: 208 GGHGGGGHGGGGFG-PGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGLS 266 Query: 773 IGXXGXXGGXVWLXGRMGTXG 711 G GG + G G G Sbjct: 267 HKHKGHGGGGGFKGGYGGGGG 287 Score = 44.4 bits (100), Expect = 2e-04 Identities = 29/83 (34%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G G G G GGG GG GG G GG GG G GGGG + Sbjct: 245 GGGFGPGIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSL 304 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G G GG + G G G A Sbjct: 305 G-GGPGGGGSYGGGYGGGSGASA 326 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G GG G GGG G G V GG G G G Sbjct: 170 GGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGG-GHGGGG 214 Score = 40.7 bits (91), Expect = 0.003 Identities = 42/146 (28%), Positives = 45/146 (30%), Gaps = 5/146 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG---GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG GG G G GGG G GGG G GG G GG G + Sbjct: 147 GGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGG-GIGGSGSSASSSVGV 205 Query: 779 XKIG-XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXX 603 G G GG + G G G +G G G Sbjct: 206 IGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPGIGGGGGGFGPGIGGGSGGGHFGGGL 265 Query: 602 P-SIKGXXXAXGTXXXGGGXGGXGGG 528 KG G GG GG GGG Sbjct: 266 SHKHKGHGGGGGFKGGYGGGGGGGGG 291 Score = 39.9 bits (89), Expect = 0.005 Identities = 35/140 (25%), Positives = 38/140 (27%), Gaps = 1/140 (0%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG- 768 GGG G GGG G GGG G G G G GG +G Sbjct: 21 GGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGDLGL 80 Query: 767 XXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXGQXRXGVXXXXXXXXXXXXXXXPSIKG 588 G GG + G G G G G P Sbjct: 81 GGGGVGGGPFAGGHAGGGVISG----GGHSGGGGGFGGGPGFGSGGHSGGGIGDGPGFGS 136 Query: 587 XXXAXGTXXXGGGXGGXGGG 528 + G GGG G GGG Sbjct: 137 GGYSGGGGGIGGGGGHSGGG 156 Score = 39.5 bits (88), Expect = 0.007 Identities = 40/146 (27%), Positives = 45/146 (30%), Gaps = 6/146 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGG G GGG G G G G GGGG Sbjct: 181 GIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFGPGGGGGGGFGPGGGGFGPG 240 Query: 773 IGXXGXXGGXVWLXGRMGTXGXRA*RNLXDKXVGXG-----QXRXGVXXXXXXXXXXXXX 609 IG G G + G G+ G L K G G + G Sbjct: 241 IGGGGGGFGP-GIGG--GSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYG 297 Query: 608 XXPSIKGXXXAXGTXXXGGGXGGXGG 531 P++ G GGG GG G Sbjct: 298 IGPAVSLGGGPGGGGSYGGGYGGGSG 323 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/69 (34%), Positives = 24/69 (34%), Gaps = 1/69 (1%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GG G G GGG G G G GG GG G A Sbjct: 271 GHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASA 330 Query: 773 IGXXGXXGG 747 G GG Sbjct: 331 SASAGAGGG 339 Score = 35.1 bits (77), Expect = 0.14 Identities = 40/146 (27%), Positives = 43/146 (29%), Gaps = 2/146 (1%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG G G G G G GG G D Sbjct: 18 GYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGGLGSGGFGSGGD 77 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXK 592 G G GG V G G G G G GGG + Sbjct: 78 LGLGG--GG--VGGGPFAGGHAGGGVISGGGHSGGGGGFGGGPGFGSGGHS-------GG 126 Query: 591 GXXXGPRY--XXXXXGGXGXGGGXGY 520 G GP + GG G GGG G+ Sbjct: 127 GIGDGPGFGSGGYSGGGGGIGGGGGH 152 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PPPP PPP PP P PPP P Sbjct: 525 PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP PPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PP P PPP P P PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 A V P P P P PPP PPP P PP PPPPP Sbjct: 495 ANGVAAPSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 38.3 bits (85), Expect = 0.015 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 P P PP PPPP PP PP PPP P PPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP--PPPMPGRAGGPPPPP 558 Score = 33.5 bits (73), Expect = 0.44 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P +P P P P A PPPP PP P PP P P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAG----GPPPP---PPPPGMGGPPPPPMPGMMRPG 578 Query: 892 XPPPXPPXXPPP 927 PP PP P Sbjct: 579 GGPPPPPMMMGP 590 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 46.8 bits (106), Expect = 4e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G GGG G G GG G GG G GGG N Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGN 702 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG GGG G GGGG G GG G GG G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRG----GGGGFGGRGGGGRGGGGFGGRG 689 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG G GGG G GG G G GG G GGG Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 934 GGXGGXGXGXXGGG--GXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G GGG G GGG G GG G GG G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRG 681 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PPPP PPP PP P PPP P Sbjct: 525 PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP PPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PP P PPP P P PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 A V P P P P PPP PPP P PP PPPPP Sbjct: 495 ANGVAAPSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 38.3 bits (85), Expect = 0.015 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 P P PP PPPP PP PP PPP P PPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP--PPPMPGRAGGPPPPP 558 Score = 33.5 bits (73), Expect = 0.44 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P +P P P P A PPPP PP P PP P P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAG----GPPPP---PPPPGMGGPPPPPMPGMMRPG 578 Query: 892 XPPPXPPXXPPP 927 PP PP P Sbjct: 579 GGPPPPPMMMGP 590 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 46.8 bits (106), Expect = 4e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G GGG G G GG G GG G GGG N Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGN 702 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG GGG G GGGG G GG G GG G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRG----GGGGFGGRGGGGRGGGGFGGRG 689 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG G GGG G GG G G GG G GGG Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 934 GGXGGXGXGXXGGG--GXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G GGG G GGG G GG G GG G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRG 681 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 47.6 bits (108), Expect = 3e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG G GGGG G GG G GG G Sbjct: 651 GRGGGGGFGGRGGGGRGGG-GGFGGRGGGGRGGGGFGGRGGRGGGGRG 697 Score = 46.8 bits (106), Expect = 4e-05 Identities = 23/50 (46%), Positives = 23/50 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG G GG G GGG G G GG G GG G GGG N Sbjct: 653 GGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGGGRGGGFGN 702 Score = 46.4 bits (105), Expect = 6e-05 Identities = 24/48 (50%), Positives = 24/48 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG GGG G GGGG G GG G GG G Sbjct: 646 GRGGGGRGGGGGFGGRGGGGRG----GGGGFGGRGGGGRGGGGFGGRG 689 Score = 46.4 bits (105), Expect = 6e-05 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG G GGG G GG G G GG G GGG Sbjct: 649 GGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRGGGGFGGRGGRGGG 694 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -3 Query: 934 GGXGGXGXGXXGGG--GXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G GGG G GGG G GG G GG G G G Sbjct: 637 GGFDNNQRGGRGGGGRGGGGGFGGRGGGGRGGGGGFGGRGGGGRG 681 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PPPP PPP PP P PPP P Sbjct: 525 PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP PPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PP P PPP P P PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 A V P P P P PPP PPP P PP PPPPP Sbjct: 495 ANGVAAPSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 38.3 bits (85), Expect = 0.015 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 P P PP PPPP PP PP PPP P PPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP--PPPMPGRAGGPPPPP 558 Score = 33.5 bits (73), Expect = 0.44 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P +P P P P A PPPP PP P PP P P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAG----GPPPP---PPPPGMGGPPPPPMPGMMRPG 578 Query: 892 XPPPXPPXXPPP 927 PP PP P Sbjct: 579 GGPPPPPMMMGP 590 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/48 (41%), Positives = 20/48 (41%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P PPPP PPP PP P PPP P Sbjct: 525 PPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 47.6 bits (108), Expect = 3e-05 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP PPP P P PPP P Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 42.7 bits (96), Expect = 7e-04 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PP P PPP P P PPPPP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 40.3 bits (90), Expect = 0.004 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 1/52 (1%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 A V P P P P PPP PPP P PP PPPPP Sbjct: 495 ANGVAAPSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPP 546 Score = 38.3 bits (85), Expect = 0.015 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 P P PP PPPP PP PP PPP P PPP P Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPP--PPPMPGRAGGPPPPP 558 Score = 33.5 bits (73), Expect = 0.44 Identities = 23/72 (31%), Positives = 24/72 (33%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P +P P P P A PPPP PP P PP P P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAG----GPPPP---PPPPGMGGPPPPPMPGMMRPG 578 Query: 892 XPPPXPPXXPPP 927 PP PP P Sbjct: 579 GGPPPPPMMMGP 590 >AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p protein. Length = 250 Score = 42.3 bits (95), Expect(2) = 3e-05 Identities = 30/83 (36%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG GGG G GGGG G G GGG V + Sbjct: 22 GGGGGGGYGGGGSSHGGGGDGGYSYGGGGG------GGSDHHGGGGGSPPVKVIKVIHET 75 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G GG W G G G A Sbjct: 76 APAGGSGG--WQSGGGGGSGWTA 96 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/139 (27%), Positives = 42/139 (30%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GGG G GGG GG GG G G G GG E G Sbjct: 20 GGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAG 79 Query: 765 XGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXKGX 586 W + G G G T G G GGG + IK ++ I G Sbjct: 80 GSGGW-------QSGGGGGSGWTAGGGGGHG-----GGGGGQEIKI-IKI-ISQQASSGG 125 Query: 585 XXGPRYXXXXXGGXGXGGG 529 G Y G G GG Sbjct: 126 HGGGGYGGSSGGYGGASGG 144 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG G GG G G GG GG GG GG G Sbjct: 124 GGHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGG 163 Score = 31.9 bits (69), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G G GG GGG GG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGG 108 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GG GG GG G GGG G GGGG + G Sbjct: 124 GGHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGGAEAVKIIKIISESNSGAGDS 183 Query: 746 XVWLXG 729 W G Sbjct: 184 GGWSSG 189 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 G G G GG GG GG G GG G GG Sbjct: 125 GHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGG 163 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = -1 Query: 933 GXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRGXGNX 754 G GGG GG GG GG G G GG G + + + G G+ Sbjct: 125 GHGGGGYGGSSGGYGGASG-GGWSSGGASSGGWSSGGGGGAEAVKIIKIISESNSGAGDS 183 Query: 753 WG 748 G Sbjct: 184 GG 185 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG------XXXXXXXGXGGXGXGGGG 807 G GG GGG G G G GGGG GG G GG G Sbjct: 79 GGSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYG 132 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG GGG G GG GG G G Sbjct: 80 GSGGWQSGGGGGSGWTAGGGGGHGGGGG 107 Score = 24.2 bits (50), Expect(2) = 3e-05 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 590 GXXXAXGTXXXGGGXGGXGGGXXM*XILIKS 498 G + T GGG GG GGG + I I S Sbjct: 88 GGGGSGWTAGGGGGHGGGGGGQEIKIIKIIS 118 >AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-PA protein. Length = 250 Score = 42.3 bits (95), Expect(2) = 3e-05 Identities = 30/83 (36%), Positives = 31/83 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GGG G GGG GGG G GGGG G G GGG V + Sbjct: 22 GGGGGGGYGGGGSSHGGGGDGGYSYGGGGG------GGSDHHGGGGGSPPVKVIKVIHET 75 Query: 770 GXXGXXGGXVWLXGRMGTXGXRA 702 G GG W G G G A Sbjct: 76 APAGGSGG--WQSGGGGGSGWTA 96 Score = 35.5 bits (78), Expect = 0.11 Identities = 38/139 (27%), Positives = 42/139 (30%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GGG G GGG GG GG G G G GG E G Sbjct: 20 GGGGGGGGGYGGGGSSHGGGGDGGYSYGGGGGGGSDHHGGGGGSPPVKVIKVIHETAPAG 79 Query: 765 XGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXKGX 586 W + G G G T G G GGG + IK ++ I G Sbjct: 80 GSGGW-------QSGGGGGSGWTAGGGGGHG-----GGGGGQEIKI-IKI-ISQQASSGG 125 Query: 585 XXGPRYXXXXXGGXGXGGG 529 G Y G G GG Sbjct: 126 HGGGGYGGSSGGYGGASGG 144 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG G GG G G GG GG GG GG G Sbjct: 124 GGHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGG 163 Score = 31.9 bits (69), Expect = 1.3 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G G GG GGG GG Sbjct: 87 GGGGGSGWTAGGGGGHGGGGGG 108 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/66 (27%), Positives = 19/66 (28%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXGG 747 GG GG GG G GGG G GGGG + G Sbjct: 124 GGHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGGAEAVKIIKIISESNSGAGDS 183 Query: 746 XVWLXG 729 W G Sbjct: 184 GGWSSG 189 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 G G G GG GG GG G GG G GG Sbjct: 125 GHGGGGYGGSSGGYGGASGGGWSSGGASSGGWSSGGGGG 163 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = -1 Query: 933 GXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRGXGNX 754 G GGG GG GG GG G G GG G + + + G G+ Sbjct: 125 GHGGGGYGGSSGGYGGASG-GGWSSGGASSGGWSSGGGGGAEAVKIIKIISESNSGAGDS 183 Query: 753 WG 748 G Sbjct: 184 GG 185 Score = 29.9 bits (64), Expect = 5.4 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG------XXXXXXXGXGGXGXGGGG 807 G GG GGG G G G GGGG GG G GG G Sbjct: 79 GGSGGWQSGGGGGSGWTAGGGGGHGGGGGGQEIKIIKIISQQASSGGHGGGGYG 132 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG GGG G GG GG G G Sbjct: 80 GSGGWQSGGGGGSGWTAGGGGGHGGGGG 107 Score = 24.2 bits (50), Expect(2) = 3e-05 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 590 GXXXAXGTXXXGGGXGGXGGGXXM*XILIKS 498 G + T GGG GG GGG + I I S Sbjct: 88 GGGGSGWTAGGGGGHGGGGGGQEIKIIKIIS 118 >X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. Length = 326 Score = 46.8 bits (106), Expect = 4e-05 Identities = 32/85 (37%), Positives = 32/85 (37%), Gaps = 3/85 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG G GG G G GGG G G GGG G GG GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 779 XKIGXXGXXGGXVWLXGRMGTXGXR 705 G G GG G MG R Sbjct: 302 GSWGGNGGGGGG-GQGGNMGGGNRR 325 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGSGGGPW 276 >X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP protein) protein. Length = 386 Score = 46.4 bits (105), Expect = 6e-05 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG G GG G G GGG G G GGG G GG GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 302 GSWGGNGGGGG 312 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 940 GGGGXGGXGXGXXGG--GGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G G GG GGG G GG G GG Sbjct: 288 GGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 327 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 39.5 bits (88), Expect = 0.007 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G GGG G GGG G GG G GGGG Sbjct: 270 GTGGGPWNNQGGGNGGWNGGGGGGGY---GGGNSNGSWGGNGGGGGGGGG 316 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGTGGGPW 276 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 G GG G GGG GG GGG G GG G GG G G Sbjct: 282 GNGGWNGGGGG--GGYGGGNSNGSWGGNGG------GGGGGGGFG 318 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G GG GGG G G G G G G G Sbjct: 269 GGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGG 314 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GG G GG G GG G G G G N Sbjct: 289 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNN 338 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 937 GGGXGGXGXGXXGGG-GXGGGXXGXGGXG 854 GGG GG G GGG G G GG G Sbjct: 346 GGGGGGFNKGNQGGGQGFAGNNYNTGGGG 374 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 46.4 bits (105), Expect = 6e-05 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG G GG G G GGG G G GGG G GG GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 302 GSWGGNGGGGG 312 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 940 GGGGXGGXGXGXXGG--GGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G G GG GGG G GG G GG Sbjct: 288 GGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 327 Score = 39.5 bits (88), Expect = 0.007 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G GGG G GGG G GG G GGGG Sbjct: 270 GTGGGPWNNQGGGNGGWNGGGGGGGY---GGGNSNGSWGGNGGGGGGGGG 316 Score = 38.7 bits (86), Expect = 0.012 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGTGGGPW 276 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 G GG G GGG GG GGG G GG G GG G G Sbjct: 282 GNGGWNGGGGG--GGYGGGNSNGSWGGNGG------GGGGGGGFG 318 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG GG G GG GGG G G G G G G G Sbjct: 269 GGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGGG 314 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GG G GG G GG G G G G N Sbjct: 289 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNN 338 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 937 GGGXGGXGXGXXGGG-GXGGGXXGXGGXG 854 GGG GG G GGG G G GG G Sbjct: 346 GGGGGGFNKGNQGGGQGFAGNNYNTGGGG 374 >X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. Length = 386 Score = 46.4 bits (105), Expect = 6e-05 Identities = 28/71 (39%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GGG G GG G G GGG G G GGG G GG GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSN 301 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 302 GSWGGNGGGGG 312 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/40 (50%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = -3 Query: 940 GGGGXGGXGXGXXGG--GGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G G GG GGG G GG G GG Sbjct: 288 GGGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 327 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 39.5 bits (88), Expect = 0.007 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G GGG G GGG G GG G GGGG Sbjct: 270 GSGGGPWNNQGGGNGGWNGGGGGGGY---GGGNSNGSWGGNGGGGGGGGG 316 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGSGGGPW 276 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG GG G G G GG G G G Sbjct: 269 GGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGGGGG 313 Score = 32.3 bits (70), Expect = 1.0 Identities = 20/45 (44%), Positives = 20/45 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 G GG G GGG GG GGG G GG G GG G G Sbjct: 282 GNGGWNGGGGG--GGYGGGNSNGSWGGNGG------GGGGGGGFG 318 Score = 30.7 bits (66), Expect = 3.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GG G GG G GG G G G G N Sbjct: 289 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGGGPQRNSNFGNN 338 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 937 GGGXGGXGXGXXGGG-GXGGGXXGXGGXG 854 GGG GG G GGG G G GG G Sbjct: 346 GGGGGGFNKGNQGGGQGFAGNNYNTGGGG 374 >AE014298-1193|AAF46385.1| 679|Drosophila melanogaster CG33181-PA protein. Length = 679 Score = 46.0 bits (104), Expect = 8e-05 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G G GG GGG G GG G Sbjct: 194 GGGGGGGGGGGGIGGAGGGGGGGGGNGGIG 223 Score = 44.4 bits (100), Expect = 2e-04 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G G G Sbjct: 196 GGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G G Sbjct: 194 GGGGGGGGGGGGIGGAGGGGGGGGGNGGIG 223 Score = 41.9 bits (94), Expect = 0.001 Identities = 18/29 (62%), Positives = 18/29 (62%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G G GG GGG G GG G Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGGGGGGGNG 220 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 951 GXGGGXGXGGGXXG-GXGGGXGGXXGXXGXG 862 G GGG G GGG G G GGG GG G G G Sbjct: 195 GGGGGGGGGGGIGGAGGGGGGGGGNGGIGSG 225 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/43 (46%), Positives = 20/43 (46%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG 816 G G GGG GG GGG G GGGG G GG G G Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGGG-----GGGNGGIGSG 225 Score = 35.5 bits (78), Expect = 0.11 Identities = 22/51 (43%), Positives = 22/51 (43%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG GG GGG G GGGG G GG G G G V A Sbjct: 188 GAVSGGGGGGGGGGGGGGIGGAGGGGG------GGGGNGGIGSGALVAADA 232 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GGG G GG G GG G G G Sbjct: 192 GGGGGGGGGGGGGGIGGAGGGGGGGGGNGGIG 223 >AY094783-1|AAM11136.1| 118|Drosophila melanogaster LD12750p protein. Length = 118 Score = 45.2 bits (102), Expect = 1e-04 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 G G G G G GGGG GGG G GG G GG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G GG GGG G GGGG G GG G GGG R R Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGG-----GGGGSGYRGGGLRPNRRIGR 103 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G GGG GG GGG GG G G G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G GGG GG GGG GG G G G Sbjct: 60 GSSSWGGGGGGGGGGGGGGGGGGGGGGGSG 89 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 920 GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GGGG G GG G GGGG Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 45.2 bits (102), Expect = 1e-04 Identities = 29/71 (40%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXG---XXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G G GGG GG GGG G GG G G GG G G GG NV Sbjct: 90 GGGYGGGYGGGHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGGYGSGG-NVKIIKVI 148 Query: 779 XKIGXXGXXGG 747 G G GG Sbjct: 149 SDAGSSGGYGG 159 Score = 43.6 bits (98), Expect = 4e-04 Identities = 27/80 (33%), Positives = 29/80 (36%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GG GGG G G GG G GG G GGGG K+ Sbjct: 23 GAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKV 82 Query: 770 GXXGXXGGXVWLXGRMGTXG 711 GG + G G G Sbjct: 83 ITDSGAGGGGYGGGYGGGHG 102 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXG--XGGXGXGGGG 807 G GGG G GGG GG GGG G G G G G G GGGG Sbjct: 87 GAGGG-GYGGGYGGGHGGGYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGG 135 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG--XGGXGXXXXXVXGGXGXGXXG 806 GGG G G GGG GGG G GG G GG G G G Sbjct: 21 GGGAGGSALSSGWSSGGG-GGGYSGGYSGGHGGGGGYGGGGYGGGGYG 67 Score = 32.3 bits (70), Expect = 1.0 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 9/57 (15%) Frame = -2 Query: 950 GXGGGXGXG--GGXXGGXGGGXXGXXXXGGGGXXXXXXX-------GXGGXGXGGGG 807 G GGG G G GG GG GGG GGGG G G GGG Sbjct: 104 GYGGGYGGGSSGGYSGGHGGGWSSGGGYGGGGYGSGGNVKIIKVISDAGSSGGYGGG 160 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GGGG G GG G GGG Sbjct: 20 GGGGAGGSALSSGWSSGGGGGGYSGGYSGGHGGGGGYGGG 59 >AE014298-1712|AAF48112.1| 118|Drosophila melanogaster CG1840-PA protein. Length = 118 Score = 45.2 bits (102), Expect = 1e-04 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG GGG G G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G G Sbjct: 65 GGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 G G G G G GGGG GGG G GG G GG Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGGSGYRGGG 94 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 938 GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G G G GG GGG G GGGG G GG G GGG R R Sbjct: 56 GNGWGSSSWGGGGGGGGGGGGGGGGGGG-----GGGGSGYRGGGLRPNRRIGR 103 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G GGG GG GGG GG G G G Sbjct: 58 GWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G GGG GG GGG GG G G G Sbjct: 60 GSSSWGGGGGGGGGGGGGGGGGGGGGGGSG 89 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -2 Query: 920 GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G GGGG G GG G GGGG Sbjct: 50 GDNSRRGNGWGSSSWGGGGGGGGGGGGGGGGGGGGGGG 87 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 45.2 bits (102), Expect = 1e-04 Identities = 31/84 (36%), Positives = 31/84 (36%), Gaps = 2/84 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXG-XGGGGXNVXRXAXRX 777 G GGG G GG G G GGG G GG G G G G GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNG 301 Query: 776 KIGXXGXXGGXVWLXGRMGTXGXR 705 G G GG G MG R Sbjct: 302 SWGGNGGGGGG-GQGGNMGGGNRR 324 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGSGGGPW 276 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 44.8 bits (101), Expect = 2e-04 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXG-XGGGGXNVXRXAXRX 777 G GGG G GG G G GGG G GG G G G G GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNG 301 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 302 SWGGNGGGGG 311 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G GGG G GGG G GG G GGGG Sbjct: 270 GSGGGPWNNQGGGNGGWNGGGGGGY----GGGNSNGSWGGNGGGGGGGGG 315 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG G G GG GGG G GG G GG Sbjct: 288 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 326 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGSGGGPW 276 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GG GG G G GG G G G GGGG Sbjct: 269 GGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGG 314 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 937 GGGXGGXGXGXXGGG-GXGGGXXGXGGXG 854 GGG GG G GGG G G GG G Sbjct: 345 GGGGGGFNKGNQGGGQGFAGNNYNTGGGG 373 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXX---PPPXPPXX---PPPXPXPPPXP 951 P P PP P PPPP P PPP P PPP P PPP P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-----PPPXXPXPX--PPXPPPPP 944 P P PP P PP P PPP P PPP P PP PPPPP Sbjct: 29 PQPAPPAPVKSYIPPPPPP--PPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 43.6 bits (98), Expect = 4e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP---PPXP 951 PPPP P PP P PPP PPP PP PPP P PP P Sbjct: 42 PPPPPPPPPAP--KNTYIPPPAAPAKAYIPPPPPP--PPPAPKNTYIPPAP 88 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXX---PPPXPPPPXXPXP--XPPXP 932 P P P P P PP P P P PPP PPPP P PP P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Query: 933 PP 938 P Sbjct: 89 AP 90 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPP---XXPPPXPXPPP 946 P PP P P P P PPP P PPP P PPP Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 35.9 bits (79), Expect = 0.082 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXP----IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 P P+ PP P P I A PPPP P PP P PP P Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP--KNTYIPPAPAP 90 Query: 880 XXPXXPPPXPPXXPPPXPXPP 942 P PP P P PP Sbjct: 91 VAP-VETYIPPAAPAPAYIPP 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPPPXXXXP 888 P P PP P P A + T PPP P PP P PPPP Sbjct: 33 PPAPVKSYIPPPPPPPP----PAPKNTYIPPPAAPAKAYIPPPP------PPPPPAPKNT 82 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 PP P P PP P Sbjct: 83 YIPPAPAPVAPVETYIPPAAP 103 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP--XPPXP 932 P A P P P PP P P P P PP P P PP P Sbjct: 60 PAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAP 112 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXP--PPXPXP 940 P PP P N P PP PPP P PP P P Sbjct: 47 PPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 44.8 bits (101), Expect = 2e-04 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PPP PPPP P P PP PP PP Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPP 94 Score = 43.6 bits (98), Expect = 4e-04 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP PPPP P P PP P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVPANP 100 Score = 42.7 bits (96), Expect = 7e-04 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PPPP P P PP PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXP---PPPP 944 P PP P PPP PPPP P P P PP P Sbjct: 75 PPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 38.7 bits (86), Expect = 0.012 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 831 PXTXXXXXPXPPXPXXPPPXPPPPXXP-XPXPPXPPPP 941 P P PP P PPP PPPP P P P PP Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPP 105 Score = 38.7 bits (86), Expect = 0.012 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P PP PPP PP PPP P P P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSP 93 Score = 38.3 bits (85), Expect = 0.015 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +1 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PPP PP PPP P PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPP 94 Score = 38.3 bits (85), Expect = 0.015 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP PPPP P PPP PP P PP P Sbjct: 73 PPPPPPPPP---------PPPP----PPPPPPSPPGVPANPVSLPPQP 107 Score = 35.1 bits (77), Expect = 0.14 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P PPP PP PPP P PP Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPP 94 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P P P PP P PP P PP P P P PP P Sbjct: 73 PPPPPPPPP-------PPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPP P P PP P P P P Sbjct: 76 PPPPPPPPPPP-----PPPPPSPPGVPANPVSLPP-QPVIVPLNPADP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PP P P P P P P Sbjct: 74 PPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQPVIVPLNP 114 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 44.8 bits (101), Expect = 2e-04 Identities = 27/70 (38%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-GXGGGXXGXXXXGGGGXXXXXXXGXGGXG-XGGGGXNVXRXAXRX 777 G GGG G GG G G GGG G GG G G G G GGGG Sbjct: 242 GGGGGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNG 301 Query: 776 KIGXXGXXGG 747 G G GG Sbjct: 302 SWGGNGGGGG 311 Score = 39.5 bits (88), Expect = 0.007 Identities = 25/67 (37%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGX-GXGGGGXNVXRXAXRXKIG 768 GGG G GG GG GG G GGGG GG G GGG G Sbjct: 200 GGGGGRGGPRAGGRGG--QGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGG 257 Query: 767 XXGXXGG 747 G GG Sbjct: 258 QGGGSGG 264 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G GGG G GGG G GG G GGGG Sbjct: 270 GSGGGPWNNQGGGNGGWNGGGGGGY----GGGNSNGSWGGNGGGGGGGGG 315 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG G G GG GGG G GG G GG Sbjct: 288 GGGGGGYGGGNSNGSWGGNGGGGGGGGGFGNEYQQSYGG 326 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/73 (31%), Positives = 24/73 (32%), Gaps = 2/73 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXG--GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRX 777 G GG G G G G GGG G GG G GG G GG + Sbjct: 204 GRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSG 263 Query: 776 KIGXXGXXGGXVW 738 G GG W Sbjct: 264 GWNQQGGSGGGPW 276 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GG GG G G GG G G G GGGG Sbjct: 269 GGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGGGGGG 314 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 1/29 (3%) Frame = -3 Query: 937 GGGXGGXGXGXXGGG-GXGGGXXGXGGXG 854 GGG GG G GGG G G GG G Sbjct: 345 GGGGGGFNKGNQGGGQGFAGNNYNTGGGG 373 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXX---PPPXPPPPXXPXPXPPXPPPP 941 P P PP P PP P PPP PPP PP PPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PPPP P PPP PP P PPP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 40.7 bits (91), Expect = 0.003 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPPP P P PPPP PPP P P PPP P Sbjct: 269 TTPPPPPPPMAPAAPPP----PPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P T P P P PPP PPP P PP PP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXP----PPXPPPPXXPXPXPPXPPPP 941 P + P P P PP P PP P PP PPPP P P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 >AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA protein. Length = 242 Score = 44.8 bits (101), Expect = 2e-04 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 1/83 (1%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXP-IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 L P P++ N P +P P + + + PPPP P PPPP Sbjct: 94 LPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPPPPPVVK 153 Query: 883 XPXXPPPXPPXXPPPXPXPPPXP 951 P P PP PP P Sbjct: 154 VNPPKPAYVPPPPPAVKVNPPKP 176 Score = 37.9 bits (84), Expect = 0.020 Identities = 21/74 (28%), Positives = 28/74 (37%), Gaps = 1/74 (1%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXP-IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 L P P++ N P +P P + + + + PPPP P PPPP Sbjct: 111 LPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPPPPPVVKVNPPKPAYVPPPPPAV- 169 Query: 883 XPXXPPPXPPXXPP 924 PP P PP Sbjct: 170 --KVNPPKPAYLPP 181 Score = 37.1 bits (82), Expect = 0.035 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 YL P V P P PP P PPP P P PPPPP Sbjct: 93 YLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPVVKVNPPKPSYLPPPPP 150 Score = 35.5 bits (78), Expect = 0.11 Identities = 25/76 (32%), Positives = 27/76 (35%), Gaps = 8/76 (10%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP-XXXXPXXP---PPXPPX 915 PP I + + PPPP P PPPP P P PP PP Sbjct: 75 PPATVKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPPPV 134 Query: 916 XP--PPXP--XPPPXP 951 PP P PPP P Sbjct: 135 VKVNPPKPSYLPPPPP 150 Score = 33.9 bits (74), Expect = 0.33 Identities = 23/71 (32%), Positives = 24/71 (33%), Gaps = 1/71 (1%) Frame = +1 Query: 742 TXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP 921 T PP + P P P PP P PP P P PPP P Sbjct: 67 TVPPPVYLPPATVKPEIPVVRTPKPAYLPPPPP--VIKVNPPKPAYLPP--PPPVVKVNP 122 Query: 922 P-PXPXPPPXP 951 P P PPP P Sbjct: 123 PKPAYLPPPPP 133 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 YL P V P P PP P PPP P P P P PP P Sbjct: 127 YLPPPPPVVKVNPPKPSYLPPPPPVVKVNPPKPAYVPPPPPAVKVNP-PKPAYLPPAP 183 Score = 31.1 bits (67), Expect = 2.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = +3 Query: 801 VXPXXPXPXPPXTXXXXXPXPPXPXXPPP---XPPPPXXPXPXPPXP---PPPP 944 V P P P P P PP PPPP PP P PPPP Sbjct: 79 VKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPPPVVKVNPPKPAYLPPPP 132 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/77 (23%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXP-IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 L P P++ N P +P P + + + PPPP P P P Sbjct: 128 LPPPPPVVKVNPPKPSYLPPPPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYLPPAPVVEQ 187 Query: 883 XPXXPPPXPPXXPPPXP 933 P P P P Sbjct: 188 PRYVAPAVVPAFKIPIP 204 Score = 29.5 bits (63), Expect = 7.1 Identities = 24/80 (30%), Positives = 24/80 (30%), Gaps = 6/80 (7%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXP---P 900 P PP IP F L PP P P PP P P Sbjct: 33 PGYNYDPPSIP----FELPTPAPAYLPPEPVTVREAPVTVPPPVYLPPATVKPEIPVVRT 88 Query: 901 PXPPXXPPPXP---XPPPXP 951 P P PPP P PP P Sbjct: 89 PKPAYLPPPPPVIKVNPPKP 108 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 44.8 bits (101), Expect = 2e-04 Identities = 22/51 (43%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXX---PPPXPPXX---PPPXPXPPPXP 951 P P PP P PPPP P PPP P PPP P PPP P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 Score = 43.6 bits (98), Expect = 4e-04 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 7/50 (14%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-----PPPXXPXPX--PPXPPPPP 944 P P PP P PP P PPP P PPP P PP PPPPP Sbjct: 29 PQPAPPAPVKSYIPPPPPP--PPPAPKNTYIPPPAAPAKAYIPPPPPPPP 76 Score = 43.6 bits (98), Expect = 4e-04 Identities = 23/51 (45%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP---PPXP 951 PPPP P PP P PPP PPP PP PPP P PP P Sbjct: 42 PPPPPPPPPAP--KNTYIPPPAAPAKAYIPPPPPP--PPPAPKNTYIPPAP 88 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/62 (35%), Positives = 22/62 (35%), Gaps = 5/62 (8%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXX---PPPXPPPPXXPXP--XPPXP 932 P P P P P PP P P P PPP PPPP P PP P Sbjct: 29 PQPAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAP 88 Query: 933 PP 938 P Sbjct: 89 AP 90 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPP---XXPPPXPXPPP 946 P PP P P P P PPP P PPP P PPP Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 35.9 bits (79), Expect = 0.082 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXP----IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 P P+ PP P P I A PPPP P PP P PP P Sbjct: 33 PPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP--KNTYIPPAPAP 90 Query: 880 XXPXXPPPXPPXXPPPXPXPP 942 P PP P P PP Sbjct: 91 VAP-VETYIPPAAPAPAYIPP 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/81 (32%), Positives = 27/81 (33%), Gaps = 4/81 (4%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPPPXXXXP 888 P P PP P P A + T PPP P PP P PPPP Sbjct: 33 PPAPVKSYIPPPPPPPP----PAPKNTYIPPPAAPAKAYIPPPP------PPPPPAPKNT 82 Query: 889 XXPPPXPPXXPPPXPXPPPXP 951 PP P P PP P Sbjct: 83 YIPPAPAPVAPVETYIPPAAP 103 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXP--XPPXP 932 P A P P P PP P P P P PP P P PP P Sbjct: 60 PAAPAKAYIPPPPPPPPPAPKNTYIPPAPAPVAPVETYIPPAAPAPAYIPPAP 112 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXP--PPXPXP 940 P PP P N P PP PPP P PP P P Sbjct: 47 PPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAPKNTYIPPAPAP 90 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 44.8 bits (101), Expect = 2e-04 Identities = 20/45 (44%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXX---PPPXPPPPXXPXPXPPXPPPP 941 P P PP P PP P PPP PPP PP PPPP Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PPPP P PPP PP P PPP P Sbjct: 255 PTRKPSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 40.7 bits (91), Expect = 0.003 Identities = 20/51 (39%), Positives = 20/51 (39%) Frame = +1 Query: 799 TXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPPP P P PPPP PPP P P PPP P Sbjct: 269 TTPPPPPPPMAPAAPPP----PPPPINGAAPPPPPPPMINGGALPPPPPPP 315 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P T P P P PPP PPP P PP PP Sbjct: 259 PSQPVGVSAKTTPPPPPPPMAPAAPPPPPPPINGAAPPPPPPP 301 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXP----PPXPPPPXXPXPXPPXPPPP 941 P + P P P PP P PP P PP PPPP P P P Sbjct: 271 PPPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPPPSMQMASRPRTPDP 328 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P P P PP PP PP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 43.6 bits (98), Expect = 4e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP P P P P P PPP P Sbjct: 52 PPPKPRPPPPP------PPPPTTTRPPTTTPTPTTTPTPITTPPPPP 92 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-XPPXXPPPXPXPPPXP 951 PP P P PP P PP P P P PPP PPP P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPP-PXPPPPXXPXPXPPXPP 935 S P+ P P P P P P PP PP P P P P PP Sbjct: 31 SYTPFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Query: 936 PPP 944 PPP Sbjct: 91 PPP 93 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPP--XPPPPXXPXPXPPXPPPP 941 P P P PP T P P P PPPP P PP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PP P P PP PPP PP Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPP 72 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P A P P P PP P P P P P P PP PPPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTR--PPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPP P PPP Sbjct: 41 PDNFPTPSAPAPPPKPRPPPPPPPPP 66 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P P P P PPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Score = 31.1 bits (67), Expect(2) = 0.51 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP- 888 P P P T PP P PPP P PP P P P P Sbjct: 59 PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVWYPLPIYGNAPQ 118 Query: 889 -XXPPPXPPXXPPPXPXPP 942 PP P PP Sbjct: 119 FGDPPGSHLLSNSGKPHPP 137 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P P PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPP 66 Score = 29.5 bits (63), Expect = 7.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTP---DTXP**PSXHPPPXLPXT 674 PPP P PP P T R P +TP T P P PPP P T Sbjct: 52 PPPKPRPPPPPPPPPTTTR-PPTTTPTPTTTPTPITTPPPPPPSAPPPPDPAT 103 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP---PPPXPXPPXPXXXXXXXPPPPXXX 882 P P P PP P P T P P P PP P PPPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPT-TTRPPTTTPTPTTTPTPITTPPPPPPSA---PPPPDPA 102 Query: 883 XPXXPPPXPPXXPPPXPXPPP 945 P P P P PP Sbjct: 103 TPGVWYPLPIYGNAPQFGDPP 123 Score = 21.0 bits (42), Expect(2) = 0.51 Identities = 8/21 (38%), Positives = 8/21 (38%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXP 591 P P P PPP P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPP 65 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P P P PP PP PP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 43.6 bits (98), Expect = 4e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP P P P P P PPP P Sbjct: 52 PPPKPRPPPPP------PPPPTTTRPPTTTPTPTTTPTPITTPPPPP 92 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-XPPXXPPPXPXPPPXP 951 PP P P PP P PP P P P PPP PPP P Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPP-PXPPPPXXPXPXPPXPP 935 S P+ P P P P P P PP PP P P P P PP Sbjct: 31 SYTPFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Query: 936 PPP 944 PPP Sbjct: 91 PPP 93 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPP--XPPPPXXPXPXPPXPPPP 941 P P P PP T P P P PPPP P PP P P Sbjct: 58 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PP P P PP PPP PP Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPP 72 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP PPP Sbjct: 53 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 98 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P A P P P PP P P P P P P PP PPPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTR--PPTTTPTPTTTPTPITTPPPPPPSAPPPP 99 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPP P PPP Sbjct: 41 PDNFPTPSAPAPPPKPRPPPPPPPPP 66 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P P P P PPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 90 Score = 31.1 bits (67), Expect(2) = 0.51 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP- 888 P P P T PP P PPP P PP P P P P Sbjct: 59 PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVWYPLPIYGNAPQ 118 Query: 889 -XXPPPXPPXXPPPXPXPP 942 PP P PP Sbjct: 119 FGDPPGSHLLSNSGKPHPP 137 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P P PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPP 66 Score = 29.5 bits (63), Expect = 7.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTP---DTXP**PSXHPPPXLPXT 674 PPP P PP P T R P +TP T P P PPP P T Sbjct: 52 PPPKPRPPPPPPPPPTTTR-PPTTTPTPTTTPTPITTPPPPPPSAPPPPDPAT 103 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP---PPPXPXPPXPXXXXXXXPPPPXXX 882 P P P PP P P T P P P PP P PPPP Sbjct: 47 PSAPAPPPKPRPPPPPPPPPT-TTRPPTTTPTPTTTPTPITTPPPPPPSA---PPPPDPA 102 Query: 883 XPXXPPPXPPXXPPPXPXPPP 945 P P P P PP Sbjct: 103 TPGVWYPLPIYGNAPQFGDPP 123 Score = 21.0 bits (42), Expect(2) = 0.51 Identities = 8/21 (38%), Positives = 8/21 (38%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXP 591 P P P PPP P P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPP 65 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/102 (31%), Positives = 34/102 (33%), Gaps = 14/102 (13%) Frame = +1 Query: 682 LSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXX 852 +S HA+ VP P Q PP P L PPPP PP P Sbjct: 306 MSLGMEHAMAAYVPAPPGTQAPPPMPP-----PLMPWMSAPQPPPPATEPLNPPIPGTLP 360 Query: 853 XXXPPPPXXXXPXXPP-----------PXPPXXPPPXPXPPP 945 PPPP P PP P PPP PPP Sbjct: 361 PLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 402 Score = 37.9 bits (84), Expect = 0.020 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P L P P P + PP P PP PPPP PP PPPP Sbjct: 360 PPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPP--PPCAPPPPALSLSQPPPPPPP 415 Score = 36.3 bits (80), Expect = 0.062 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPP PPP P P PPPP Sbjct: 319 PAPPGTQAPPPM-PPPLMPWMSAPQPPPP 346 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXX-PXXPPPXPPXXPPPX-PXPPPXP 951 PPP P P P PPP P P PP PPP PP P Sbjct: 327 PPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMP 375 Score = 35.1 bits (77), Expect = 0.14 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = +1 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXX 879 A P P +P T PP IP P T PP PP PPPP Sbjct: 347 ATEPLNPPIPG--TLPPLIPPPP--------GTSAPPMPPWGGGAYSGWGGGYAPPPPP- 395 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 P PPP P P PPP Sbjct: 396 --PCAPPPPALSLSQPPPPPPP 415 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P P PP P PP PPPP Sbjct: 328 PPMPPPLMPWMSAPQPPPPATEPLNPP---IPGTLPPLIPPPP 367 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP T P P PP PPPP PP PP Sbjct: 341 PQPPPPATEPLNPPIPGT--LPPLIPPPPG--TSAPPMPP 376 Score = 29.1 bits (62), Expect = 9.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPP 943 P PP PPP P P P PP Sbjct: 322 PGTQAPPPMPPPLMPWMSAPQPPPP 346 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/102 (31%), Positives = 34/102 (33%), Gaps = 14/102 (13%) Frame = +1 Query: 682 LSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXX 852 +S HA+ VP P Q PP P L PPPP PP P Sbjct: 111 MSLGMEHAMAAYVPAPPGTQAPPPMPP-----PLMPWMSAPQPPPPATEPLNPPIPGTLP 165 Query: 853 XXXPPPPXXXXPXXPP-----------PXPPXXPPPXPXPPP 945 PPPP P PP P PPP PPP Sbjct: 166 PLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 207 Score = 37.9 bits (84), Expect = 0.020 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P L P P P + PP P PP PPPP PP PPPP Sbjct: 165 PPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPP--PPCAPPPPALSLSQPPPPPPP 220 Score = 36.3 bits (80), Expect = 0.062 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPP PPP P P PPPP Sbjct: 124 PAPPGTQAPPPM-PPPLMPWMSAPQPPPP 151 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXX-PXXPPPXPPXXPPPX-PXPPPXP 951 PPP P P P PPP P P PP PPP PP P Sbjct: 132 PPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMP 180 Score = 35.1 bits (77), Expect = 0.14 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = +1 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXX 879 A P P +P T PP IP P T PP PP PPPP Sbjct: 152 ATEPLNPPIPG--TLPPLIPPPP--------GTSAPPMPPWGGGAYSGWGGGYAPPPPP- 200 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 P PPP P P PPP Sbjct: 201 --PCAPPPPALSLSQPPPPPPP 220 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P P PP P PP PPPP Sbjct: 133 PPMPPPLMPWMSAPQPPPPATEPLNPP---IPGTLPPLIPPPP 172 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP T P P PP PPPP PP PP Sbjct: 146 PQPPPPATEPLNPPIPGT--LPPLIPPPPG--TSAPPMPP 181 Score = 29.1 bits (62), Expect = 9.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPP 943 P PP PPP P P P PP Sbjct: 127 PGTQAPPPMPPPLMPWMSAPQPPPP 151 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 44.4 bits (100), Expect = 2e-04 Identities = 32/102 (31%), Positives = 34/102 (33%), Gaps = 14/102 (13%) Frame = +1 Query: 682 LSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP---XPPXPXXXX 852 +S HA+ VP P Q PP P L PPPP PP P Sbjct: 676 MSLGMEHAMAAYVPAPPGTQAPPPMPP-----PLMPWMSAPQPPPPATEPLNPPIPGTLP 730 Query: 853 XXXPPPPXXXXPXXPP-----------PXPPXXPPPXPXPPP 945 PPPP P PP P PPP PPP Sbjct: 731 PLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 772 Score = 37.9 bits (84), Expect = 0.020 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P L P P P + PP P PP PPPP PP PPPP Sbjct: 730 PPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPP--PPCAPPPPALSLSQPPPPPPP 785 Score = 36.3 bits (80), Expect = 0.062 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP PPP PPP P P PPPP Sbjct: 689 PAPPGTQAPPPM-PPPLMPWMSAPQPPPP 716 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXX-PXXPPPXPPXXPPPX-PXPPPXP 951 PPP P P P PPP P P PP PPP PP P Sbjct: 697 PPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMP 745 Score = 35.1 bits (77), Expect = 0.14 Identities = 28/82 (34%), Positives = 29/82 (35%), Gaps = 1/82 (1%) Frame = +1 Query: 703 ALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXX 879 A P P +P T PP IP P T PP PP PPPP Sbjct: 717 ATEPLNPPIPG--TLPPLIPPPP--------GTSAPPMPPWGGGAYSGWGGGYAPPPPP- 765 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 P PPP P P PPP Sbjct: 766 --PCAPPPPALSLSQPPPPPPP 785 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P P PP P PP PPPP Sbjct: 698 PPMPPPLMPWMSAPQPPPPATEPLNPP---IPGTLPPLIPPPP 737 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP T P P PP PPPP PP PP Sbjct: 711 PQPPPPATEPLNPPIPGT--LPPLIPPPPG--TSAPPMPP 746 Score = 29.1 bits (62), Expect = 9.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPP 943 P PP PPP P P P PP Sbjct: 692 PGTQAPPPMPPPLMPWMSAPQPPPP 716 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 44.4 bits (100), Expect = 2e-04 Identities = 41/158 (25%), Positives = 45/158 (28%), Gaps = 12/158 (7%) Frame = +1 Query: 508 KIXYIXXPPPX-------PPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXC 666 K+ Y PPP PP PPP V P + Sbjct: 162 KVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPP--PPTKKVVYTPPPPPPPPKKVVYT 219 Query: 667 PXPTX-LSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPX 843 P PT L H P V + P P + PPP PP Sbjct: 220 PPPTGILKDDGYHYGQPSVKF----EVSAPPAPKVEYLPPPTKKVVIAPPPVYVPPPTKK 275 Query: 844 XXXXXXPPPPXXXXPXXPPPXPP----XXPPPXPXPPP 945 PPPP PPP PP PP P PPP Sbjct: 276 VIYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 313 Score = 43.2 bits (97), Expect = 5e-04 Identities = 27/82 (32%), Positives = 30/82 (36%), Gaps = 4/82 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P V LP T I P++ + PPP P P PPPP Sbjct: 135 PKVEYLPP-PTKKVVIAPPPVYVPPPTKKVVYTPPPPP--PTKKVVYTPPPPPPTKKVVY 191 Query: 892 XPPPXPP----XXPPPXPXPPP 945 PPP PP PP P PPP Sbjct: 192 TPPPPPPTKKVVYTPPPPPPPP 213 Score = 40.7 bits (91), Expect = 0.003 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP PPPP PPP PP PPP P Sbjct: 151 PPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPP 198 Score = 39.1 bits (87), Expect = 0.009 Identities = 24/78 (30%), Positives = 27/78 (34%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P V LP T I P++ + PPP P P PPPP Sbjct: 248 PKVEYLPP-PTKKVVIAPPPVYVPPPTKKVIYTPPPPP--PTKKVVYTPPPPPPTKKVVY 304 Query: 892 XPPPXPPXXPPPXPXPPP 945 PPP PP PPP Sbjct: 305 TPPPPPPPPKKVVYTPPP 322 Score = 37.5 bits (83), Expect = 0.027 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P V P PP T PP P P PPP P PPPPP Sbjct: 354 PPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 36.7 bits (81), Expect = 0.047 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 6/57 (10%) Frame = +1 Query: 799 TXXPPPPX------PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 T PPPP P PP P PPPP P PP PP P P Sbjct: 166 TPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 222 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-----PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P P P PPP PPP PP PPP P Sbjct: 133 PPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTKKVVYTPPPPPP 185 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPP--PXPPPPXXPXPXPPXPPP 938 P P PP P PP P PPPP P PPP Sbjct: 180 PPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPPKKVVYTPPP 222 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP PP PPPP PP P P PPP Sbjct: 365 PPVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPX-PPPPXXPXPXPPXPPPP 941 P PP P PPP PPP P PPPP Sbjct: 132 PPPPKVEYLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPPPP 172 Score = 31.1 bits (67), Expect = 2.3 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 9/55 (16%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXX--PPPX-------PXPPPXP 951 PP P PPP PPP PP PPP P PPP P Sbjct: 354 PPPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPPPVYIPPPTKKVVVYTPPPPPPP 408 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 44.4 bits (100), Expect = 2e-04 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 PPPP P PP P P P PP PP PP P P Sbjct: 40 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Score = 43.6 bits (98), Expect = 4e-04 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PP P PPPP P P P P P PPP P Sbjct: 34 PPPKPRPPPP------PPPPPTTTRPPTTTPTPTTTPTPITTPPPPP 74 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-XPPXXPPPXPXPPPXP 951 PP P P PP P PP P P P PPP PPP P Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/63 (33%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPP-PXPPPPXXPXPXPPXPP 935 S P+ P P P P P P PP PP P P P P PP Sbjct: 13 SYTPFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 72 Query: 936 PPP 944 PPP Sbjct: 73 PPP 75 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPP--XPPPPXXPXPXPPXPPPP 941 P P P PP T P P P PPPP P PP P P Sbjct: 40 PPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PP P P PP PPP PP Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPP 54 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP PPP Sbjct: 35 PPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPP 80 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P A P P P PP P P P P P P PP PPPP Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTR--PPTTTPTPTTTPTPITTPPPPPPSAPPPP 81 Score = 32.3 bits (70), Expect = 1.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPP P PPP Sbjct: 23 PDNFPTPSAPAPPPKPRPPPPPPPPP 48 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P P P P PPP Sbjct: 29 PSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPP 72 Score = 31.1 bits (67), Expect = 2.3 Identities = 22/79 (27%), Positives = 22/79 (27%), Gaps = 2/79 (2%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP- 888 P P P T PP P PPP P PP P P P P Sbjct: 41 PPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATPGVWYPLPIYGNAPQ 100 Query: 889 -XXPPPXPPXXPPPXPXPP 942 PP P PP Sbjct: 101 FGDPPGSHLLSNSGKPHPP 119 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P P PPP P Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPP 48 Score = 29.5 bits (63), Expect = 7.1 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 3/53 (5%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTP---DTXP**PSXHPPPXLPXT 674 PPP P PP P T R P +TP T P P PPP P T Sbjct: 34 PPPKPRPPPPPPPPPTTTR-PPTTTPTPTTTPTPITTPPPPPPSAPPPPDPAT 85 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 3/81 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXP---PPPXPXPPXPXXXXXXXPPPPXXX 882 P P P PP P P T P P P PP P PPPP Sbjct: 29 PSAPAPPPKPRPPPPPPPPPT-TTRPPTTTPTPTTTPTPITTPPPPPPSA---PPPPDPA 84 Query: 883 XPXXPPPXPPXXPPPXPXPPP 945 P P P P PP Sbjct: 85 TPGVWYPLPIYGNAPQFGDPP 105 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPX----PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 PPPP P PP P PPPP PPP PPP P PPP P Sbjct: 437 PPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP-----XPPPPP 944 P P PP P PP PP PPP P PP PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPXPX-----PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPX---PPPXP 951 PPPP P PP P PPPP PPP PPP P PP P Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 38.3 bits (85), Expect = 0.015 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PPPP P PPPPP Sbjct: 643 PGPPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P P P P P P PPP PP P Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 36.7 bits (81), Expect = 0.047 Identities = 25/85 (29%), Positives = 27/85 (31%), Gaps = 5/85 (5%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAX-RXTXXPPPPXPXPPXPXXXXXXXPPPP----X 876 P + P Q PP P + PPPP P P PPPP Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQH 176 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP PPP P P P Sbjct: 177 RPAPQYGPPKLQYGPPPPPQLLPSP 201 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 808 PPPPXPXPPX---PXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P P P PP PP P P PPP P Sbjct: 609 PPPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPP 659 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P PPP P P P PPPP Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP---XPPPP 941 P P PP P P PPP P P P P PPPP Sbjct: 457 PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P P PP P PP PP PPP P Sbjct: 626 PAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP P PP P PPPP P P P Sbjct: 643 PGPPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 32.7 bits (71), Expect = 0.76 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP PPP PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPP 462 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P PP P PPPP PP PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYG---PPPPPPSGNYGPPPPP 472 Score = 31.1 bits (67), Expect = 2.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXP----XPPP 946 P PP N P P PP PPP PPP P PPP Sbjct: 436 PPPPPSGN---YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPP 480 Score = 29.5 bits (63), Expect = 7.1 Identities = 25/80 (31%), Positives = 26/80 (32%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P L Q P P P F + PP P P PP P PPPP Sbjct: 614 PSAPQLSLQQQLPAPQPG-PAF---VHQKQFGPPGPPP-PPEPQ----YLPPPPPLANVR 664 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 P PP P P P Sbjct: 665 PLGPPPPPTQQYLPAAPSGP 684 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXP-PXXPPPXPXPPP 946 P P P PPP P P PP P P P Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 11/85 (12%) Frame = +1 Query: 730 PXNQTXPPX---IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP--------PPX 876 P Q PP I P + PPPP P P P PP Sbjct: 162 PPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLPSPHAAPLFKPAHQPATSYGPPA 221 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 PP PPP PPP P Sbjct: 222 SGPLNLPPKQIFDAPPPNYGPPPLP 246 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 44.0 bits (99), Expect = 3e-04 Identities = 23/56 (41%), Positives = 23/56 (41%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPX----PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP----XPPPXP 951 PPPP P PP P PPPP PPP PPP P PPP P Sbjct: 437 PPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP-----XPPPPP 944 P P PP P PP PP PPP P PP PPPPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPP 482 Score = 40.3 bits (90), Expect = 0.004 Identities = 22/56 (39%), Positives = 22/56 (39%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPXPX-----PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPX---PPPXP 951 PPPP P PP P PPPP PPP PPP P PP P Sbjct: 446 PPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 38.3 bits (85), Expect = 0.015 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PPPP P PPPPP Sbjct: 643 PGPPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P P P P P P PPP PP P Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 36.7 bits (81), Expect = 0.047 Identities = 25/85 (29%), Positives = 27/85 (31%), Gaps = 5/85 (5%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAX-RXTXXPPPPXPXPPXPXXXXXXXPPPP----X 876 P + P Q PP P + PPPP P P PPPP Sbjct: 117 PHIQHKPAQQYGPPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPPLKIQH 176 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP PPP P P P Sbjct: 177 RPAPQYGPPKLQYGPPPPPQLLPSP 201 Score = 35.1 bits (77), Expect = 0.14 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 3/51 (5%) Frame = +1 Query: 808 PPPPXPXPPX---PXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P P P P PP PP P P PPP P Sbjct: 609 PPPPPPSAPQLSLQQQLPAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPP 659 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P PPP P P P PPPP Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAPQYGPPPTQYGPPPP 171 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 3/45 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP---XPPPP 941 P P PP P P PPP P P P P PPPP Sbjct: 457 PPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P P PP P PP PP PPP P Sbjct: 626 PAPQPGPAFVHQKQFGPPGPPPPPEPQYLPPPPPLANVRPLGPPPPP 672 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP P PP P PPPP P P P Sbjct: 643 PGPPPPPEPQYLPPPPPLANVRPLGPPPPPTQQYLPAAPSGP 684 Score = 32.7 bits (71), Expect = 0.76 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPPP PPP PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPP 462 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P PP P PPPP PP PP P PPP Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYG---PPPPPPSGNYGPPPPP 472 Score = 31.1 bits (67), Expect = 2.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXP----XPPP 946 P PP N P P PP PPP PPP P PPP Sbjct: 436 PPPPPSGN---YGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPP 480 Score = 29.5 bits (63), Expect = 7.1 Identities = 25/80 (31%), Positives = 26/80 (32%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPX 891 P P L Q P P P F + PP P P PP P PPPP Sbjct: 614 PSAPQLSLQQQLPAPQPG-PAF---VHQKQFGPPGPPP-PPEPQ----YLPPPPPLANVR 664 Query: 892 XPPPXPPXXPPPXPXPPPXP 951 P PP P P P Sbjct: 665 PLGPPPPPTQQYLPAAPSGP 684 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 1/29 (3%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXP-PXXPPPXPXPPP 946 P P P PPP P P PP P P P Sbjct: 129 PPPPKPAPQYGPPPQPAPQYGPPPPKPAP 157 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/85 (28%), Positives = 25/85 (29%), Gaps = 11/85 (12%) Frame = +1 Query: 730 PXNQTXPPX---IPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPP--------PPX 876 P Q PP I P + PPPP P P P PP Sbjct: 162 PPTQYGPPPPLKIQHRPAPQYGPPKLQYGPPPPPQLLPSPHAAPLFKPAHQPATSYGPPA 221 Query: 877 XXXPXXPPPXPPXXPPPXPXPPPXP 951 PP PPP PPP P Sbjct: 222 SGPLNLPPKQIFDAPPPNYGPPPLP 246 >AY121649-1|AAM51976.1| 950|Drosophila melanogaster LD23647p protein. Length = 950 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GGG G GG G Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGGGVGSGGSG 446 Score = 38.3 bits (85), Expect = 0.015 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GGG G G GGG G GG GGGG V R Sbjct: 24 GVGGGGGGGGGGMYSSNYGGGGSGANFGGGGNTSGRGGYGGT-FGGGGYGVNR 75 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G GG G G GG G G G Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGGGVGSGGSG 446 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GGG GG GGG G GGGG G GG G G Sbjct: 417 GGGGGGGGRSGGGGGGGAG----GGGGV------GSGGSGWEAG 450 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -2 Query: 908 GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGGG G GG G GG G + A K Sbjct: 417 GGGGGGGGRSGGGGGGGAG----GGGGVGSGGSGWEAGQRAFNSK 457 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GGG GG G GG G G GGG Sbjct: 43 GGGSGANFGGGGNTSGRGGYGGTFGGGGYGVNRNTSPDGGNFSRGGG 89 Score = 29.9 bits (64), Expect = 5.4 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGGXNVXRXAXRXKIG 768 G G G G G GGG GGGG G G G GGGG R G Sbjct: 12 GIGQRRGMGSSSGVGGGG----GGGGGGMYSSNYGGGGSGANFGGGGNTSGRGGYGGTFG 67 Query: 767 XXG 759 G Sbjct: 68 GGG 70 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G GGG G GGG GG G G Sbjct: 411 GYQSNSGGGGGGGGRSGGGGGGGAGGGG 438 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG G GGG GGGG G G G G GG Sbjct: 44 GGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGG 91 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGG 807 G GG G GG GG GGG GGGG G G G GGGG Sbjct: 45 GNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-----GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G G GGG G G G GG G GGGG Sbjct: 50 GGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGG 102 Score = 33.9 bits (74), Expect = 0.33 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 G G G G GG GGG GGGG GG G GGG V G Sbjct: 36 GQGPGVYTGGNGGRGGGGGYNAGGGGGGYY------NGGGGGGGGRRPVYSGNFGPGYGN 89 Query: 764 XGXXGG 747 G GG Sbjct: 90 GGGGGG 95 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG----GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG G G GGG G GG G GG Sbjct: 59 GGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GGG GG G G GGGG G Sbjct: 88 GNGGGGGGGGYGGGGGGGYDDG 109 Score = 29.1 bits (62), Expect = 9.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG G G GG G GGG GG G GG G G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGY-NAGGGGGGYYNGGGGGGGG 74 >AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p protein. Length = 335 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARG 53 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GG G GGG G G G Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGGGSGARGYG 55 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG G GGG GG G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSG 50 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GG GGG G GGGG G G G GG G Sbjct: 17 GFLGLLGGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHG 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG GGG G GGG G G G G Sbjct: 29 GGGGGLNLGGGGGNGGGGGGSGARGYGGHG 58 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GG GG G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARG 53 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 GGG GG GG G GGG G GG G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG G G G G G Sbjct: 37 GGGGGNGGGGGGSGARGYGGHGPSG 61 >AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 protein. Length = 148 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GGGG G G G G G Sbjct: 51 GGGGGGGGGGSGGGGGGGSGSGDGGGGAIG 80 Score = 35.9 bits (79), Expect = 0.082 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG G G GG G Sbjct: 54 GGGGGGGSGGGGGGGSGSGDGGGGAIGG 81 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG GGG G G G Sbjct: 51 GGGGGGG-GGGSGGGGGGGSGSGDGGGG 77 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGGG G G G G G GG GG Sbjct: 54 GGGGGGGSGGGGGGGSGSGDGGGGAIGG 81 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 G G GGGG GGG G G G GG Sbjct: 52 GGGGGGGGGSGGGGGGGSGSGDGGGGAIGG 81 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GGG G GG G GG G Sbjct: 52 GGGGGGGGGSGGGGGGGSGSGDGGGGAIG 80 Score = 29.5 bits (63), Expect = 7.1 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GGG G GGGG G GG G GG Sbjct: 51 GGGGGGGGGGSGGGGGG---GSGSGDGGGGAIGG 81 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GGGG GGG GG G GG G Sbjct: 51 GGGGGGGGGGSGGGGGGGSGSGDGGGG 77 >AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA protein. Length = 376 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARG 53 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GG G GGG G G G Sbjct: 26 GGGGGGGGLNLGGGGGNGGGGGGSGARGYG 55 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG G GGG GG G G Sbjct: 23 GGGGGGGGGGGLNLGGGGGNGGGGGGSG 50 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G GG GGG G GGGG G G G GG G Sbjct: 17 GFLGLLGGGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHG 58 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG GGG G GGG G G G G Sbjct: 29 GGGGGLNLGGGGGNGGGGGGSGARGYGGHG 58 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GG GG G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARG 53 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 GGG GG GG G GGG G GG G G Sbjct: 24 GGGGGGGGGGLNLGGGGGNGGGGGGSGARGYGGHGPSG 61 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG G G G G G Sbjct: 37 GGGGGNGGGGGGSGARGYGGHGPSG 61 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 43.6 bits (98), Expect = 4e-04 Identities = 21/48 (43%), Positives = 21/48 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG G GGG GGGG G G G G GG Sbjct: 44 GGNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGG 91 Score = 41.9 bits (94), Expect = 0.001 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGG 807 G GG G GG GG GGG GGGG G G G GGGG Sbjct: 45 GNGGRGGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGG 93 Score = 38.7 bits (86), Expect = 0.012 Identities = 22/53 (41%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-----GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG G G GGG G G G GG G GGGG Sbjct: 50 GGGGGYNAGGGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGG 102 Score = 33.9 bits (74), Expect = 0.33 Identities = 24/66 (36%), Positives = 24/66 (36%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGX 765 G G G G GG GGG GGGG GG G GGG V G Sbjct: 36 GQGPGVYTGGNGGRGGGGGYNAGGGGGGYY------NGGGGGGGGRRPVYSGNFGPGYGN 89 Query: 764 XGXXGG 747 G GG Sbjct: 90 GGGGGG 95 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG----GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GGG GG G G GGG G GG G GG Sbjct: 59 GGGGGYYNGGGGGGGGRRPVYSGNFGPGYGNGGGGGGGGYGGGGGGGYDDGG 110 Score = 32.3 bits (70), Expect = 1.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GGG GG G G GGGG G Sbjct: 88 GNGGGGGGGGYGGGGGGGYDDG 109 Score = 29.1 bits (62), Expect = 9.4 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG G G GG G GGG GG G GG G G Sbjct: 35 GGQGPGVYTGGNGGRGGGGGY-NAGGGGGGYYNGGGGGGGG 74 >AE014134-2238|AAF53220.2| 950|Drosophila melanogaster CG5787-PA protein. Length = 950 Score = 43.6 bits (98), Expect = 4e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GGG G GG G Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGGGVGSGGSG 446 Score = 38.3 bits (85), Expect = 0.015 Identities = 22/53 (41%), Positives = 22/53 (41%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXR 792 G GGG G GGG G G GGG G GG GGGG V R Sbjct: 24 GVGGGGGGGGGGMYSSNYGGGGSGANFGGGGNTSGRGGYGGT-FGGGGYGVNR 75 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G GG G G GG G G G Sbjct: 417 GGGGGGGGRSGGGGGGGAGGGGGVGSGGSG 446 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG G GGG GG GGG G GGGG G GG G G Sbjct: 417 GGGGGGGGRSGGGGGGGAG----GGGGV------GSGGSGWEAG 450 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/45 (40%), Positives = 19/45 (42%) Frame = -2 Query: 908 GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG G GGGG G GG G GG G + A K Sbjct: 417 GGGGGGGGRSGGGGGGGAG----GGGGVGSGGSGWEAGQRAFNSK 457 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G G G GGG GG G GG G G GGG Sbjct: 43 GGGSGANFGGGGNTSGRGGYGGTFGGGGYGVNRNTSPDGGNFSRGGG 89 Score = 29.9 bits (64), Expect = 5.4 Identities = 22/63 (34%), Positives = 22/63 (34%), Gaps = 1/63 (1%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG-GXGXGGGGXNVXRXAXRXKIG 768 G G G G G GGG GGGG G G G GGGG R G Sbjct: 12 GIGQRRGMGSSSGVGGGG----GGGGGGMYSSNYGGGGSGANFGGGGNTSGRGGYGGTFG 67 Query: 767 XXG 759 G Sbjct: 68 GGG 70 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G GGG G GGG GG G G Sbjct: 411 GYQSNSGGGGGGGGRSGGGGGGGAGGGG 438 >BT025138-1|ABE73309.1| 175|Drosophila melanogaster IP06825p protein. Length = 175 Score = 43.2 bits (97), Expect = 5e-04 Identities = 26/86 (30%), Positives = 30/86 (34%), Gaps = 6/86 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP------PXPXXXXXXXPPPP 873 P +P + + T PP P P + T PPPP P P PPPP Sbjct: 47 PEIPFVITSTTEPP--PPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 104 Query: 874 XXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 105 PTTTTTTTTPAPTPAPTYLPPPPPPP 130 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP PPPP Sbjct: 91 PAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPP 130 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 P P P PPPP P P P P PPP P Sbjct: 45 PKPEIPFVITSTTEPPPPPPTYLP--PKPVPTYLPPPPP 81 Score = 29.5 bits (63), Expect(2) = 0.062 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 9/65 (13%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXX---------PPPXPPPPXXPXPXP 923 YL P P P P T P PP P P P P P P P Sbjct: 99 YLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLP-PPP 157 Query: 924 PXPPP 938 P P P Sbjct: 158 PQPEP 162 Score = 29.1 bits (62), Expect = 9.4 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 5/100 (5%) Frame = +1 Query: 667 PXPTXLSXK-FRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPX 843 P PT L K L P P T P P + L T P P Sbjct: 62 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTY-LPPPPPTTTTTTTTPAPTPAP 120 Query: 844 XXXXXXPPPPXXXXPXXPP----PXPPXXPPPXPXPPPXP 951 PPPP P P P P PPP P Sbjct: 121 TYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 160 Score = 25.8 bits (54), Expect(2) = 0.062 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPP 659 PPPP PP P+ P +TP P P+ PPP Sbjct: 60 PPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTP-APTYLPPP 103 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 516 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 575 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 576 GPTRPGPPGPPGPTRPGPPGPPGP 599 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 525 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 569 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 528 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 572 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 551 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 597 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 545 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 604 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 605 PGPTRPGPPGPTRPGPPGP 623 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 545 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 588 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 554 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 599 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 523 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 555 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 551 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 610 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 611 GPPGPTRPGPPGPSPNDP 628 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GG G GG G GG G Sbjct: 257 GGNGGNGGSGSG--GGFGGNGGFGGVGGFG 284 Score = 32.7 bits (71), Expect = 0.76 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = -2 Query: 950 GXGGGXGXG----GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G G G GG G G GGG G G GG G G Sbjct: 348 GNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGG-AAGSGDRYTAGNG 406 Query: 785 XRXKIGXXGXXGG 747 R G G GG Sbjct: 407 GRYNTGNGGAVGG 419 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 513 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 558 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG G GGG GG G G G Sbjct: 254 GPNGGNGGNGG--SGSGGGFGGNGGFGGVG 281 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 G G GG G GGG G GG G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGG-GGXGG-GXXGXGG 860 GG GG G G G G GG GG GG G G GG Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPGG 290 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G G G G G G G Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 507 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 557 Score = 29.1 bits (62), Expect = 9.4 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GG GG GG G G GG G GG G G G + G G Sbjct: 254 GPNGGN-GGNGGSGSGGGFGGNGG-----FGGVGGFGPNGPGGPNGPKGPKGPPGPPGPP 307 Query: 752 GG 747 GG Sbjct: 308 GG 309 Score = 29.1 bits (62), Expect = 9.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GGG G GG G G G G G G GG G Sbjct: 266 GSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLG 311 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 191 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 192 GPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 141 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 185 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 144 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 167 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 213 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 221 PGPTRPGPPGPTRPGPPGP 239 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 161 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 204 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 170 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 167 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 227 GPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 129 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 123 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 173 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 43.2 bits (97), Expect = 5e-04 Identities = 19/41 (46%), Positives = 19/41 (46%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P PP PPP P P PP P PPP Sbjct: 40 PNPNPVPDPTRPPPPPPS-PPCGRPPPGSPPPGPPPPGPPP 79 Score = 41.1 bits (92), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 811 PPPXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPPP PPP P PP P PPP Sbjct: 34 PEPYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPP 79 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P T P P PPP PPP P P PP P Sbjct: 42 PNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCP 82 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P PP PPP P PPP PP P P P Sbjct: 51 PPPPPPSPPCGR-------PPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 37.1 bits (82), Expect = 0.035 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P PPP PPPP P P P P Sbjct: 48 PTRPPPPPPSPPCGRPP----PGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 36.3 bits (80), Expect = 0.062 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PPP PP PP PPP P Sbjct: 44 PVPDPTRPPPPPPSPPCGRPPPGSPPPGP 72 Score = 35.1 bits (77), Expect = 0.14 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP 926 PY P P P P P P P PPP PPP P P Sbjct: 36 PYRNPNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Frame = +1 Query: 817 PXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P P P PP P PP P P P P P P Sbjct: 40 PNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGP 85 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P P P P PP P PPP PP PP P Sbjct: 40 PNPNPVPDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCP 82 Score = 29.9 bits (64), Expect = 5.4 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = +1 Query: 742 TXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP--PPPXXXXPXXPPPXPPX 915 T PP P P R PPP P PP P P P P P Sbjct: 49 TRPPPPPPSP----PCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQWQPR 104 Query: 916 XPPP 927 PPP Sbjct: 105 RPPP 108 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P PP PP P P PP P P P P Sbjct: 46 PDPTRPPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGGPGGP 88 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 546 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 605 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 606 GPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 555 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 599 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 558 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 602 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 581 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 627 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 575 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 634 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 635 PGPTRPGPPGPTRPGPPGP 653 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 575 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 618 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 584 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 553 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 585 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 581 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 641 GPPGPTRPGPPGPSPNDP 658 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GG G GG G GG G Sbjct: 257 GGNGGNGGSGSG--GGFGGNGGFGGVGGFG 284 Score = 32.7 bits (71), Expect = 0.76 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = -2 Query: 950 GXGGGXGXG----GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G G G GG G G GGG G G GG G G Sbjct: 348 GNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGG-AAGSGDRYTAGNG 406 Query: 785 XRXKIGXXGXXGG 747 R G G GG Sbjct: 407 GRYNTGNGGAVGG 419 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 543 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG G GGG GG G G G Sbjct: 254 GPNGGNGGNGG--SGSGGGFGGNGGFGGVG 281 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 G G GG G GGG G GG G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGG-GGXGG-GXXGXGG 860 GG GG G G G G GG GG GG G G GG Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPGG 290 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G G G G G G G Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 537 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 587 Score = 29.1 bits (62), Expect = 9.4 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GG GG GG G G GG G GG G G G + G G Sbjct: 254 GPNGGN-GGNGGSGSGGGFGGNGG-----FGGVGGFGPNGPGGPNGPKGPKGPPGPPGPP 307 Query: 752 GG 747 GG Sbjct: 308 GG 309 Score = 29.1 bits (62), Expect = 9.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GGG G GG G G G G G G GG G Sbjct: 266 GSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLG 311 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 546 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 605 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 606 GPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 555 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 599 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 558 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 602 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 581 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 627 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 575 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 634 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 635 PGPTRPGPPGPTRPGPPGP 653 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 575 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 618 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 584 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 629 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 553 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 585 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 581 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 641 GPPGPTRPGPPGPSPNDP 658 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GG G GG G GG G Sbjct: 257 GGNGGNGGSGSG--GGFGGNGGFGGVGGFG 284 Score = 32.7 bits (71), Expect = 0.76 Identities = 25/73 (34%), Positives = 25/73 (34%), Gaps = 5/73 (6%) Frame = -2 Query: 950 GXGGGXGXG----GGXXGGXGGGXXGXXXXGGG-GXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G G G GG G G GGG G G GG G G Sbjct: 348 GNGGGAGAGDRYISGNGGGVGAGDRYVTGNGGGVGAGDRYTTGNGG-AAGSGDRYTAGNG 406 Query: 785 XRXKIGXXGXXGG 747 R G G GG Sbjct: 407 GRYNTGNGGAVGG 419 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 543 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 588 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG G GGG GG G G G Sbjct: 254 GPNGGNGGNGG--SGSGGGFGGNGGFGGVG 281 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 G G GG G GGG G GG G G G Sbjct: 258 GNGGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.7 bits (66), Expect = 3.1 Identities = 18/31 (58%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXGG-GGXGG-GXXGXGG 860 GG GG G G G G GG GG GG G G GG Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPGG 290 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G G G G G G G Sbjct: 260 GGNGGSGSGGGFGGNGGFGGVGGFGPNGPG 289 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 537 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 587 Score = 29.1 bits (62), Expect = 9.4 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXX 753 G GG GG GG G G GG G GG G G G + G G Sbjct: 254 GPNGGN-GGNGGSGSGGGFGGNGG-----FGGVGGFGPNGPGGPNGPKGPKGPPGPPGPP 307 Query: 752 GG 747 GG Sbjct: 308 GG 309 Score = 29.1 bits (62), Expect = 9.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 G GGG G GG G G G G G G GG G Sbjct: 266 GSGGGFGGNGGFGGVGGFGPNGPGGPNGPKGPKGPPGPPGPPGGLG 311 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 191 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 192 GPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 141 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 185 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 144 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 167 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 213 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 221 PGPTRPGPPGPTRPGPPGP 239 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 161 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 204 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 170 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 167 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 227 GPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 129 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 123 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 173 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 43.2 bits (97), Expect = 5e-04 Identities = 29/84 (34%), Positives = 29/84 (34%), Gaps = 4/84 (4%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPX--PXPPXPXXXXXXXPP-PPXXX 882 P P P PP P P PP P P PP P PP PP Sbjct: 132 PNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPT 191 Query: 883 XPXXP-PPXPPXXPPPXPXPPPXP 951 P P PP PP P P PP P Sbjct: 192 GPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P P P PP Sbjct: 141 PPGP-PGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPP 185 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP P P P PP P PP P P PP PP Sbjct: 144 PPGP-PGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPP 188 Score = 38.7 bits (86), Expect = 0.012 Identities = 20/48 (41%), Positives = 20/48 (41%), Gaps = 2/48 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXP--PPXPPPPXXPXPXPPXPPPPP 944 P P P PP PP P P P P PP P P P PP PP Sbjct: 167 PPGP-PGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPP 213 Score = 38.3 bits (85), Expect = 0.015 Identities = 25/79 (31%), Positives = 25/79 (31%), Gaps = 5/79 (6%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPP----PPXPXPPXPXXXXXXXPP-PPXXXXPXX 894 P PP P P PP P P PP P PP PP P Sbjct: 161 PFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGP 220 Query: 895 PPPXPPXXPPPXPXPPPXP 951 P P P P P PP P Sbjct: 221 PGPTRPGPPGPTRPGPPGP 239 Score = 38.3 bits (85), Expect = 0.015 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP P P P PP PP P Sbjct: 161 PFGP-PGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGP 204 Score = 37.1 bits (82), Expect = 0.035 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP-PXPP-PPXXPXPXPPXPPPP 941 P P P P P PP P P P PP PP P PP PP P Sbjct: 170 PPGP-PGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGP 215 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXP--PPXPPPPXXPXP-XPPXPPPPP 944 P PP P P PP P P P P PP PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPP 171 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 1/78 (1%) Frame = +1 Query: 712 PXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P P P T P P P P R PP P P P PP P Sbjct: 167 PPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Query: 889 XXPPPXPPXXPPPXPXPP 942 P P P P P P P Sbjct: 227 GPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P P PP P PP P Sbjct: 129 PKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 30.3 bits (65), Expect = 4.1 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 5/51 (9%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPP-PXPPXXP----PPXPXPPPXP 951 P P P P PP P PP P P P PP P PP P Sbjct: 123 PKGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGP 173 >AE014296-854|AAF47906.1| 172|Drosophila melanogaster CG15023-PA protein. Length = 172 Score = 43.2 bits (97), Expect = 5e-04 Identities = 26/86 (30%), Positives = 30/86 (34%), Gaps = 6/86 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP------PXPXXXXXXXPPPP 873 P +P + + T PP P P + T PPPP P P PPPP Sbjct: 44 PEIPFVITSTTEPP--PPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPP 101 Query: 874 XXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 102 PTTTTTTTTPAPTPAPTYLPPPPPPP 127 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P P P PP PPPP Sbjct: 88 PAPTPAPTYLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPP 127 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 P P P PPPP P P P P PPP P Sbjct: 42 PKPEIPFVITSTTEPPPPPPTYLP--PKPVPTYLPPPPP 78 Score = 29.5 bits (63), Expect(2) = 0.062 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 9/65 (13%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXX---------PPPXPPPPXXPXPXP 923 YL P P P P T P PP P P P P P P P Sbjct: 96 YLPPPPPTTTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLP-PPP 154 Query: 924 PXPPP 938 P P P Sbjct: 155 PQPEP 159 Score = 29.1 bits (62), Expect = 9.4 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 5/100 (5%) Frame = +1 Query: 667 PXPTXLSXK-FRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPX 843 P PT L K L P P T P P + L T P P Sbjct: 59 PPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTY-LPPPPPTTTTTTTTPAPTPAP 117 Query: 844 XXXXXXPPPPXXXXPXXPP----PXPPXXPPPXPXPPPXP 951 PPPP P P P P PPP P Sbjct: 118 TYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPPPPQP 157 Score = 25.8 bits (54), Expect(2) = 0.062 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**PSXHPPP 659 PPPP PP P+ P +TP P P+ PPP Sbjct: 57 PPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTP-APTYLPPP 100 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/92 (32%), Positives = 35/92 (38%), Gaps = 10/92 (10%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX-----PPXPXXXXXXXPPP 870 + P P++P + + P A PPPP P PP P PPP Sbjct: 260 MAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGI--PPP 317 Query: 871 PXXXXPXX--PP--PXPPXXPPPXPX-PPPXP 951 P P PP P PP PPP PPP P Sbjct: 318 PRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVP 349 Score = 40.7 bits (91), Expect = 0.003 Identities = 28/99 (28%), Positives = 34/99 (34%), Gaps = 2/99 (2%) Frame = +1 Query: 652 PXLXCPXP--TXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP 825 P + P P +S L P P+ P P IP P+ + + PP Sbjct: 257 PPMMAPPPPVVPVSNNNMGMLAPPPPV-PQPAPFPATIPPPPLPPMTGGQPPL--PPAMG 313 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P PP P PP PPP P PP Sbjct: 314 IPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPP 352 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP PPP PPP P P PP P Sbjct: 310 PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 354 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG GGG G GGGG Sbjct: 30 GGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG GG G G GGG GGG G GG G Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGG 56 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 GG G GGG GG GGG G GGGG GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G G GGG GG GGG GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGG 861 G GGG G G GG GG GGG G GG Sbjct: 36 GFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GG GGG G G G G GGGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GGG G G G + GG G G G Sbjct: 23 GYNYPRGGGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXG-GGXXGXGG 860 GGG GG G G GGGG G GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/92 (32%), Positives = 35/92 (38%), Gaps = 10/92 (10%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX-----PPXPXXXXXXXPPP 870 + P P++P + + P A PPPP P PP P PPP Sbjct: 241 MAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGI--PPP 298 Query: 871 PXXXXPXX--PP--PXPPXXPPPXPX-PPPXP 951 P P PP P PP PPP PPP P Sbjct: 299 PRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVP 330 Score = 40.7 bits (91), Expect = 0.003 Identities = 28/99 (28%), Positives = 34/99 (34%), Gaps = 2/99 (2%) Frame = +1 Query: 652 PXLXCPXP--TXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP 825 P + P P +S L P P+ P P IP P+ + + PP Sbjct: 238 PPMMAPPPPVVPVSNNNMGMLAPPPPV-PQPAPFPATIPPPPLPPMTGGQPPL--PPAMG 294 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P PP P PP PPP P PP Sbjct: 295 IPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPP 333 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP PPP PPP P P PP P Sbjct: 291 PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PP PPPP P PPP PP PPP P PPP P Sbjct: 76 PPQWSPGPPA-------YPPPPQR--PWGPPP-PPGPPPPGPPPPPGP 113 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PP P P PPPP P P PP PP P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +2 Query: 869 PXXPXXPPXP-----PPXPPXXPPPXPXPPP 946 P P PP P PP PP PPP P PPP Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P PP P PPP Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPP 104 Score = 37.1 bits (82), Expect = 0.035 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP P PP P PPP PPPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGP--PPPGPPPPPGPYYNP 117 Score = 37.1 bits (82), Expect = 0.035 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PPPP P P P PPP P Sbjct: 84 PAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P P PPP PPPP P P P P Sbjct: 81 PGPPA--YPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 P P P P PPPP P PPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + R PPPP P PP P PPPP Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGP-------PPPP 111 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG GGG G GGGG Sbjct: 30 GGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG GG G G GGG GGG G GG G Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGG 56 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 GG G GGG GG GGG G GGGG GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G G GGG GG GGG GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGG 861 G GGG G G GG GG GGG G GG Sbjct: 36 GFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GG GGG G G G G GGGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GGG G G G + GG G G G Sbjct: 23 GYNYPRGGGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXG-GGXXGXGG 860 GGG GG G G GGGG G GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PP PPPP P PPP PP PPP P PPP P Sbjct: 106 PPQWSPGPPA-------YPPPPQR--PWGPPP-PPGPPPPGPPPPPGP 143 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PP P P PPPP P P PP PP P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +2 Query: 869 PXXPXXPPXP-----PPXPPXXPPPXPXPPP 946 P P PP P PP PP PPP P PPP Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P PP P PPP Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPP 134 Score = 37.1 bits (82), Expect = 0.035 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP P PP P PPP PPPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGP--PPPGPPPPPGPYYNP 147 Score = 37.1 bits (82), Expect = 0.035 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PPPP P P P PPP P Sbjct: 114 PAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P P PPP PPPP P P P P Sbjct: 111 PGPPA--YPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P P PP P P PP P P P PP P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPP 140 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 P P P P PPPP P PPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + R PPPP P PP P PPPP Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGP-------PPPP 141 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 42.7 bits (96), Expect = 7e-04 Identities = 30/92 (32%), Positives = 35/92 (38%), Gaps = 10/92 (10%) Frame = +1 Query: 706 LXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX-----PPXPXXXXXXXPPP 870 + P P++P + + P A PPPP P PP P PPP Sbjct: 241 MAPPPPVVPVSNNNMGMLAPPPPVPQPAPFPATIPPPPLPPMTGGQPPLPPAMGI--PPP 298 Query: 871 PXXXXPXX--PP--PXPPXXPPPXPX-PPPXP 951 P P PP P PP PPP PPP P Sbjct: 299 PRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVP 330 Score = 40.7 bits (91), Expect = 0.003 Identities = 28/99 (28%), Positives = 34/99 (34%), Gaps = 2/99 (2%) Frame = +1 Query: 652 PXLXCPXP--TXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP 825 P + P P +S L P P+ P P IP P+ + + PP Sbjct: 238 PPMMAPPPPVVPVSNNNMGMLAPPPPV-PQPAPFPATIPPPPLPPMTGGQPPL--PPAMG 294 Query: 826 XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP P PP P PP PPP P PP Sbjct: 295 IPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPP 333 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P PP PP PPP PPP P P PP P Sbjct: 291 PAMGIPPPPRMMQPNAWAPPGMPAPPPRPPPTNWRPPPVPFPPTP 335 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 42.7 bits (96), Expect = 7e-04 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG GGG G GGGG Sbjct: 30 GGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 39.9 bits (89), Expect = 0.005 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG GG G G GGG GGG G GG G Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGG 56 Score = 38.7 bits (86), Expect = 0.012 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGG 828 GG G GGG GG GGG G GGGG GG Sbjct: 29 GGGGGGGGFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G G GGG GG GGG GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGG 861 G GGG G G GG GG GGG G GG Sbjct: 36 GFGGGFGGGFGGGLGGGGGGGGGGYQAVSGG 66 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GG GGG G G G G GGGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GGG G G G + GG G G G Sbjct: 23 GYNYPRGGGGGGGGFGGGFGGGFGGGLGGGGGGGGGG 59 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXG-GGXXGXGG 860 GGG GG G G GGGG G GG G Sbjct: 38 GGGFGGGFGGGLGGGGGGGGGGYQAVSG 65 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PP PPPP P PPP PP PPP P PPP P Sbjct: 106 PPQWSPGPPA-------YPPPPQR--PWGPPP-PPGPPPPGPPPPPGP 143 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PP P P PPPP P P PP PP P Sbjct: 106 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +2 Query: 869 PXXPXXPPXP-----PPXPPXXPPPXPXPPP 946 P P PP P PP PP PPP P PPP Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 141 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P PP P PPP Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPP 134 Score = 37.1 bits (82), Expect = 0.035 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP P PP P PPP PPPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGP--PPPGPPPPPGPYYNP 147 Score = 37.1 bits (82), Expect = 0.035 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PPPP P P P PPP P Sbjct: 114 PAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 143 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P P PPP PPPP P P P P Sbjct: 111 PGPPA--YPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P P PP P P PP P P P PP P Sbjct: 93 PPEDQQHPRQYGYPPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPP 140 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 P P P P PPPP P PPP P P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 147 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + R PPPP P PP P PPPP Sbjct: 107 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGP-------PPPP 141 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 42.7 bits (96), Expect = 7e-04 Identities = 23/48 (47%), Positives = 23/48 (47%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PP PPPP P PPP PP PPP P PPP P Sbjct: 76 PPQWSPGPPA-------YPPPPQR--PWGPPP-PPGPPPPGPPPPPGP 113 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +3 Query: 828 PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 PP PP P P PPPP P P PP PP P Sbjct: 76 PPQWSPGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +2 Query: 869 PXXPXXPPXP-----PPXPPXXPPPXPXPPP 946 P P PP P PP PP PPP P PPP Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPP 111 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP PPPP P PP P PPP Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPP 104 Score = 37.1 bits (82), Expect = 0.035 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP P PP P PPP PPPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGP--PPPGPPPPPGPYYNP 117 Score = 37.1 bits (82), Expect = 0.035 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PPPP P P P PPP P Sbjct: 84 PAYPPPPQRPWGPPPPPGPPPPGPPPPPGP 113 Score = 33.1 bits (72), Expect = 0.58 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP P P PPP PPPP P P P P Sbjct: 81 PGPPA--YPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPP 924 P P P P PPPP P PPP P P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPGPPPPGPPPPPGPYYNP 117 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPP 873 P P P + R PPPP P PP P PPPP Sbjct: 77 PQWSPGPPAYPPPPQRPWGPPPPPGPPPPGP-------PPPP 111 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 P PP P P PPP P P PP PPPPP Sbjct: 1271 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1301 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP P PP P PP PPPP P P P Sbjct: 1271 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPPPEADDP 1307 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +2 Query: 863 PXPXXPXXPPXPPPX----PPXXPPPXPXPPP 946 P P P P PPP PP PPP P PPP Sbjct: 1271 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPPP 1302 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P PP P PPPP P PP PP PP P Sbjct: 1271 PTPPKPVAAPV--PPPPLPLTPPAAPPPPPPPPPEADDP 1307 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PPP P P P PPP P Sbjct: 1273 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1301 Score = 31.1 bits (67), Expect = 2.3 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 808 PPPPXP-XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P PP P P P PPP P PPP PP PPP P Sbjct: 1271 PTPPKPVAAPVP-------PPPLPLTPPAAPPPPPP--PPPEADDP 1307 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 808 PPPPXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPPP P PPP PP P P P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP-----PPP 944 P P P P P P PP P P PP PP PPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPP 208 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P PPPP P P PPPP Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPP--PPKAAPRPPPP 209 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXP-XXPPPXPPPP 902 P P PP P PP P P P PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 808 PPPPXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPPP P PPP PP P P P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP-----PPP 944 P P P P P P PP P P PP PP PPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPP 208 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P PPPP P P PPPP Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPP--PPKAAPRPPPP 209 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXP-XXPPPXPPPP 902 P P PP P PP P P P PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 41.9 bits (94), Expect = 0.001 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 855 PXPPXPXXPPPXPPP-PXXPXPXPPXPPPPP 944 P PP P P PPP P P PP PPPPP Sbjct: 1331 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1361 Score = 40.7 bits (91), Expect = 0.003 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP P PP P PP PPPP P P P Sbjct: 1331 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPPPEADDP 1367 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = +2 Query: 863 PXPXXPXXPPXPPPX----PPXXPPPXPXPPP 946 P P P P PPP PP PPP P PPP Sbjct: 1331 PTPPKPVAAPVPPPPLPLTPPAAPPPPPPPPP 1362 Score = 35.5 bits (78), Expect = 0.11 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P PP P PPPP P PP PP PP P Sbjct: 1331 PTPPKPVAAPV--PPPPLPLTPPAAPPPPPPPPPEADDP 1367 Score = 33.5 bits (73), Expect = 0.44 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PP P PPP P P P PPP P Sbjct: 1333 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1361 Score = 31.1 bits (67), Expect = 2.3 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +1 Query: 808 PPPPXP-XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P PP P P P PPP P PPP PP PPP P Sbjct: 1331 PTPPKPVAAPVP-------PPPLPLTPPAAPPPPPP--PPPEADDP 1367 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 41.9 bits (94), Expect = 0.001 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +1 Query: 808 PPPPXPXP-PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 P P P P P PPPP P PPP PP P P P P Sbjct: 165 PAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 5/48 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP-----PPP 944 P P P P P P PP P P PP PP PPP Sbjct: 161 PAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPP 208 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P P P PP P PPPP P P PPPP Sbjct: 167 PAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPP--PPKAAPRPPPP 209 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 1/30 (3%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXP-XXPPPXPPPP 902 P P PP P PP P P P PP P Sbjct: 182 PAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 41.9 bits (94), Expect = 0.001 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PP PP P P P PP P PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 36.3 bits (80), Expect = 0.062 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +1 Query: 865 PPPXXXXPXXPP-PXPPXXPPPXPXPPP 945 PPP P PP P P PPP P PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 33.9 bits (74), Expect = 0.33 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PP P PP P PP P P PP PP P P P Sbjct: 107 PPKYPPYPPYPHYSPYPAPPYPY---PGYYPPPPPPYPYPYP 145 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P PP P PP P PPPP P P P Sbjct: 108 PKYP-PYPPYPHYSPYPAPPYPYPGYYPPPPPPYPYPYP 145 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P P PP P PP PPP P Sbjct: 112 PYPPYPHYSPYPAPPYPYPGYYPPPPPPYP 141 Score = 33.9 bits (74), Expect = 0.33 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPP 899 P P PP P P P PPP PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPPPPLPPP 213 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP 903 PPPP P P P PPPP P PPP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPPP----PPLPPP 213 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPP P P P P Sbjct: 186 PPPPPP--PPYYPPYPYYPPPPPPPPLPPP 213 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPP 912 PPP P PP PPPP PPP PP Sbjct: 186 PPPPPPPPYYPPYPYYPPPPP-------PPPLPP 212 Score = 30.3 bits (65), Expect = 4.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P P P P P P PPP PPP P Sbjct: 102 PYYPYPPKYPPYPPYPHYSPYPAPPYPYPGYYPPP---PPPYP 141 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG GG GGG G GGG G GG G GGG Sbjct: 789 GSGGWSSGPGGGGSGG-GGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXG-XXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G GG G G G G GGGG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGG 819 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXG-GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G G G G G GG G GG G GG G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGG G G G G GGG G GG G GG G T G Sbjct: 780 GGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G GG G GGG G GG G GG G G GG Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GG G G G GGG G G G + GG G G Sbjct: 798 GGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 38.3 bits (85), Expect = 0.015 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG---XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GG G GG G GGGG G GG G GG G Sbjct: 774 GPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWG 824 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 899 GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGGG G G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGRGAGSGG 792 >AY118423-1|AAM48452.1| 263|Drosophila melanogaster RH04014p protein. Length = 263 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG GG G G GGG GGG G GG Sbjct: 137 GGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G GGGG GGG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG G G G GGGG GGG G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G G G GG G GGGG G GG G GGGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGG---GGGGGGGGGGG 164 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG GG GGG GG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 GG G G G G GG G G G GGGG A + G G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG G GGG GG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGGGGG 162 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G GG G GG G G G GG G G G T + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGG-----GGGGGGGGGGTATSGQSG 172 Score = 33.5 bits (73), Expect = 0.44 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GG G GG GG GG GG G G G G G G + D Sbjct: 137 GGAGGAGGAGG--GGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDGEDGAD 194 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G DG G KG Sbjct: 195 GADG-------PDGPDGSKGGKG 210 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GG GG GGG G G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GGG GG GGG G G Sbjct: 146 GGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G G G GG GG G G GG G G + + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G G G G GG GGG GGGG G G G Sbjct: 130 GQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 29.9 bits (64), Expect = 5.4 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = -2 Query: 950 GXGGGXGXGG------GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G G G GG GG G GGGG GG G GGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGG---------GGGGGGGG 164 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 943 GGGGGXGGXG--XGXXGGGGXGG 881 GG GG GG G G GGGG GG Sbjct: 207 GGKGGKGGKGARNGAGGGGGAGG 229 >AY095057-1|AAM11385.1| 258|Drosophila melanogaster LD46359p protein. Length = 258 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG GG G G GGGG GG G GG G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 GGG GG GGG GG G G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 41.5 bits (93), Expect = 0.002 Identities = 28/82 (34%), Positives = 28/82 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G G G G GG GG G GGG R Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGP 96 Query: 770 GXXGXXGGXVWLXGRMGTXGXR 705 G G GG G G G R Sbjct: 97 GFGGGFGGGPGFGGGSGFGGGR 118 Score = 36.7 bits (81), Expect = 0.047 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G GGG G G G G GGG G G GG G R A Sbjct: 67 GFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGF-GGGSGFGGGRPA 120 Score = 31.9 bits (69), Expect = 1.3 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 4/71 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXX----GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAX 783 G GGG G GGG G GGG G GGG G GG GG + + Sbjct: 73 GFGGGPGFGGGQGFGGRPGFGGG-PGFGGGFGGGPGFGGGSGFGGGRPAVGGSSAASASS 131 Query: 782 RXKIGXXGXXG 750 G G Sbjct: 132 SASASGGGRGG 142 >AY051568-1|AAK92992.1| 263|Drosophila melanogaster GH21518p protein. Length = 263 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG GG G G GGG GGG G GG Sbjct: 137 GGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G GGGG GGG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG G G G GGGG GGG G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G G G GG G GGGG G GG G GGGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGG---GGGGGGGGGGG 164 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG GG GGG GG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 GG G G G G GG G G G GGGG A + G G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG G GGG GG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGGGGG 162 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G GG G GG G G G GG G G G T + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGG-----GGGGGGGGGGTATSGQSG 172 Score = 33.5 bits (73), Expect = 0.44 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GG G GG GG GG GG G G G G G G + D Sbjct: 137 GGAGGAGGAGG--GGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDGEDGAD 194 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G DG G KG Sbjct: 195 GADG-------PDGPDGSKGGKG 210 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GG GG GGG G G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GGG GG GGG G G Sbjct: 146 GGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G G G GG GG G G GG G G + + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G G G G GG GGG GGGG G G G Sbjct: 130 GQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 29.9 bits (64), Expect = 5.4 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = -2 Query: 950 GXGGGXGXGG------GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G G G GG GG G GGGG GG G GGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGG---------GGGGGGGG 164 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 943 GGGGGXGGXG--XGXXGGGGXGG 881 GG GG GG G G GGGG GG Sbjct: 207 GGKGGKGGKGARNGAGGGGGAGG 229 >AM294881-1|CAL26867.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGGSG----SGGG---------SGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GGG G GG G GG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG G G G G Sbjct: 55 GGGGGGGGGGS--GGGGGGGSGSGGGSGSG 82 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 910 GXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294880-1|CAL26866.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGGSG----SGGG---------SGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GGG G GG G GG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG G G G G Sbjct: 55 GGGGGGGGGGS--GGGGGGGSGSGGGSGSG 82 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 910 GXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294879-1|CAL26865.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGGSG----SGGG---------SGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GGG G GG G GG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG G G G G Sbjct: 55 GGGGGGGGGGS--GGGGGGGSGSGGGSGSG 82 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 910 GXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294878-1|CAL26864.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG-XXGXGGXG 854 GGGGG GG G G GG G GGG G GG G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 39.1 bits (87), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G GGGG G G G G G GG Sbjct: 56 GGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGANG 90 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GGG G GGGG G G G GGGG N Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAN 89 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G G GGGG GGG G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGG--GGGGSGSGGGSGSGDGGGGANGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGANG 90 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G G GGG G G G G G G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 >AM294877-1|CAL26863.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG-XXGXGGXG 854 GGGGG GG G G GG G GGG G GG G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 39.1 bits (87), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G GGGG G G G G G GG Sbjct: 56 GGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGANG 90 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GGG G GGGG G G G GGGG N Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAN 89 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G G GGGG GGG G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGG--GGGGSGSGGGSGSGDGGGGANGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGANGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGANG 90 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G G GGG G G G G G G Sbjct: 62 GGGSGGGGGGGSGSGGGSGSGDGGGGANGG 91 >AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG-XXGXGGXG 854 GGGGG GG G G GG G GGG G GG G Sbjct: 57 GGGGGGGGSGGGSGGGSGSGGGSGSGDGGGG 87 Score = 39.1 bits (87), Expect = 0.009 Identities = 19/39 (48%), Positives = 19/39 (48%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GG G G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 58 GGGGGGGSGGGSGGGSGSGGGSGSGDGGGG 87 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG GG GGG G GGG G G GGGG Sbjct: 56 GGGGGGGGGSGGGSGGGSGSGGGS----------GSGDGGGG 87 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGSGGGSGSGGGSGSGDGGGGAIGG 91 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GGG G GGG GG GGG G G Sbjct: 55 GGGGGGG-GGGSGGGSGGGSGSGGG 78 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G G G G G G G G GG Sbjct: 56 GGGGGGGGGSGGGSGGGSGSGGGSGSGDGG 85 Score = 31.5 bits (68), Expect = 1.8 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G G GGGG GG G GG G G G G G T Sbjct: 55 GGGGGGGGGGSGGGSG-GGSGSGGGSGSGDGGGGAIGGT 92 >AM294875-1|CAL26861.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGGSG----SGGG---------SGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GGG G GG G GG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG G G G G Sbjct: 55 GGGGGGGGGGS--GGGGGGGSGSGGGSGSG 82 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 910 GXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294874-1|CAL26860.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 20/39 (51%), Positives = 20/39 (51%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG G G G G G GG Sbjct: 55 GGGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G G Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.9 bits (79), Expect = 0.082 Identities = 22/46 (47%), Positives = 22/46 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGGGGSGGGGGGGSG----SGGG---------SGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G G G GG G G G G GG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GGG GG GGG G GG G G GG G GG Sbjct: 55 GGG--GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -3 Query: 898 GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GGG G GG G GG G G G Sbjct: 55 GGGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GG GG GGG G G G G Sbjct: 55 GGGGGGGGGGS--GGGGGGGSGSGGGSGSG 82 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -3 Query: 910 GXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AM294872-1|CAL26858.1| 158|Drosophila melanogaster CG10853 protein. Length = 158 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/31 (61%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG-XXGXGGXG 854 GGGGG GG G G GG G GGG G GG G Sbjct: 57 GGGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 39.1 bits (87), Expect = 0.009 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G G GGGG G G G G G GG Sbjct: 56 GGGGGGGGGSG--GGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG G G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 58 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G G G GG G G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GGGG G G G GGGG Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 87 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/39 (46%), Positives = 18/39 (46%) Frame = -3 Query: 916 GXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 G G GGGG GGG G GG G G G G G T Sbjct: 56 GGGGGGGGGSGGG--GGGGSGSGGGSGSGDGGGGAIGGT 92 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 64 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 91 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -3 Query: 925 GGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG G G G GG GGG G GG G G Sbjct: 56 GGGGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 61 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 90 >AJ249466-1|CAB60724.1| 258|Drosophila melanogaster DXl6 protein protein. Length = 258 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG GG G G GGGG GG G GG G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 GGG GG GGG GG G G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG GG GGG G GGG G GG G GGG Sbjct: 789 GSGGWSSGPGGGGSGG-GGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXG-XXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G GG G G G G GGGG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGG 819 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXG-GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G G G G G GG G GG G GG G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGG G G G G GGG G GG G GG G T G Sbjct: 780 GGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G GG G GGG G GG G GG G G GG Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GG G G G GGG G G G + GG G G Sbjct: 798 GGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 38.3 bits (85), Expect = 0.015 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG---XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GG G GG G GGGG G GG G GG G Sbjct: 774 GPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWG 824 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 899 GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGGG G G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGRGAGSGG 792 >AF232774-1|AAF43414.1| 258|Drosophila melanogaster SR family splicing factor 9G8 protein. Length = 258 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG GG G G GGGG GG G GG G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 GGG GG GGG GG G G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 >AE014297-2841|AAF55795.1| 263|Drosophila melanogaster CG4000-PA protein. Length = 263 Score = 41.5 bits (93), Expect = 0.002 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG GG G G GGG GGG G GG Sbjct: 137 GGAGGAGGAGGGGSAGGGGGGGGGGGGG 164 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G GGGG GGG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG G G G GGGG GGG G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 35.5 bits (78), Expect = 0.11 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -2 Query: 944 GGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G G G GG G GGGG G GG G GGGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGG---GGGGGGGGGGG 164 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GG GG GGG GG G G Sbjct: 140 GGAGGAGGGGSAGGGGGGGGGGGGGTATSG 169 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = -2 Query: 923 GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIGXXGXXG 750 GG G G G G GG G G G GGGG A + G G G Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG G GGG GG G Sbjct: 138 GAGGAGGAGGGGSAGGGGGGGGGGG 162 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/54 (35%), Positives = 20/54 (37%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G GG G GG G G G GG G G G T + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGG-----GGGGGGGGGGTATSGQSG 172 Score = 33.5 bits (73), Expect = 0.44 Identities = 26/83 (31%), Positives = 27/83 (32%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GG G GG GG GG GG G G G G G G + D Sbjct: 137 GGAGGAGGAGG--GGSAGGGGGGGGGGGGGTATSGQSGDSGQPGAPSPAGPQPDGEDGAD 194 Query: 771 RGXGNXWGGCLVXGEDGDXGXKG 703 G G DG G KG Sbjct: 195 GADG-------PDGPDGSKGGKG 210 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GG GG GGG G G G Sbjct: 143 GGAGGGGSAGGGGGGGGGGGGGTATSGQSG 172 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GG G GGG GG GGG G G Sbjct: 146 GGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/55 (30%), Positives = 19/55 (34%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GG G G G G GG GG G G GG G G + + G Sbjct: 124 GGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSGQPG 178 Score = 30.7 bits (66), Expect = 3.1 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G G G G GG GGG GGGG G G G Sbjct: 130 GQAGALLGGAGGAGGAGGGGSAGGGGGGGGGGGGGTATSGQSGDSG 175 Score = 29.9 bits (64), Expect = 5.4 Identities = 21/53 (39%), Positives = 21/53 (39%), Gaps = 6/53 (11%) Frame = -2 Query: 950 GXGGGXGXGG------GXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G G G GG GG G GGGG GG G GGG Sbjct: 121 GGAGGAGQAGQAGALLGGAGGAGGAGGGGSAGGGGG---------GGGGGGGG 164 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = -3 Query: 943 GGGGGXGGXG--XGXXGGGGXGG 881 GG GG GG G G GGGG GG Sbjct: 207 GGKGGKGGKGARNGAGGGGGAGG 229 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 41.5 bits (93), Expect = 0.002 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG GG GGG G GGG G GG G GGG Sbjct: 789 GSGGWSSGPGGGGSGG-GGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 Score = 41.1 bits (92), Expect = 0.002 Identities = 23/50 (46%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXG-XXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G GG G G G G GGGG G G G GGGG Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGG 819 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/48 (47%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Frame = -3 Query: 943 GGGGGXG-GXGXGXXG-GGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG G G G G G G G GG G GG G GG G G G Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGG 817 Score = 39.9 bits (89), Expect = 0.005 Identities = 20/55 (36%), Positives = 20/55 (36%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXTXXAXXXG 779 GGGG G G G G GGG G GG G GG G T G Sbjct: 780 GGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -2 Query: 950 GXGGGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G G GG G GGG G GG G GG G G GG Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGG 829 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGG GG G G G GGG G G G + GG G G Sbjct: 798 GGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGGKGKKPGG 842 Score = 38.3 bits (85), Expect = 0.015 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGG---XXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G G G G GG G GG G GGGG G GG G GG G Sbjct: 774 GPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWG 824 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 899 GGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGGG G G G G GG Sbjct: 762 GGIVGEVRGGGGGPGPGPGGGGSGRGAGSGG 792 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 41.5 bits (93), Expect = 0.002 Identities = 28/82 (34%), Positives = 28/82 (34%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G G G G GG GG G GGG R Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGP 96 Query: 770 GXXGXXGGXVWLXGRMGTXGXR 705 G G GG G G G R Sbjct: 97 GFGGGFGGGPGFGGGSGFGGGR 118 Score = 36.7 bits (81), Expect = 0.047 Identities = 22/55 (40%), Positives = 22/55 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GGG G GGG G G G G GGG G G GG G R A Sbjct: 67 GFGGGPGFGGGPGFGGGQGFGGRPGFGGGPGFGGGFGGGPGF-GGGSGFGGGRPA 120 Score = 31.9 bits (69), Expect = 1.3 Identities = 23/71 (32%), Positives = 25/71 (35%), Gaps = 4/71 (5%) Frame = -2 Query: 950 GXGGGXGXGGGXX----GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAX 783 G GGG G GGG G GGG G GGG G GG GG + + Sbjct: 73 GFGGGPGFGGGQGFGGRPGFGGG-PGFGGGFGGGPGFGGGSGFGGGRPAVGGSSAASASS 131 Query: 782 RXKIGXXGXXG 750 G G Sbjct: 132 SASASGGGRGG 142 >AE014134-1188|AAF52454.1| 258|Drosophila melanogaster CG10203-PA protein. Length = 258 Score = 41.5 bits (93), Expect = 0.002 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 934 GGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXG 821 GG GG G G GGGG GG G GG G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 Score = 30.7 bits (66), Expect = 3.1 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = -1 Query: 927 GGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXG 814 GGG GG GGG GG G G GG G Sbjct: 87 GGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGRG 124 >AY113614-1|AAM29619.1| 121|Drosophila melanogaster RH62530p protein. Length = 121 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -3 Query: 943 GGGGGX--GGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG GGG GG G GG Sbjct: 63 GGGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGGYPRGGFGG 103 Score = 37.1 bits (82), Expect = 0.035 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GG GG GGG G GGGG G G GGG + A Sbjct: 64 GGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGGYPRGGFGGGSASASASA 112 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G GG G G GGG GG G G G Sbjct: 75 GGGYGGGGYGGGGYPGGGFGGYPRGGFGGG 104 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G GGGG G G GG G G G G G Sbjct: 52 GGGFGRGGYCCGGGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGG 95 >AY113490-1|AAM29495.1| 158|Drosophila melanogaster RE47308p protein. Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGGG GGG G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGG 119 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG G GGG GG G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGG 118 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 931 GXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G GGGG GGG G GG G GG G G Sbjct: 84 GRSREGRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 37.1 bits (82), Expect = 0.035 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG GG GGG G GGG G GG GGG R R + Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARA---GGGGRAGDGGGRYRSRSPRRSR 138 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGG 120 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG---XGGGXXGXGG 860 GGGGG G G G GG G GGG G GG Sbjct: 96 GGGGGGGSGGGGRGGGSGARAGGGGRAGDGG 126 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G Sbjct: 96 GGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G G GGG G G Sbjct: 98 GGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 >AY075437-1|AAL68252.1| 155|Drosophila melanogaster LP09837p protein. Length = 155 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G G GGG GG G GG G Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 58 GGGGSGGGGGGGGGAGGGSGSGEGGGGAIG 87 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG GGG G G G Sbjct: 57 GGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 37.9 bits (84), Expect = 0.020 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G GGGG GGG G G G GG Sbjct: 55 GGGGGGGSG----GGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 35.9 bits (79), Expect = 0.082 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG G G GG G Sbjct: 61 GSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GGG G GGGG G GG G GG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGGT 89 Score = 31.1 bits (67), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GGG GG G G G GG GG Sbjct: 61 GSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG G GGG GG G G G G Sbjct: 60 GGSGGGGGGGGGAGGGSGSGEGGGGAIG 87 >AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p protein. Length = 1024 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G GGG GGG G GG G G GG Sbjct: 840 GDGGGIGGGGGARGVLGGGRSARGGGAGGG----GFRGPGGPGGGPGG 883 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -3 Query: 943 GGGGGXG---GXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G GGG GGG G GG G Sbjct: 846 GGGGGARGVLGGGRSARGGGAGGGGFRGPGGPG 878 Score = 32.7 bits (71), Expect = 0.76 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G GGG G GG GG G G Sbjct: 842 GGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGGPGGG 884 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG G G G GGG GG G Sbjct: 864 GGAGGGGFRGPGGPGGGPGGGAWKG 888 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 41.1 bits (92), Expect = 0.002 Identities = 30/79 (37%), Positives = 31/79 (39%), Gaps = 2/79 (2%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXX--GXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKIG 768 GG G GG GG GGG G GGGG G GG G GG R +G Sbjct: 20 GGGGRRGGRGGGGGGGRSLGGFGGRGGGG--FGGRGGPGGTGGPGGFGGPGRFGGPGGLG 77 Query: 767 XXGXXGGXVWLXGRMGTXG 711 G GG GR G G Sbjct: 78 GGGGFGG----PGRFGGPG 92 Score = 36.3 bits (80), Expect = 0.062 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G G GG GGG G GG G G G GG Sbjct: 29 GGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGG 75 Score = 33.5 bits (73), Expect = 0.44 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G G GG G GG G Sbjct: 77 GGGGGFGGPGR-FGGPGSFNGGFGGPGGWG 105 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GG G G G G GGG GG G GG Sbjct: 50 GGRGGPGGTGGPGGFGGPGRFGGPGGLGGGGGFGGPGRFGGPGSFNGG 97 >AE014298-2723|AAX52506.1| 991|Drosophila melanogaster CG32547-PA protein. Length = 991 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/27 (62%), Positives = 17/27 (62%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXG 863 GGGGG GG G G GGGG GG G G Sbjct: 31 GGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 39.5 bits (88), Expect = 0.007 Identities = 18/29 (62%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG-GXXGXGG 860 GG GG GG G G GGGG GG G G GG Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGG 51 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G GG G GG GG G Sbjct: 28 GGGGGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G G GG GGG G G Sbjct: 26 GGGGGGGGGGGGGGGLGGYGGGGSGGDAGG 55 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G GG G G GGGG GG G G G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGG 51 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GG GG G G Sbjct: 26 GGGGGGGGGGGGGGGLGGYGGGGSGGDAGG 55 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG G GGGG G G GG G Sbjct: 23 GGAGGGGGGGGGGGGGGGLGGYGGGGSGGDAGGSG 57 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG GG GGG GGGG G GG G G Sbjct: 24 GAGGGGGGGGGGG-------GGGGLGGYGGGGSGGDAGGSG 57 >AE014298-1899|AAF48264.2| 158|Drosophila melanogaster CG1987-PA protein. Length = 158 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGGG GGG G G Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGG 119 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG G GGG GG G G Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARAGG 118 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 931 GXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G G G GGGG GGG G GG G GG G G Sbjct: 84 GRSREGRGGGGGGGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 37.1 bits (82), Expect = 0.035 Identities = 21/53 (39%), Positives = 22/53 (41%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXK 774 G GGG GG GGG G GGG G GG GGG R R + Sbjct: 89 GRGGGGGGGGGGGGSGGGGRGGGSGARA---GGGGRAGDGGGRYRSRSPRRSR 138 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 91 GGGGGGGGGGGGSGGGGRGGGSGARAGGGG 120 Score = 35.5 bits (78), Expect = 0.11 Identities = 17/31 (54%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGG---XGGGXXGXGG 860 GGGGG G G G GG G GGG G GG Sbjct: 96 GGGGGGGSGGGGRGGGSGARAGGGGRAGDGG 126 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG G G G G G Sbjct: 96 GGGGGGGSGGGGRGGGSGARAGGGGRAGDG 125 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G G G GGG G G Sbjct: 98 GGGGGSGGGGRGGGSGARAGGGGRAGDGGG 127 >AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-PA protein. Length = 1024 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G GGG GGG G GG G G GG Sbjct: 840 GDGGGIGGGGGARGVLGGGRSARGGGAGGG----GFRGPGGPGGGPGG 883 Score = 34.3 bits (75), Expect = 0.25 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -3 Query: 943 GGGGGXG---GXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G GGG GGG G GG G Sbjct: 846 GGGGGARGVLGGGRSARGGGAGGGGFRGPGGPG 878 Score = 32.7 bits (71), Expect = 0.76 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG G GG G GGG G GG GG G G Sbjct: 842 GGGIGGGGGARGVLGGGRSARGGGAGGGGFRGPGGPGGGPGGG 884 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG G G G GGG GG G Sbjct: 864 GGAGGGGFRGPGGPGGGPGGGAWKG 888 >AE014296-723|AAF47815.1| 155|Drosophila melanogaster CG10853-PA protein. Length = 155 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G G GGG GG G GG G Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 58 GGGGSGGGGGGGGGAGGGSGSGEGGGGAIG 87 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG GGG G G G Sbjct: 57 GGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 37.9 bits (84), Expect = 0.020 Identities = 19/38 (50%), Positives = 19/38 (50%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G GGGG GGG G G G GG Sbjct: 55 GGGGGGGSG----GGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG G GGG GG G G GGGG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGG 84 Score = 35.9 bits (79), Expect = 0.082 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GGG GG G G GG G Sbjct: 61 GSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GGG G GGGG G GG G GG Sbjct: 55 GGGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGSGGGGGGGGGAGGGSGSGEGGGGAIGGT 89 Score = 31.1 bits (67), Expect = 2.3 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GGG GG G G G GG GG Sbjct: 61 GSGGGGGGGGGAGGGSGSGEGGGGAIGG 88 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG G GGG GG G G G G Sbjct: 60 GGSGGGGGGGGGAGGGSGSGEGGGGAIG 87 >AE013599-1232|AAF58699.1| 121|Drosophila melanogaster CG9080-PA protein. Length = 121 Score = 41.1 bits (92), Expect = 0.002 Identities = 21/41 (51%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = -3 Query: 943 GGGGGX--GGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGGG GG G G GGGG GGG GG G GG Sbjct: 63 GGGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGGYPRGGFGG 103 Score = 37.1 bits (82), Expect = 0.035 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = -2 Query: 932 GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G GG GG GGG G GGGG G G GGG + A Sbjct: 64 GGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGGYPRGGFGGGSASASASA 112 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G GG G G GGG GG G G G Sbjct: 75 GGGYGGGGYGGGGYPGGGFGGYPRGGFGGG 104 Score = 33.5 bits (73), Expect = 0.44 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G GGGG G G GG G G G G G Sbjct: 52 GGGFGRGGYCCGGGGGFRRGGFGGGGYGGGGYGGGGYPGGGFGG 95 >X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. Length = 196 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 941 GGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG GG GG G GGGG GG GGGG Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 97 Score = 37.5 bits (83), Expect = 0.027 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GG G GG GG GGG GGG GG GGGG + A R Sbjct: 61 GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPR 118 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG GG G Sbjct: 74 GGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G G GG GG G GG G GG GGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GG G G G GGG G G GG G G Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 GG GGG G GG G GG G GG N Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSN 88 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/67 (31%), Positives = 24/67 (35%) Frame = +1 Query: 751 PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPX 930 P +P P + A + T PP P P PP PP P PPP Sbjct: 151 PSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPP 210 Query: 931 PXPPPXP 951 P PP P Sbjct: 211 PPPPVAP 217 Score = 37.9 bits (84), Expect = 0.020 Identities = 26/93 (27%), Positives = 31/93 (33%), Gaps = 13/93 (13%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP---PXPXXXXXXXP-----P 867 P LP ++ +P P+ + PPP P P P P P P Sbjct: 121 PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLP 180 Query: 868 PPXXXXPXXPPP-----XPPXXPPPXPXPPPXP 951 PP PP PP P P PPP P Sbjct: 181 PPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 Score = 37.1 bits (82), Expect = 0.035 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPX--PPXTXXXXXPXPPXPXXPPPXPPPPXXPXP--XPP 926 S P P A + P P PP P P PPP PPP P P PP Sbjct: 112 SLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPP 171 Query: 927 XPP-----PPP 944 PP PPP Sbjct: 172 SPPESKYLPPP 182 Score = 35.1 bits (77), Expect = 0.14 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 3/83 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXP---IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 P LP + PP P P PP P P PPPP Sbjct: 102 PRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPV 161 Query: 883 XPXXPPPXPPXXPPPXPXPPPXP 951 P PP P PPP P Sbjct: 162 VAPKPTYLPPSPPESKYLPPPTP 184 Score = 35.1 bits (77), Expect = 0.14 Identities = 27/87 (31%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = +1 Query: 706 LXPXV-PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPP 870 L P V P LP PP + P + + + PPP P PP P PP Sbjct: 145 LPPKVAPSLPP-PPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYL---PP 200 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PP P Sbjct: 201 KVAPSLPPPPPPPPVAPKKLYLPPAEP 227 Score = 32.7 bits (71), Expect = 0.76 Identities = 35/149 (23%), Positives = 41/149 (27%), Gaps = 9/149 (6%) Frame = +1 Query: 532 PPXPPXPPPXXXVPXAXXX-----PFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKF 696 PP PP PP +P + P P + P PT L Sbjct: 114 PPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPS- 172 Query: 697 RHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPX 876 P LP +P P+ + PPP P PP PP Sbjct: 173 ----PPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAPKKLYL--PPAE 226 Query: 877 XXXPXXPPPXP-PXXPPPXPXP---PPXP 951 PP P PP P PP P Sbjct: 227 PETKYLPPSEPVEKYLPPKPEQKYLPPQP 255 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 941 GGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG GG GG G GGGG GG GGGG Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 97 Score = 37.5 bits (83), Expect = 0.027 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GG G GG GG GGG GGG GG GGGG + A R Sbjct: 61 GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPR 118 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG GG G Sbjct: 74 GGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G G GG GG G GG G GG GGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXKIGX 765 G GG GG GGG G G GG GG G G GGG K+G Sbjct: 18 GQASLGGLLGGGGGGG--GSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGG 75 Query: 764 XGXXGG 747 G GG Sbjct: 76 GGGGGG 81 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GG GG G GG G GG Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGG 71 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG------GXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GG G G GG G GG GGGG Sbjct: 27 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGG 78 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GG G G G GGG G G GG G G Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 10/60 (16%) Frame = -2 Query: 950 GXGGGXGXGGGXXG----------GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GGG G G GGG G GG G GG G GG N Sbjct: 29 GGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSN 88 Score = 30.7 bits (66), Expect = 3.1 Identities = 36/138 (26%), Positives = 43/138 (31%), Gaps = 1/138 (0%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXG-GXGXXXXRXXRGXEXEDR 769 GG G GGG G GGG G G G G G G G G + Sbjct: 23 GGLLGGGGGGGGSIGGGAG------GIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGG 76 Query: 768 GXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXKG 589 G G + G G G G + G G GG + +V I + +G Sbjct: 77 GGGGGYSG----GYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEG 132 Query: 588 XXXGPRYXXXXXGGXGXG 535 G Y GG G Sbjct: 133 YSGG--YSGAQSGGYSGG 148 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 941 GGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG GG GG G GGGG GG GGGG Sbjct: 52 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 97 Score = 37.5 bits (83), Expect = 0.027 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GG G GG GG GGG GGG GG GGGG + A R Sbjct: 61 GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPR 118 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG GG G Sbjct: 74 GGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G G GG GG G GG G GG GGG Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 103 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXKIGX 765 G GG GG GGG G G GG GG G G GGG K+G Sbjct: 18 GQASLGGLLGGGGGGG--GSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGG 75 Query: 764 XGXXGG 747 G GG Sbjct: 76 GGGGGG 81 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GG GG G GG G GG Sbjct: 24 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGG 71 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG------GXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GG G G GG G GG GGGG Sbjct: 27 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGG 78 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GG G G G GGG G G GG G G Sbjct: 57 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 102 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 10/60 (16%) Frame = -2 Query: 950 GXGGGXGXGGGXXG----------GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GGG G G GGG G GG G GG G GG N Sbjct: 29 GGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSN 88 Score = 30.7 bits (66), Expect = 3.1 Identities = 36/138 (26%), Positives = 43/138 (31%), Gaps = 1/138 (0%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXG-GXGXXXXRXXRGXEXEDR 769 GG G GGG G GGG G G G G G G G G + Sbjct: 23 GGLLGGGGGGGGSIGGGAG------GIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGG 76 Query: 768 GXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXKG 589 G G + G G G G + G G GG + +V I + +G Sbjct: 77 GGGGGYSG----GYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEG 132 Query: 588 XXXGPRYXXXXXGGXGXG 535 G Y GG G Sbjct: 133 YSGG--YSGAQSGGYSGG 148 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/46 (45%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -2 Query: 941 GGXGXG-GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G G GG GG GG G GGGG GG GGGG Sbjct: 109 GGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGG 154 Score = 37.5 bits (83), Expect = 0.027 Identities = 22/58 (37%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = -2 Query: 950 GXGG-GXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXR 780 G GG G GG GG GGG GGG GG GGGG + A R Sbjct: 118 GLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPR 175 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGG GG GG G Sbjct: 131 GGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 160 Score = 36.7 bits (81), Expect = 0.047 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G G GG GG G GG G GG GGG Sbjct: 114 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGGG 160 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/66 (36%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXG-GGGXNVXRXAXRXKIGX 765 G GG GG GGG G G GG GG G G GGG K+G Sbjct: 75 GQASLGGLLGGGGGGG--GSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGG 132 Query: 764 XGXXGG 747 G GG Sbjct: 133 GGGGGG 138 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GG G GGG GG GG GG G GG G GG Sbjct: 81 GLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGG 128 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 6/52 (11%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGG------GXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GG G G GG G GG GGGG Sbjct: 84 GGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGG 135 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GGG GG G G G GGG G G GG G G Sbjct: 114 GLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSNGGGYSGGGGYSGGG 159 Score = 33.5 bits (73), Expect = 0.44 Identities = 22/60 (36%), Positives = 22/60 (36%), Gaps = 10/60 (16%) Frame = -2 Query: 950 GXGGGXGXGGGXXG----------GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G GGG GGG G G GGG G GG G GG G GG N Sbjct: 86 GGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGYSGGYSN 145 Score = 30.7 bits (66), Expect = 3.1 Identities = 36/138 (26%), Positives = 43/138 (31%), Gaps = 1/138 (0%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXG-GXGXXXXRXXRGXEXEDR 769 GG G GGG G GGG G G G G G G G G + Sbjct: 80 GGLLGGGGGGGGSIGGGAG------GIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGG 133 Query: 768 GXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGGXKVIKXWYQVWIXVTLXKG 589 G G + G G G G + G G GG + +V I + +G Sbjct: 134 GGGGGYSG----GYSNGGGYSGGGGYSGGGGYSGGGGYSGGYAAPRPVEKVVIVKVINEG 189 Query: 588 XXXGPRYXXXXXGGXGXG 535 G Y GG G Sbjct: 190 YSGG--YSGAQSGGYSGG 205 >AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA protein. Length = 171 Score = 40.7 bits (91), Expect = 0.003 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 GGG G GGG GG GGG GG G G G Sbjct: 49 GGGGGGGGGYGGGYGGGYGGGYGGGGYG 76 Score = 38.7 bits (86), Expect = 0.012 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG GGG G G G Sbjct: 49 GGGGGGGGGYGGGYGGGYGGGYGGGGYGG 77 Score = 38.7 bits (86), Expect = 0.012 Identities = 32/102 (31%), Positives = 34/102 (33%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXED 772 G GGG G GGG GG GGG GG G G G G G Sbjct: 51 GGGGGGGYGGGYGGGYGGGYGG--GGYGGESTVKVIKVITDSGAGGGYRGGYAGGY---G 105 Query: 771 RGXGNXWGGCLVXGEDGDXGXKGMTKFXG*GSXXXAV*XGGG 646 G G +GG G G K + GS GGG Sbjct: 106 GGYGGGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGG 147 Score = 37.9 bits (84), Expect = 0.020 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGGGG GG G GGG GGG G G G G G Sbjct: 53 GGGGGYGGGYGGGYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRG 98 Score = 37.1 bits (82), Expect = 0.035 Identities = 30/91 (32%), Positives = 32/91 (35%), Gaps = 14/91 (15%) Frame = -2 Query: 950 GXGGGXGXGGGXXG-------------GXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG G G GGG G G GG G G G GGG Sbjct: 65 GYGGGYG-GGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYGGGYGGAYGGGYGGG 123 Query: 809 GX-NVXRXAXRXKIGXXGXXGGXVWLXGRMG 720 + + G G GG W G G Sbjct: 124 STVKIIKVITDSGSGYGGGYGGGGWTSGSYG 154 Score = 29.9 bits (64), Expect = 5.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GGG G GG G GG G G Sbjct: 49 GGGGGGGGGYG-GGYGGGYGGGYGGGGYG 76 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 40.7 bits (91), Expect = 0.003 Identities = 32/136 (23%), Positives = 41/136 (30%), Gaps = 3/136 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP P PP +P + P + P PT K+ Sbjct: 447 PPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLPP- 505 Query: 709 XPXVPILPX-NQTXPPXIPXXPIFX--LXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 P +P P + PP P P + + + P P P PP PP Sbjct: 506 -PVIPTSPPVPKYLPPTNPPTPQYLPPVQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTT 564 Query: 880 XXPXXPPPXPPXXPPP 927 P PPP PPP Sbjct: 565 QAPPPPPPTSKYLPPP 580 Score = 40.3 bits (90), Expect = 0.004 Identities = 27/86 (31%), Positives = 29/86 (33%), Gaps = 6/86 (6%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPP----PXX 879 P VP P T PP P+ + PPP PP P P P Sbjct: 374 PAVPFPPP--TNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKP 431 Query: 880 XXPXXPPPXPP--XXPPPXPXPPPXP 951 P PP PP PP P PP P Sbjct: 432 AIPFPPPTNPPQKYLPPVVPTSPPQP 457 Score = 39.5 bits (88), Expect = 0.007 Identities = 31/105 (29%), Positives = 36/105 (34%), Gaps = 5/105 (4%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXX--PPPPX 822 P + P PT K+ + P P P P P P P + + P P Sbjct: 374 PAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAI 433 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXP--PPXPPXXPPPXPXPPPXP 951 P PP PP P P PP P PPP P PP P Sbjct: 434 PFPPPTN-------PPQKYLPPVVPTSPPQPKYLPPPKPTNPPQP 471 Score = 39.5 bits (88), Expect = 0.007 Identities = 33/142 (23%), Positives = 40/142 (28%), Gaps = 3/142 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PP P PP +P + P + P PT K+ + Sbjct: 390 PPVVPTTPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPPQKYLPPV 449 Query: 709 XPXVPILPXNQTXP-PXIPXXPIFXLXAXRXTXX--PPPPXPXPPXPXXXXXXXPPPPXX 879 P P P P P P P + + P P P P PPP Sbjct: 450 VPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPAPTNPPQKYLPPPVIP 509 Query: 880 XXPXXPPPXPPXXPPPXPXPPP 945 P P PP PP PP Sbjct: 510 TSPPVPKYLPPTNPPTPQYLPP 531 Score = 39.1 bits (87), Expect = 0.009 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPP----PPXXPXPXPPXPPPP 941 P P P P P PP PP PP P PP PPPP Sbjct: 168 PPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPP 211 Score = 37.1 bits (82), Expect = 0.035 Identities = 38/154 (24%), Positives = 44/154 (28%), Gaps = 5/154 (3%) Frame = +1 Query: 499 DFIKIXYIXXPPPXPPXP--PPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPX 672 D+ K PP PP PP P P P + P Sbjct: 177 DYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPP 236 Query: 673 PTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP---PXPX 843 PT K+ + P P +P + PP P T PPPP P P Sbjct: 237 PTNPPQKYLPPVVPTSPPVP--KYVPPPTP------------TYIPPPPKKQGYDYPKPA 282 Query: 844 XXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P PPP PPP Sbjct: 283 IPFPPPTAPPQKYLPPVTTTQAPPPPPPKYLPPP 316 Score = 36.7 bits (81), Expect = 0.047 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 6/52 (11%) Frame = +3 Query: 801 VXPXXPX--PXPPXTXXXXXPXPPXPXXPPPXPP----PPXXPXPXPPXPPP 938 V P P P PP P P P PP PP PP PP PPP Sbjct: 259 VPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 310 Score = 35.9 bits (79), Expect = 0.082 Identities = 25/87 (28%), Positives = 28/87 (32%), Gaps = 7/87 (8%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPP----PXX 879 P +P P T PP P+ + PPP PP P P P Sbjct: 431 PAIPFPPP--TNPPQKYLPPVVPTSPPQPKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKP 488 Query: 880 XXPXXPPPXPPXX---PPPXPXPPPXP 951 P P PP PP P PP P Sbjct: 489 AIPFPAPTNPPQKYLPPPVIPTSPPVP 515 Score = 35.5 bits (78), Expect = 0.11 Identities = 20/69 (28%), Positives = 20/69 (28%), Gaps = 3/69 (4%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP---XPPXX 918 PP P PPPP PP P P P PP PP Sbjct: 287 PPTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVT 346 Query: 919 PPPXPXPPP 945 P PPP Sbjct: 347 TTKAPPPPP 355 Score = 35.5 bits (78), Expect = 0.11 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 5/73 (6%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXP---PXPXXXXXXXPPPPXXXXPXXPPPXPPXX 918 PP P P L T PPPP P P P P P P PP PP Sbjct: 597 PPTAP--PQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFP--PPTNPPQK 652 Query: 919 --PPPXPXPPPXP 951 PP P PP P Sbjct: 653 YIPPVVPTSPPTP 665 Score = 35.1 bits (77), Expect = 0.14 Identities = 38/143 (26%), Positives = 42/143 (29%), Gaps = 4/143 (2%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 P P P PPP VP P P + P PT K+ Sbjct: 142 PKPAVPFPPPA--VPTQKYLPPVTTTQAPPPQVKQGYDYPKPAIPFPPPTAPPQKY---- 195 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXP 888 P V P PP + + P P P PP PP P Sbjct: 196 LPPVTTTPAPPPPPPPTKKY-LPPPQVKQGYDYPKPAIPFPPPTN-------PPQKYLPP 247 Query: 889 XXP--PPXPPXXPPPXP--XPPP 945 P PP P PPP P PPP Sbjct: 248 VVPTSPPVPKYVPPPTPTYIPPP 270 Score = 34.7 bits (76), Expect = 0.19 Identities = 26/74 (35%), Positives = 26/74 (35%), Gaps = 6/74 (8%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXP----PXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 PP P P L T PPPP P P P P P P PP PP Sbjct: 187 PPTAP--PQKYLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFP--PPTNPPQ 242 Query: 916 X--PPPXPXPPPXP 951 PP P PP P Sbjct: 243 KYLPPVVPTSPPVP 256 Score = 34.7 bits (76), Expect = 0.19 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXX--P 921 PP P P L T PPPP P P P PP PP P Sbjct: 333 PPTAP--PQKYLPPVTTTKAPPPPPTVKYLPPPQVKQGYDYPKPAVPFPPPTNPPQKYLP 390 Query: 922 PPXPXPPPXP 951 P P PP P Sbjct: 391 PVVPTTPPQP 400 Score = 34.3 bits (75), Expect = 0.25 Identities = 22/75 (29%), Positives = 23/75 (30%), Gaps = 3/75 (4%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-- 903 P PP IP P + PP P PP P P P PP Sbjct: 499 PQKYLPPPVIPTSP--PVPKYLPPTNPPTPQYLPPVQVKQGYDYPKPAIPFPPPTAPPQK 556 Query: 904 -XPPXXPPPXPXPPP 945 PP P PPP Sbjct: 557 YLPPVTTTQAPPPPP 571 Score = 34.3 bits (75), Expect = 0.25 Identities = 31/134 (23%), Positives = 37/134 (27%), Gaps = 1/134 (0%) Frame = +1 Query: 529 PPPXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHAL 708 PPP P PP P + P + P PT K+ Sbjct: 504 PPPVIPTSPPVPKYLPPTNPPTPQ--YLPPVQVKQGYDYPKPAIPFPPPTAPPQKY---- 557 Query: 709 XPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXX-PPPPXPXPPXPXXXXXXXPPPPXXXX 885 +P + Q PP P + P P P PP PP Sbjct: 558 ---LPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQA 614 Query: 886 PXXPPPXPPXXPPP 927 P PPP PPP Sbjct: 615 PPPPPPTSKYLPPP 628 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 8/64 (12%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPX----PXPPXTXXXXXPXPPXPXXPPPXPP----PPXXPXPXPP 926 YL P P P P P P P P PP PP PP PP Sbjct: 557 YLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPP 616 Query: 927 XPPP 938 PPP Sbjct: 617 PPPP 620 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP 926 P P PP T PP P P PPPP PP Sbjct: 179 PKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPP 218 Score = 33.9 bits (74), Expect = 0.33 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXP---PPPXXPXPXPPXPPPPP 944 P P PP T PP PP P PPP P P PPP Sbjct: 372 PKPAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPPQPKYLPPP 420 Score = 33.9 bits (74), Expect = 0.33 Identities = 19/50 (38%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXP--PPXPPXXPPPXPXPPPXP 951 P P P PP PP P P PP P PPP P PP P Sbjct: 372 PKPAVPFPPPTN-------PPQKYLPPVVPTTPPQPKYLPPPKPTNPPQP 414 Score = 33.9 bits (74), Expect = 0.33 Identities = 19/61 (31%), Positives = 19/61 (31%), Gaps = 4/61 (6%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPX----PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 YL P P P P P P P P PP PP P P PP Sbjct: 605 YLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYIPPVVPTSPPT 664 Query: 939 P 941 P Sbjct: 665 P 665 Score = 33.1 bits (72), Expect = 0.58 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP T PP PP P P P P PPPP Sbjct: 228 PKPAIPFPPPTNPPQKYLPPVVPTSPPV--PKYVPPPTPTYIPPPP 271 Score = 32.7 bits (71), Expect = 0.76 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 5/62 (8%) Frame = +3 Query: 771 YLXPXXXAXXVXPXXPX-----PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 YL P P P P P P P P PP PP P P PP Sbjct: 195 YLPPVTTTPAPPPPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPP 254 Query: 936 PP 941 P Sbjct: 255 VP 256 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXX--PXPPXPXXPPPXPP----PPXXPXPXPPXPPP 938 P P PP P P P PP PP PP PP PPP Sbjct: 523 PPTPQYLPPVQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 572 Score = 31.5 bits (68), Expect = 1.8 Identities = 22/72 (30%), Positives = 22/72 (30%), Gaps = 4/72 (5%) Frame = +1 Query: 748 PPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 PP P P L T PPPP P PP P P P PP Sbjct: 549 PPTAP--PQKYLPPVTTTQAPPPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYL 606 Query: 916 XPPPXPXPPPXP 951 P PP P Sbjct: 607 PPVTTTQAPPPP 618 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 824 PXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP P PPP P PP Sbjct: 372 PKPAVPFPPPTNPPQKYLPPVVPTTPPQPKYLPPPKPTNPP 412 Score = 29.9 bits (64), Expect = 5.4 Identities = 25/96 (26%), Positives = 32/96 (33%), Gaps = 3/96 (3%) Frame = +1 Query: 649 TPXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX 828 TP + P P + A+ P +P + PP + + P P P Sbjct: 127 TPSVPFPQPKQGYDYPKPAVPFPPPAVPTQKYLPP-VTTTQAPPPQVKQGYDYPKPAIPF 185 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPP---XXPPP 927 PP PP P PPP PP PPP Sbjct: 186 PPPTAPPQKYL--PPVTTTPAPPPPPPPTKKYLPPP 219 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P P P PPP PPP P P Sbjct: 181 PAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPP 219 Score = 29.1 bits (62), Expect = 9.4 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 10/56 (17%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP----------XXPXPXPPXPPPPP 944 P P PP T PP P PPPP P P P PPP Sbjct: 279 PKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPP 334 Score = 29.1 bits (62), Expect = 9.4 Identities = 24/92 (26%), Positives = 30/92 (32%) Frame = +1 Query: 652 PXLXCPXPTXLSXKFRHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP 831 P + P PT K+ +P + Q PP P + + P P P P Sbjct: 281 PAIPFPPPTAPPQKY-------LPPVTTTQAPPPPPPKY-LPPPQVKQGYDYPKPAIPFP 332 Query: 832 PXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 P PP P PPP PPP Sbjct: 333 PPTAPPQKYLPPVTTTKAP-PPPPTVKYLPPP 363 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 40.7 bits (91), Expect = 0.003 Identities = 21/67 (31%), Positives = 24/67 (35%) Frame = +1 Query: 751 PXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPX 930 P +P P + A + T PP P P PP PP P PPP Sbjct: 151 PSLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPP 210 Query: 931 PXPPPXP 951 P PP P Sbjct: 211 PPPPVAP 217 Score = 37.9 bits (84), Expect = 0.020 Identities = 26/93 (27%), Positives = 31/93 (33%), Gaps = 13/93 (13%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXP---PXPXXXXXXXP-----P 867 P LP ++ +P P+ + PPP P P P P P P Sbjct: 121 PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPPESKYLP 180 Query: 868 PPXXXXPXXPPP-----XPPXXPPPXPXPPPXP 951 PP PP PP P P PPP P Sbjct: 181 PPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPP 213 Score = 37.1 bits (82), Expect = 0.035 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 9/71 (12%) Frame = +3 Query: 759 SXXPYLXPXXXAXXVXPXXPXPX--PPXTXXXXXPXPPXPXXPPPXPPPPXXPXP--XPP 926 S P P A + P P PP P P PPP PPP P P PP Sbjct: 112 SLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPP 171 Query: 927 XPP-----PPP 944 PP PPP Sbjct: 172 SPPESKYLPPP 182 Score = 35.1 bits (77), Expect = 0.14 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 3/83 (3%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXP---IFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXX 882 P LP + PP P P PP P P PPPP Sbjct: 102 PRQKYLPPKVSLPPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPV 161 Query: 883 XPXXPPPXPPXXPPPXPXPPPXP 951 P PP P PPP P Sbjct: 162 VAPKPTYLPPSPPESKYLPPPTP 184 Score = 35.1 bits (77), Expect = 0.14 Identities = 27/87 (31%), Positives = 31/87 (35%), Gaps = 5/87 (5%) Frame = +1 Query: 706 LXPXV-PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX----PPXPXXXXXXXPPP 870 L P V P LP PP + P + + + PPP P PP P PP Sbjct: 145 LPPKVAPSLPP-PPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYL---PP 200 Query: 871 PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP PP P PP P Sbjct: 201 KVAPSLPPPPPPPPVAPKKLYLPPAEP 227 Score = 32.7 bits (71), Expect = 0.76 Identities = 35/149 (23%), Positives = 41/149 (27%), Gaps = 9/149 (6%) Frame = +1 Query: 532 PPXPPXPPPXXXVPXAXXX-----PFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKF 696 PP PP PP +P + P P + P PT L Sbjct: 114 PPPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPS- 172 Query: 697 RHALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPX 876 P LP +P P+ + PPP P PP PP Sbjct: 173 ----PPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAPKKLYL--PPAE 226 Query: 877 XXXPXXPPPXP-PXXPPPXPXP---PPXP 951 PP P PP P PP P Sbjct: 227 PETKYLPPSEPVEKYLPPKPEQKYLPPQP 255 >AE013599-2045|AAF58147.1| 113|Drosophila melanogaster CG8157-PA protein. Length = 113 Score = 40.7 bits (91), Expect = 0.003 Identities = 22/48 (45%), Positives = 22/48 (45%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GG GG GGG GG G G GG G G GG Sbjct: 40 GFGGGPGFGG--QGGFGGGPGEYGGQGGFGGGPGGYGGQGGFGGGPGG 85 Score = 33.9 bits (74), Expect = 0.33 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG G G G G GGG G G G G G GG G G G Sbjct: 54 GGGPGEYG-GQGGFGGGPGGYGGQGGFGGGPGGFGGQGGFGGGQGG 98 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 378 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 434 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 435 GAPPPPAMGGGPPPAPPAPP 454 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 461 PPAPGGPGAPPPPPPPP 477 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 425 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 488 >DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GG GG G G GGGG GGG G G G Sbjct: 57 GWGGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G GGG GG GGG GG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G Sbjct: 57 GWGGGGGWGGG-GGGGGGGGGGRPGSGSGG 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG 870 G GGG G GGG GG GGG G G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G GG G GGGG GGG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G Sbjct: 59 GGGGGWGGGG----GGGGGGGGGRPGSGSG 84 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 381 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 437 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 438 GAPPPPAMGGGPPPAPPAPP 457 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 463 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 464 PPAPGGPGAPPPPPPPP 480 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 428 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 449 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 491 >BT003569-1|AAO39573.1| 745|Drosophila melanogaster LD44990p protein. Length = 745 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G G GG GG G G GG G G Sbjct: 406 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 448 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXG---GGG 807 GGG G GGG GG GG GGG GG G G GGG Sbjct: 405 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 454 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG GG G G V G G Sbjct: 410 GGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 452 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G G G G G G G G GG Sbjct: 407 GAGGGGGAGGGAASG-GAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGG 453 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G G G G GG GGG GG G GG G V Sbjct: 401 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGV 449 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG G G G G G G G Sbjct: 400 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAG 443 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG GG G G G G G GG Sbjct: 400 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 444 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG G GG Sbjct: 400 GGASAGGGAGGGGGAGGGAASGGAAAGG 427 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 524 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 580 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 581 GAPPPPAMGGGPPPAPPAPP 600 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 583 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 623 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 547 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 606 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 607 PPAPGGPGAPPPPPPPP 623 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 571 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 583 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 623 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 592 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 634 >AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p protein. Length = 108 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GG GG G G GGGG GGG G G G Sbjct: 57 GWGGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G GGG GG GGG GG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G Sbjct: 57 GWGGGGGWGGG-GGGGGGGGGGRPGSGSGG 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG 870 G GGG G GGG GG GGG G G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G GG G GGGG GGG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G Sbjct: 59 GGGGGWGGGG----GGGGGGGGGRPGSGSG 84 >AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GG GG G G GGGG GGG G G G Sbjct: 57 GWGGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G GGG GG GGG GG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G Sbjct: 57 GWGGGGGWGGG-GGGGGGGGGGRPGSGSGG 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG 870 G GGG G GGG GG GGG G G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G GG G GGGG GGG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G Sbjct: 59 GGGGGWGGGG----GGGGGGGGGRPGSGSG 84 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P PP PPP PP P P P PPPP Sbjct: 133 PLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPP 173 Score = 39.5 bits (88), Expect = 0.007 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PP PP P PPP PPP PP PP P PP Sbjct: 119 PPEDQPPEPPPLFQPLEPPPL----FQPPPDPPDDQPPPPSPP 157 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/55 (38%), Positives = 21/55 (38%), Gaps = 7/55 (12%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPP----PPXXXXPXXPPPXPPXXPPPXPXP---PPXP 951 PP P P P PP PP PPP PP PP P P PP P Sbjct: 119 PPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPP 173 Score = 38.3 bits (85), Expect = 0.015 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXX-PPPXPPPPXXPXPXPP--XPPPPP 944 P PP P P P PPP PP P P PP PP PP Sbjct: 120 PEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPP 165 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 PPP P P P P PPP PP PP PPP P Sbjct: 25 PPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPP 73 Score = 37.9 bits (84), Expect = 0.020 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PPP P P PP PPP Sbjct: 108 PELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPP 153 Score = 36.7 bits (81), Expect = 0.047 Identities = 24/80 (30%), Positives = 27/80 (33%) Frame = +1 Query: 700 HALXPXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXX 879 + L P P P +Q PP P+ L PP P P P PPP Sbjct: 11 YQLQPLPPPPPGDQPPPPPPEDQPLLILLGQ--AEDPPEDQPPDPPPLFQ-----PPPEE 63 Query: 880 XXPXXPPPXPPXXPPPXPXP 939 PPP PP P P Sbjct: 64 PPDDQPPPPPPLFQPLLKLP 83 Score = 35.9 bits (79), Expect = 0.082 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPP-PPXXXXPXXPPPX--PPXXPPPXPXPPPXP 951 P P P PP PP P PPP PP PP PPP P Sbjct: 108 PELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSP 156 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 3/62 (4%) Frame = +1 Query: 769 PIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXP 939 P+F PPPP P PP P PPPP PP P P P Sbjct: 138 PLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQ--PPPPLEGQALIMTLLPPDPPEDQPPP 195 Query: 940 PP 945 PP Sbjct: 196 PP 197 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +3 Query: 774 LXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXP---PPPXXPXPXPPXPPPP 941 L P P P P PP P P P PPP P P PPPP Sbjct: 16 LPPPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPPP 74 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/79 (27%), Positives = 25/79 (31%), Gaps = 9/79 (11%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXP---- 897 P +Q P P+ + PP P PP P PPP P Sbjct: 120 PEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEGQAL 179 Query: 898 -----PPXPPXXPPPXPXP 939 PP PP PP P P Sbjct: 180 IMTLLPPDPPEDQPPPPPP 198 Score = 34.3 bits (75), Expect = 0.25 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPP----PXPPPPXXPXPXPPXPPP 938 P P PP P PP PP PPPP P PP PPP Sbjct: 120 PEDQPPEPPPLFQPLEP-PPLFQPPPDPPDDQPPPPSPPLFHPPDPPP 166 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPP---XPPPPP 944 P P P P PP PPP P P P PPPPP Sbjct: 25 PPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPPDDQPPPPP 73 Score = 33.5 bits (73), Expect = 0.44 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 814 PPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-XPPXXPPPXPXPPPXP 951 P P P P P P PPP P PPP PPP P Sbjct: 100 PELPPDFQPELPELGQPEDPPEDQPPEPPPLFQPLEPPPLFQPPPDP 146 Score = 32.7 bits (71), Expect = 0.76 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P PP PPP PP P P PP P Sbjct: 51 PDPPPLFQPPPEEPPDDQPPPPPPLFQP 78 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P PPP P PP PPP Sbjct: 100 PELPPDFQPELPELGQPEDPPEDQP-PEPPPLFQPLEPPPLFQPPP 144 >AE014298-1796|AAF48189.3| 1470|Drosophila melanogaster CG17762-PD, isoform D protein. Length = 1470 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G G GG GG G G GG G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXG---GGG 807 GGG G GGG GG GG GGG GG G G GGG Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG GG G G V G G Sbjct: 1135 GGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 1177 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G G G G G G G G GG Sbjct: 1132 GAGGGGGAGGGAASG-GAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGG 1178 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G G G G GG GGG GG G GG G V Sbjct: 1126 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGV 1174 Score = 30.7 bits (66), Expect = 3.1 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 GGG G G G G GGGG G Sbjct: 828 GGGAGGSGGGGGASGGGGASG 848 Score = 30.7 bits (66), Expect = 3.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GG GG GG G GGG G G Sbjct: 829 GGAGGSGGGGGASGGGGASGAG 850 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 GG G GG G GGG G G G G Sbjct: 823 GGECGGGGAGGSGGGGGASGGGGASGAG 850 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG G G G G G G G Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAG 1168 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG GG G G G G G GG Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 1169 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG G GG Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGG 1152 >AE014298-1795|AAF48187.3| 1470|Drosophila melanogaster CG17762-PC, isoform C protein. Length = 1470 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G G GG GG G G GG G G Sbjct: 1131 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 1173 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXG---GGG 807 GGG G GGG GG GG GGG GG G G GGG Sbjct: 1130 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 1179 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG GG G G V G G Sbjct: 1135 GGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 1177 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G G G G G G G G GG Sbjct: 1132 GAGGGGGAGGGAASG-GAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGG 1178 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G G G G GG GGG GG G GG G V Sbjct: 1126 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGV 1174 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG G G G G G G G Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAG 1168 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG GG G G G G G GG Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 1169 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG G GG Sbjct: 1125 GGASAGGGAGGGGGAGGGAASGGAAAGG 1152 >AE014298-1794|AAF48188.3| 1173|Drosophila melanogaster CG17762-PB, isoform B protein. Length = 1173 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G G GG GG G G GG G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXG---GGG 807 GGG G GGG GG GG GGG GG G G GGG Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG GG G G V G G Sbjct: 838 GGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 880 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G G G G G G G G GG Sbjct: 835 GAGGGGGAGGGAASG-GAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGG 881 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G G G G GG GGG GG G GG G V Sbjct: 829 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGV 877 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG G G G G G G G Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAG 871 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG GG G G G G G GG Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 872 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG G GG Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGG 855 >AE014298-1793|AAF48190.3| 1173|Drosophila melanogaster CG17762-PA, isoform A protein. Length = 1173 Score = 40.3 bits (90), Expect = 0.004 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GG GG GG G G GG GG G G GG G G Sbjct: 834 GGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSG 876 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/50 (42%), Positives = 21/50 (42%), Gaps = 4/50 (8%) Frame = -2 Query: 944 GGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXGGXGXG---GGG 807 GGG G GGG GG GG GGG GG G G GGG Sbjct: 833 GGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGGG 882 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGGG GG G GG GG G G V G G Sbjct: 838 GGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGVTSG 880 Score = 32.7 bits (71), Expect = 0.76 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G GGG G G G G G G G G GG Sbjct: 835 GAGGGGGAGGGAASG-GAAAGGPAGGGAGAGSAAGAAGGVGSGVTSGG 881 Score = 31.1 bits (67), Expect = 2.3 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNV 798 G G G G GG GGG GG G GG G V Sbjct: 829 GASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGGVGSGV 877 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GG G G G GG G G G G G G G Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAG 871 Score = 29.5 bits (63), Expect = 7.1 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG GGG GG G G G G G GG Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGGPAGGGAGAGSAAGAAGG 872 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG GG G G GGG G GG Sbjct: 828 GGASAGGGAGGGGGAGGGAASGGAAAGG 855 >AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA protein. Length = 110 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G GG GG G G GGGG GGG G G G Sbjct: 57 GWGGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G G G GGG GG GGG GG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 36.3 bits (80), Expect = 0.062 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GGG G GGG GG GGG GG G G Sbjct: 57 GWGGGGGWGGG-GGGGGGGGGGRPGSGSGG 85 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXG 870 G GGG G GGG GG GGG G G Sbjct: 59 GGGGGWGGGGGGGGGGGGGRPGSGSGG 85 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G GG G GGGG GGG G G G Sbjct: 55 GNGWGGGGGWGGGGGGGGGGGGGRPGSG 82 Score = 34.7 bits (76), Expect = 0.19 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG GG G GGGG GGG G G Sbjct: 59 GGGGGWGGGG----GGGGGGGGGRPGSGSG 84 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 40.3 bits (90), Expect = 0.004 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP---XPXPPP 945 PP P P PP P PP P PP P PPP PPP Sbjct: 38 PPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGNGKPPP 86 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP-----PPPXXPXPXPPXPPPP 941 P PP T P P P PPP P PP PP PP P Sbjct: 25 PSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKP 71 Score = 34.3 bits (75), Expect = 0.25 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXP--XXPPPXPP-PPXXPXPXPPXPPP 938 P P V P P P PP PP PPP PP P P P P Sbjct: 25 PSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGNGKP 84 Query: 939 PP 944 PP Sbjct: 85 PP 86 Score = 31.1 bits (67), Expect = 2.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP PP P PP Sbjct: 30 PATYLPVKPPAPPPRPPPPAPANSYGPP 57 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 523 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 579 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 580 GAPPPPAMGGGPPPAPPAPP 599 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 622 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 546 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 605 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 606 PPAPGGPGAPPPPPPPP 622 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 570 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 582 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 622 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 591 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 633 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 378 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 434 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 435 GAPPPPAMGGGPPPAPPAPP 454 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 461 PPAPGGPGAPPPPPPPP 477 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 425 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 488 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 378 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 434 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 435 GAPPPPAMGGGPPPAPPAPP 454 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 461 PPAPGGPGAPPPPPPPP 477 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 425 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 488 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 378 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 434 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 435 GAPPPPAMGGGPPPAPPAPP 454 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 461 PPAPGGPGAPPPPPPPP 477 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 425 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 437 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 446 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 488 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 40.3 bits (90), Expect = 0.004 Identities = 24/80 (30%), Positives = 29/80 (36%), Gaps = 5/80 (6%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXP-----XXXXXXXPPPPXXXX 885 P+ P Q P +P + + + PP P P PP P P PP Sbjct: 381 PMNPSQQQQPGQVP---LNRMSSQGGPGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFN 437 Query: 886 PXXPPPXPPXXPPPXPXPPP 945 PPP PPP P PP Sbjct: 438 GAPPPPAMGGGPPPAPPAPP 457 Score = 40.3 bits (90), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PP P PPP PP PPPPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/77 (31%), Positives = 24/77 (31%), Gaps = 3/77 (3%) Frame = +1 Query: 730 PXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPX---PPXPXXXXXXXPPPPXXXXPXXPP 900 P P P P F A P PP PP P P PP P Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 463 Query: 901 PXPPXXPPPXPXPPPXP 951 P P P P PPP P Sbjct: 464 PPAPGGPGAPPPPPPPP 480 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 9/52 (17%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXP---------PPPXXPXPXPPXPPPPP 944 P P PP P P PPP P PPP P P PPPPP Sbjct: 428 PPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 36.7 bits (81), Expect = 0.047 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 780 PXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 P A P P PP P P P PPP PPPP Sbjct: 440 PPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 815 PXPPXPXNXXXXXXXXPXPXXPXXPPXPPPXPPXXPPPXPXPP 943 P P P P P P PP PPP P P P Sbjct: 449 PPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPGLGGAPKKEDP 491 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 39.9 bits (89), Expect = 0.005 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPPP P P P PPP PPP PP PPP P Sbjct: 696 PPPPPPMPASPTASSAAPPPP--------PPPAPPAPPPPPGFSP 732 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 2/70 (2%) Frame = +1 Query: 742 TXPPXIPXXPIFXLXAXRXTXXPPPPXP--XPPXPXXXXXXXPPPPXXXXPXXPPPXPPX 915 T PP P P + PPPP P PP P P PP PP Sbjct: 694 TLPPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPM 753 Query: 916 XPPPXPXPPP 945 P PPP Sbjct: 754 LSSFQPPPPP 763 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP PPP P PP P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPP 727 Score = 36.3 bits (80), Expect = 0.062 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P P P PP P P P PPP P P Sbjct: 698 PPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP 736 Score = 34.7 bits (76), Expect = 0.19 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PP PP PP P PPP Sbjct: 701 PMPASPTASSAAPPPPPPPAPPAPPPPP 728 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG G G GGGG GGG G G Sbjct: 60 GGGGSGSRGLQDPGGGGGGGGGGGGSVSG 88 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 792 AXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPP 902 A P P P P PP P PP PPPP Sbjct: 691 ASLTLPPPPPPMPASPTASSAAPPPPPPPAPPAPPPP 727 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P PP P PPP PP P P P P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSP 736 Score = 31.1 bits (67), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P P PPP P PP P Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAP 724 Score = 29.5 bits (63), Expect = 7.1 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG G G GGGG GGG G Sbjct: 61 GGGSGSRGLQDPGGGGGGGGGGGGSVSG 88 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GGGGG GG G G G G G Sbjct: 73 GGGGGGGGGGGGSVSGSVSGSG 94 Score = 29.1 bits (62), Expect = 9.4 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +3 Query: 525 PPPPXXPXPPXXXPSTXGRGSPLYXGXXGSTPDTXP**P----SXHPPP 659 PPPP P P P GSP G ST + P P S PPP Sbjct: 715 PPPPPAPPAPPPPPGFSPLGSP--SGSLASTAPSPPHAPPMLSSFQPPP 761 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-------XPPXXPPPXPXPPP 945 PPP P P P PPP P PPP PP P P P PPP Sbjct: 288 PPPPPASPSPSRSSSL--PPPASPSPSLPPPASPSLSLPPPASPSPSPSPPP 337 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXP-----PPPXXPXPXPPXPPP 938 P P P + P P P PPP PPP P P P PPP Sbjct: 290 PPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPP 338 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP-PPPXXXXP 888 P I+ + PP P P R + PPP P P P PPP P Sbjct: 276 PTSVIVTAGRKQPPPPPASP----SPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSP 331 Query: 889 XXPPPXPPXXPPPXPXP 939 PP P P P P Sbjct: 332 SPSPPPPAEATAPAPVP 348 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P P PP P PP P P P PP Sbjct: 959 PAEPEQPKPRARQRNQPPPPAPAHVPPVVQAPPAPAPEVLTPP 1001 >AY094834-1|AAM11187.1| 342|Drosophila melanogaster LD42296p protein. Length = 342 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G G GGG GG GGG G GGGG G G G GGGG +V A Sbjct: 64 GDHGGHGGGDFGGHGGGDFGGH--GGGGYEIHSHDG-GYSGGGGGGGHVNTYA 113 Score = 31.1 bits (67), Expect = 2.3 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 17/65 (26%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGG------XXGXXXXGGGG---------XXXXXXXGXGGXG 822 G GGG G GGG GG GGG G GGGG GG G Sbjct: 68 GHGGGDFGGHGGGDFGGHGGGGYEIHSHDGGYSGGGGGGGHVNTYAVITENHGYSSGGGG 127 Query: 821 XGGGG 807 GGGG Sbjct: 128 GGGGG 132 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/52 (40%), Positives = 21/52 (40%), Gaps = 7/52 (13%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPP-------XPPXXPPPXPXPPP 945 PPP P P P PPP P PPP PP P P P PPP Sbjct: 2555 PPPPPASPSPSRSSSL--PPPASPSPSLPPPASPSLSLPPPASPSPSPSPPP 2604 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXP-----PPPXXPXPXPPXPPP 938 P P P + P P P PPP PPP P P P PPP Sbjct: 2557 PPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSPSPSPPPP 2605 Score = 37.1 bits (82), Expect = 0.035 Identities = 23/77 (29%), Positives = 26/77 (33%), Gaps = 1/77 (1%) Frame = +1 Query: 712 PXVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXP-PPPXXXXP 888 P I+ + PP P P R + PPP P P P PPP P Sbjct: 2543 PTSVIVTAGRKQPPPPPASP----SPSRSSSLPPPASPSPSLPPPASPSLSLPPPASPSP 2598 Query: 889 XXPPPXPPXXPPPXPXP 939 PP P P P P Sbjct: 2599 SPSPPPPAEATAPAPVP 2615 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P P PP P PP P P P PP Sbjct: 3226 PAEPEQPKPRARQRNQPPPPAPAHVPPVVQAPPAPAPEVLTPP 3268 >AE013599-3979|AAF47289.2| 342|Drosophila melanogaster CG9083-PA protein. Length = 342 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/53 (45%), Positives = 25/53 (47%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXA 786 G G GGG GG GGG G GGGG G G G GGGG +V A Sbjct: 64 GDHGGHGGGDFGGHGGGDFGGH--GGGGYEIHSHDG-GYSGGGGGGGHVNTYA 113 Score = 31.1 bits (67), Expect = 2.3 Identities = 25/65 (38%), Positives = 25/65 (38%), Gaps = 17/65 (26%) Frame = -2 Query: 950 GXGGGX--GXGGGXXGGXGGG------XXGXXXXGGGG---------XXXXXXXGXGGXG 822 G GGG G GGG GG GGG G GGGG GG G Sbjct: 68 GHGGGDFGGHGGGDFGGHGGGGYEIHSHDGGYSGGGGGGGHVNTYAVITENHGYSSGGGG 127 Query: 821 XGGGG 807 GGGG Sbjct: 128 GGGGG 132 >U62542-1|AAB05771.1| 901|Drosophila melanogaster dead ringer protein. Length = 901 Score = 39.5 bits (88), Expect = 0.007 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G G G GGGG GGG G GG G Sbjct: 195 GGGTAGPGGTGGSGGGGAGGGGGGGGGVG 223 Score = 35.9 bits (79), Expect = 0.082 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG GG GGG GG G Sbjct: 200 GPGGTGGSGGGGAGGGGGGGGGVGG 224 Score = 34.3 bits (75), Expect = 0.25 Identities = 16/25 (64%), Positives = 16/25 (64%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG GG G G GGGG GGG G Sbjct: 202 GGTGGSGGGGAG--GGGGGGGGVGG 224 Score = 33.9 bits (74), Expect = 0.33 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GG GG G G G GG GGG G GG Sbjct: 200 GPGGTGGSGGG--GAGGGGGGGGGVGG 224 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G G G GG GG GGG GG G G Sbjct: 197 GTAGPGGTGGSGGGGAGGGGGGGGGVGG 224 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXG 868 GGG GG G GGG GG G G Sbjct: 195 GGGTAGPGGTGGSGGGGAGGGGGGGG 220 Score = 29.1 bits (62), Expect = 9.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 GGG G GG G G GG G GG Sbjct: 195 GGGTAGPGGTGGSGGGGAGGGGGGGGGVGG 224 >BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p protein. Length = 157 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GG GG GGG G GG G GG G GGG Sbjct: 72 GKGGPGGRGG--PGGKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GG G GGG GG GGG G G G GG G +G R Sbjct: 34 GGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRN 93 Query: 765 XGNXWGG 745 GG Sbjct: 94 GPGGSGG 100 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG G GGG GG G Sbjct: 25 GSRGGPGAGGGAPGAGGGGPGGRGG 49 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG GG GGGG GGG G Sbjct: 96 GGSGGPGGRN-APNGGGGGGGGPFG 119 Score = 29.1 bits (62), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G G G G G G G GG GGG Sbjct: 29 GPGAGGGAPGAGGGGPGGRGGG 50 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 39.5 bits (88), Expect = 0.007 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P PPP PPPP P PP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 39.1 bits (87), Expect = 0.009 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP PPPP P PPP P Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 38.7 bits (86), Expect = 0.012 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P P PP P P P P P P Sbjct: 339 PPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 Score = 38.3 bits (85), Expect = 0.015 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PPPP P P PPP Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPP 361 Score = 37.5 bits (83), Expect = 0.027 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP PP P PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 35.9 bits (79), Expect = 0.082 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPP------XPXPPP 946 P P PP PPP PP PPP P PPP Sbjct: 328 PSPVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPP 361 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P PP P PPP PP P PP P Sbjct: 328 PSPVTAAPPPPPPPPPP--PPPPPPAQTSAIPSPPPFP 363 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P PPP PP PPP P PP Sbjct: 328 PSPVTAAPPPPPP-PP--PPPPPPPP 350 >AY071607-1|AAL49229.1| 174|Drosophila melanogaster RE65554p protein. Length = 174 Score = 39.5 bits (88), Expect = 0.007 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGG 813 G GGG G GGG G G G G GGG GG G GG Sbjct: 43 GFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGG 88 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GGG G G G G GG GG G GGG Sbjct: 37 GLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGG 83 Score = 35.5 bits (78), Expect = 0.11 Identities = 19/47 (40%), Positives = 19/47 (40%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GGG G GGG G G G GGG G G GGG Sbjct: 49 GFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGG 95 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXG 822 G GGG G GG G G G G GGG GG G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPG 97 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXG-GGXXGXGGXGXXXXXVXGGXGXGXXG 806 G GG G G G GGG G GG G GG G G G G Sbjct: 43 GFGGGPGFGGGPGFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGG 88 Score = 29.9 bits (64), Expect = 5.4 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 G GGG G G GGG GG G GG G G G Sbjct: 55 GFGGGPGFGGRPGFGGGPGFGGGPGFGGGQGFGGRPGFGGGPG 97 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PP PPP P P PPP P P PPP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX--PXXPPPXPPP-PXXPXPXPPXPPPPP 944 P P PP P PP P PP PPP P P PPPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.035 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPX-------PXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPP P PPP PP PPP P Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P A V P P PP P P PPPP PPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P P PPPP PPP P P Sbjct: 394 PPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PP PPP P P PPP P P PPP P Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX--PXXPPPXPPP-PXXPXPXPPXPPPPP 944 P P PP P PP P PP PPP P P PPPPP Sbjct: 367 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 415 Score = 37.1 bits (82), Expect = 0.035 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPX-------PXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPP P PPP PP PPP P Sbjct: 372 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P A V P P PP P P PPPP PPPPP Sbjct: 369 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 427 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P P PPPP PPP P P Sbjct: 394 PPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 433 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P PP PPP P P PPP P P PPP P Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 39.1 bits (87), Expect = 0.009 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPX--PXXPPPXPPP-PXXPXPXPPXPPPPP 944 P P PP P PP P PP PPP P P PPPPP Sbjct: 483 PVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPP 531 Score = 37.1 bits (82), Expect = 0.035 Identities = 21/56 (37%), Positives = 21/56 (37%), Gaps = 8/56 (14%) Frame = +1 Query: 808 PPPPX-------PXPPXPXXXXXXXPPP-PXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPP P PPP PP PPP P Sbjct: 488 PPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 34.7 bits (76), Expect = 0.19 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +3 Query: 768 PYLXPXXXAXXVXPXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P A V P P PP P P PPPP PPPPP Sbjct: 485 PVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPP 543 Score = 31.9 bits (69), Expect = 1.3 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPP 927 PP P P P PPPP PPP P P Sbjct: 510 PPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPPPMQKSQP 549 >AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-PA protein. Length = 157 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/47 (44%), Positives = 21/47 (44%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 G GG G GG GG GGG G GG G GG G GGG Sbjct: 72 GKGGPGGRGG--PGGKGGGPGGRNGPGGSGGPGGRNAPNGGGGGGGG 116 Score = 34.7 bits (76), Expect = 0.19 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXGXXXXXXXXXXGXGGXGXXXXRXXRGXEXEDRG 766 GG G GGG GG GGG G G G GG G +G R Sbjct: 34 GGAPGAGGGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRN 93 Query: 765 XGNXWGG 745 GG Sbjct: 94 GPGGSGG 100 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G GGG G GGG GG G Sbjct: 25 GSRGGPGAGGGAPGAGGGGPGGRGG 49 Score = 30.7 bits (66), Expect = 3.1 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GG GG GG GGGG GGG G Sbjct: 96 GGSGGPGGRN-APNGGGGGGGGPFG 119 Score = 29.1 bits (62), Expect = 9.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G G G G G G G GG GGG Sbjct: 29 GPGAGGGAPGAGGGGPGGRGGG 50 >AE014134-1714|AAS64673.2| 1701|Drosophila melanogaster CG33300-PA protein. Length = 1701 Score = 39.5 bits (88), Expect = 0.007 Identities = 19/44 (43%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 816 PXPX-PPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P P P P P PP P P PP PP PP Sbjct: 1622 PLPDLPPLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPP 1665 Score = 32.7 bits (71), Expect = 0.76 Identities = 17/45 (37%), Positives = 17/45 (37%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P P P PP P P PP P PP P PP P Sbjct: 1622 PLPDLP-PLPLPLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPP 1665 Score = 32.3 bits (70), Expect = 1.0 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 816 PXPXPPXTXXXXX-PXPPXPXXPPPXPP-PPXXPXP 917 P P PP P PP P PP PP PP P P Sbjct: 1632 PLPWPPLPLPEIPLPLPPLPTALPPLPPLPPLPPLP 1667 Score = 30.3 bits (65), Expect = 4.1 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXP-PPXP 933 P P P PP P P P P PP PP P PP P Sbjct: 1630 PLPLPWPPLPLPEI----PLPLPPLPTALPPLPPLPPLPPLP 1667 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 39.5 bits (88), Expect = 0.007 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPP 941 P PP P PPP PPPP P PP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 39.1 bits (87), Expect = 0.009 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 PP P PPP PPPP P PPP P Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 38.7 bits (86), Expect = 0.012 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P P PP P P P P P P Sbjct: 339 PPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 Score = 38.3 bits (85), Expect = 0.015 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 864 PXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PPPP P P PPP Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPP 361 Score = 37.5 bits (83), Expect = 0.027 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPP P PPP PP P PPP P Sbjct: 335 PPPPPPPPPPPPPPPPAQTSAIPSPPPFP 363 Score = 35.9 bits (79), Expect = 0.082 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPP------XPXPPP 946 P P PP PPP PP PPP P PPP Sbjct: 328 PSPVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPP 361 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPP 935 P P P PP P PPP PP P PP P Sbjct: 328 PSPVTAAPPPPPPPPPP--PPPPPPAQTSAIPSPPPFP 363 Score = 30.3 bits (65), Expect = 4.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 Query: 865 PPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P PPP PP PPP P PP Sbjct: 328 PSPVTAAPPPPPP-PP--PPPPPPPP 350 >AY052130-1|AAK93554.1| 455|Drosophila melanogaster SD08037p protein. Length = 455 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GGG GGGG G GG G GGGG Sbjct: 336 GGGRGGGGNFRGGRGGG-------GGGGFGG----GRGGGGGGGGG 370 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG G G GGGG GGG G GG G Sbjct: 340 GGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GGGG GGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG GG GG GGG G GGGG Sbjct: 338 GRGGGGNFRGGRGGGGGGGFGGGRGGGGGG 367 Score = 35.1 bits (77), Expect = 0.14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXG 889 G GGG G GGG GG GGG G Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GG GG GG G G GGG GGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGGG 368 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 G G G GGG GG GGG GG G Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGGG 370 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 951 GXGGGXGXG-GGXXGGXGGGXGG 886 G GGG G G GG GG GGG GG Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGGG 370 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G G G G GGG GGG GG G Sbjct: 417 GGRDGGGRDGGGRDGGGRDGGGRGRGGGGG 446 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G GGGG GG G Sbjct: 431 GGGRDGGGRGRGGGGGRGGYRGG 453 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG-GGXXGXGG 860 GGG GG G GGG G GG G GG Sbjct: 421 GGGRDGGGRDGGGRDGGGRGRGGGGGRGG 449 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG GGG G GGG GG G Sbjct: 428 GRDGGGRDGGGRGRGGGGGRGGYRG 452 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGG 861 G GG G G GG G GG G GGGG Sbjct: 340 GGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AM294873-1|CAL26859.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGGG GG G G G GG G G GG Sbjct: 57 GGGGGSGGGGGGGSGSGGGSGSGDGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G G G G GG G GG G Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 58 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G GGGG G G G G G GG Sbjct: 55 GGGGGGGSG----GGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 61 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GGG G GG G G GG G GG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 89 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGS----------GSGDGGGG 84 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 58 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 87 >AM294870-1|CAL26856.1| 155|Drosophila melanogaster CG10853 protein. Length = 155 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGGG GG G G G GG G G GG Sbjct: 57 GGGGGSGGGGGGGSGSGGGSGSGDGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGGG G G G G G GG G GG G Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGG 84 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG GG G G GGG G G G G G Sbjct: 58 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 87 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/38 (47%), Positives = 18/38 (47%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGG 827 GGGG GG G GGGG G G G G G GG Sbjct: 55 GGGGGGGSG----GGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 33.5 bits (73), Expect = 0.44 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G G G GG G G GG G Sbjct: 61 GSGGGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 911 GGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGG 810 GG GGG G GG G G GG G GG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGG 88 Score = 31.9 bits (69), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -3 Query: 901 GGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GGGG G G G GG G G G G G T Sbjct: 56 GGGGGGSGGGGGGGSGSGGGSGSGDGGGGAIGGT 89 Score = 31.5 bits (68), Expect = 1.8 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GGG G GGG G G GGGG Sbjct: 55 GGGGGGGSGGGGGGGSGSGGGS----------GSGDGGGG 84 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 G GG G GGG G GG G G G Sbjct: 58 GGGGSGGGGGGGSGSGGGSGSGDGGGGAIG 87 >AE014298-1529|AAF47983.2| 2602|Drosophila melanogaster CG2174-PA, isoform A protein. Length = 2602 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P P P P PP P PPP P PP Sbjct: 1417 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1462 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXP---PXPPP 938 P P PP PP P P P PP PP P P P PP Sbjct: 1417 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1462 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP PP P P P P PP P P P Sbjct: 1417 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSP 1461 Score = 29.9 bits (64), Expect = 5.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPX---PXPPXPXXXXXXXPPPPXXXXPXXPPPXPP--XXPPPXPXPPPXP 951 P PP P P PPPP PP PP PP P P P Sbjct: 1419 PAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1471 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP PP P P PP P P P Sbjct: 1433 PAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1471 >AE014298-1528|ABI30975.1| 2693|Drosophila melanogaster CG2174-PB, isoform B protein. Length = 2693 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PPP P P P P P PP P PPP P PP Sbjct: 1508 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1553 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPP--PPXXPXPXP---PXPPP 938 P P PP PP P P P PP PP P P P PP Sbjct: 1508 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPP 1553 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/45 (33%), Positives = 15/45 (33%) Frame = +1 Query: 817 PXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP PP P P P P PP P P P Sbjct: 1508 PPPAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSP 1552 Score = 29.9 bits (64), Expect = 5.4 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPX---PXPPXPXXXXXXXPPPPXXXXPXXPPPXPP--XXPPPXPXPPPXP 951 P PP P P PPPP PP PP PP P P P Sbjct: 1510 PAPPSGGWPGVLLPPAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1562 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P PP PP P P PP P P P Sbjct: 1524 PAPSVPAPPPPIRPPSMAPPAPPPAPQSPPTARSPEPEP 1562 >AE014297-3872|AAF56525.1| 454|Drosophila melanogaster CG5913-PA protein. Length = 454 Score = 39.1 bits (87), Expect = 0.009 Identities = 23/46 (50%), Positives = 23/46 (50%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG G GG GG GGG GGGG G GG G GGGG Sbjct: 336 GGGRGGGGNFRGGRGGG-------GGGGFGG----GRGGGGGGGGG 370 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/29 (58%), Positives = 17/29 (58%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGGG G G GGGG GGG G GG G Sbjct: 340 GGGGNFRGGRGGGGGGGFGGGRGGGGGGG 368 Score = 37.9 bits (84), Expect = 0.020 Identities = 15/21 (71%), Positives = 15/21 (71%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGG 878 GGGG GG G G GGGG GGG Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G GGG GG GG GGG G GGGG Sbjct: 338 GRGGGGNFRGGRGGGGGGGFGGGRGGGGGG 367 Score = 35.1 bits (77), Expect = 0.14 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXG 889 G GGG G GGG GG GGG G Sbjct: 350 GGGGGGGFGGGRGGGGGGGGG 370 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 GG GG GG G G GGG GGG Sbjct: 347 GGRGGGGGGGFGGGRGGGGGGG 368 Score = 33.9 bits (74), Expect = 0.33 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXG 877 G G G GGG GG GGG GG G Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGGG 370 Score = 33.1 bits (72), Expect = 0.58 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -1 Query: 951 GXGGGXGXG-GGXXGGXGGGXGG 886 G GGG G G GG GG GGG GG Sbjct: 348 GRGGGGGGGFGGGRGGGGGGGGG 370 Score = 32.7 bits (71), Expect = 0.76 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG G G G G GGG GGG GG G Sbjct: 416 GGRDGGGRDGGGRDGGGRDGGGRGRGGGGG 445 Score = 30.7 bits (66), Expect = 3.1 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G GGGG GG G Sbjct: 430 GGGRDGGGRGRGGGGGRGGYRGG 452 Score = 30.3 bits (65), Expect = 4.1 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXG-GGXXGXGG 860 GGG GG G GGG G GG G GG Sbjct: 420 GGGRDGGGRDGGGRDGGGRGRGGGGGRGG 448 Score = 29.9 bits (64), Expect = 5.4 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG GGG G GGG GG G Sbjct: 427 GRDGGGRDGGGRGRGGGGGRGGYRG 451 Score = 29.5 bits (63), Expect = 7.1 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXG-GGXXGXXXXGGGG 861 G GG G G GG G GG G GGGG Sbjct: 340 GGGGNFRGGRGGGGGGGFGGGRGGGGGGGGG 370 >AE014134-1928|AAF52988.1| 96|Drosophila melanogaster CG17107-PA protein. Length = 96 Score = 39.1 bits (87), Expect = 0.009 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 G GG GG G G GGGG GGG G GG Sbjct: 23 GFGGFGGGGGGGGRGGGGGGGGVGGVGG 50 Score = 37.1 bits (82), Expect = 0.035 Identities = 18/30 (60%), Positives = 18/30 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GG GG GG G G GGG GGG G GG G Sbjct: 22 GGFGGFGGGGGGGGRGGGGGGG--GVGGVG 49 Score = 35.9 bits (79), Expect = 0.082 Identities = 21/68 (30%), Positives = 22/68 (32%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 G GG G GGG G GGG G GG GGG + A Sbjct: 23 GFGGFGGGGGGGGRGGGGGGGGVGGVGGSNAVANANAAATADSRGGGPASASASATATAN 82 Query: 770 GXXGXXGG 747 G GG Sbjct: 83 ASSGGGGG 90 >AE013599-1122|AAF58779.3| 757|Drosophila melanogaster CG12052-PJ, isoform J protein. Length = 757 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGG GGG G GG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GG GG G G GGGG GGG Sbjct: 678 GSGGAGGGIGGGGSGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 G GGG GG G G GGGG GG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G G G GG GGG G Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GGG GG GGG GG Sbjct: 681 GAGGGIG-GGGSGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG G GG G GGGG Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGG 697 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGG GGG G GG G Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGG 698 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 667 GSVAGNWSSGGGSGGAGGGIGGGGSGGGGG 696 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G G G G GGG GG G Sbjct: 677 GGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G G GG GGG G G G G G T Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGGGGGGAYACDRCGNT 711 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 39.1 bits (87), Expect = 0.009 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 862 PPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P PP P P PP PPP P PPP P Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPPPPP 242 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXP 932 P PP P P PPP PPPP P P P Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPPPPPPPPPPTLSPSLP 249 Score = 35.5 bits (78), Expect = 0.11 Identities = 18/33 (54%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Frame = +3 Query: 855 PXPPXPXXPPPXP---PPPXXPXPXPPXPPPPP 944 P PP P P P PPP P P PP PPPPP Sbjct: 213 PRPP-PFYKPSRPNRRPPP--PPPPPPPPPPPP 242 Score = 34.3 bits (75), Expect = 0.25 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 869 PXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP PPP P P Sbjct: 221 PSRPNRRPPPPPPPPPPPPPPPTLSP 246 Score = 33.1 bits (72), Expect = 0.58 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXP 911 P P + P PP P PPP PPP P Sbjct: 215 PPPFYKPSRPNRRPPPPPPPPPPPPPPPTLSP 246 Score = 33.1 bits (72), Expect = 0.58 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 879 PPPXPPPPXXPXPXPPXPPPPP 944 PPP PPPP P P P P P Sbjct: 228 PPPPPPPPPPPPPPPTLSPSLP 249 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXP 933 PPP P P PPPP P PPP PP P P Sbjct: 215 PPPFYKPSRPNRRPP--PPPP----PPPPPPPPPTLSPSLP 249 Score = 31.1 bits (67), Expect = 2.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXP 923 P P P P PP P PPP PPPP P Sbjct: 213 PRPPPFYKPSRPNRRPPPPPPP--PPPPPPPPTLSPSLP 249 Score = 30.7 bits (66), Expect = 3.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 886 PXXPPPXPPXXPPPXPXPPPXP 951 P PPP PP PPP P P Sbjct: 228 PPPPPPPPPPPPPPPTLSPSLP 249 >AB107346-1|BAC67651.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGG GGG G GG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GG GG G G GGGG GGG Sbjct: 678 GSGGAGGGIGGGGSGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 G GGG GG G G GGGG GG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G G G GG GGG G Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GGG GG GGG GG Sbjct: 681 GAGGGIG-GGGSGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG G GG G GGGG Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGG 697 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGG GGG G GG G Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGG 698 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 667 GSVAGNWSSGGGSGGAGGGIGGGGSGGGGG 696 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G G G G GGG GG G Sbjct: 677 GGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G G GG GGG G G G G G T Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGGGGGGAYACDRCGNT 711 >AB107326-1|BAC67631.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGG GGG G GG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GG GG G G GGGG GGG Sbjct: 678 GSGGAGGGIGGGGSGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 G GGG GG G G GGGG GG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G G G GG GGG G Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GGG GG GGG GG Sbjct: 681 GAGGGIG-GGGSGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG G GG G GGGG Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGG 697 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGG GGG G GG G Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGG 698 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 667 GSVAGNWSSGGGSGGAGGGIGGGGSGGGGG 696 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G G G G GGG GG G Sbjct: 677 GGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G G GG GGG G G G G G T Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGGGGGGAYACDRCGNT 711 >AB107306-1|BAC67611.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGG GGG G GG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GG GG G G GGGG GGG Sbjct: 678 GSGGAGGGIGGGGSGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 G GGG GG G G GGGG GG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G G G GG GGG G Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GGG GG GGG GG Sbjct: 681 GAGGGIG-GGGSGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG G GG G GGGG Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGG 697 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGG GGG G GG G Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGG 698 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 667 GSVAGNWSSGGGSGGAGGGIGGGGSGGGGG 696 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G G G G GGG GG G Sbjct: 677 GGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G G GG GGG G G G G G T Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGGGGGGAYACDRCGNT 711 >AB107286-1|BAC67591.1| 757|Drosophila melanogaster Lola protein isoform O protein. Length = 757 Score = 39.1 bits (87), Expect = 0.009 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG GG G G GGG GGG G GG Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGG 878 G GG GG G G GGGG GGG Sbjct: 678 GSGGAGGGIGGGGSGGGGGGGG 699 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGG 881 G GGG GG G G GGGG GG Sbjct: 681 GAGGGIGGGGSGGGGGGGGGG 701 Score = 34.7 bits (76), Expect = 0.19 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXG 869 GGG G G G G G GG GGG G Sbjct: 676 GGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 33.5 bits (73), Expect = 0.44 Identities = 15/22 (68%), Positives = 15/22 (68%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GGG G GGG GG GGG GG Sbjct: 681 GAGGGIG-GGGSGGGGGGGGGG 701 Score = 32.3 bits (70), Expect = 1.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGGGG 700 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = -2 Query: 902 GGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GG G GGG G GG G GGGG Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGG 697 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 G G G G GGG GGG G GG G Sbjct: 671 GNWSSGGGSGGAGGGIGGGGSGGGGGGG 698 Score = 31.1 bits (67), Expect = 2.3 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = -2 Query: 950 GXGGGXGXGGGXXGGXGGGXXGXXXXGGGG 861 G G GG GG GGG G GGGG Sbjct: 667 GSVAGNWSSGGGSGGAGGGIGGGGSGGGGG 696 Score = 30.3 bits (65), Expect = 4.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXG 877 G GG G G G G GGG GG G Sbjct: 677 GGSGGAGGGIGGGGSGGGGGGGGGG 701 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXGXT 800 GG G G GG GGG G G G G G T Sbjct: 666 GGSVAGNWSSGGGSGGAGGGIGGGGSGGGGGGGGGGAYACDRCGNT 711 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 38.7 bits (86), Expect = 0.012 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPP 900 P P T P P T PPPP P P P PP Sbjct: 119 PPAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPP---PNYDYDYDYDAQPAAPAEPPPPPP 175 Query: 901 PXPPXXPPPXPXPPPXP 951 P PP PP P P P P Sbjct: 176 PPPPPTAPPRPRPRPRP 192 Score = 37.5 bits (83), Expect = 0.027 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +1 Query: 793 RXTXXPPPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 R T PPP P P P PPP P P P P P P P Sbjct: 142 RPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRP 194 Score = 37.1 bits (82), Expect = 0.035 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P PP PPPP P PP P P P Sbjct: 148 PPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRP 190 Score = 36.3 bits (80), Expect = 0.062 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 861 PPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PPP PPPP P P P P P Sbjct: 167 PAEPPPPPPPPPPPTAPPRPRPRPRPRP 194 Score = 36.3 bits (80), Expect = 0.062 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P PP P PPP PP P P P P P Sbjct: 170 PPPPPPPPPPPTAPPRPRPRPRPRPQQPDP 199 Score = 34.7 bits (76), Expect = 0.19 Identities = 22/64 (34%), Positives = 22/64 (34%), Gaps = 16/64 (25%) Frame = +1 Query: 808 PPPPXPXPPXPXXXXXXXP-----PPPXXXXPXXPP-----------PXPPXXPPPXPXP 939 P PP P PP P P P P PP P P PPP P P Sbjct: 117 PRPPAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPP 176 Query: 940 PPXP 951 PP P Sbjct: 177 PPPP 180 Score = 34.3 bits (75), Expect = 0.25 Identities = 29/124 (23%), Positives = 32/124 (25%), Gaps = 1/124 (0%) Frame = +1 Query: 535 PXPPXPPPXXXVPXAXXXPFXEGXXXXXXXXXXXXXXXTPXLXCPXPTXLSXKFRHALXP 714 P PP PP + PF P P P R + P Sbjct: 78 PPPPPPPAPIRIRKPIWHPFFSSGFLPGAFDVDYADPPAPRPPAPAPPTTQPPRR--VRP 135 Query: 715 XVPILPXNQTXPPXIPXXPIFXLXAXRXTXXPP-PPXPXPPXPXXXXXXXPPPPXXXXPX 891 V P T P P + P PP P PP P P P P Sbjct: 136 QVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPPRPRPRPRPRPQ 195 Query: 892 XPPP 903 P P Sbjct: 196 QPDP 199 Score = 33.9 bits (74), Expect = 0.33 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P PP PPP P P P P P P Sbjct: 167 PAEPPPPPPPPPPPTAPPRPRPRPRPRP 194 >AE014134-2984|AAF53715.3| 1377|Drosophila melanogaster CG10600-PA protein. Length = 1377 Score = 33.1 bits (72), Expect(2) = 0.014 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +3 Query: 882 PPXPPPPXXPXPXPPXPPPPP 944 PP PP P PP PPPPP Sbjct: 1259 PPLPPLPPSRTSAPPPPPPPP 1279 Score = 24.2 bits (50), Expect(2) = 0.014 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 861 PPXPXXPPPXPPPP 902 PP P P PPPP Sbjct: 1223 PPVPIVAAPAPPPP 1236 >BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p protein. Length = 1327 Score = 38.3 bits (85), Expect = 0.015 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +3 Query: 882 PPXPPPPXXPXPXPPXPPP 938 PP PPPP P P PP PPP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 887 PPXPPPXPPXXPPPXPXPP 943 PP PPP PPP P PP Sbjct: 4 PPLPPPPVQPAPPPPPPPP 22 Score = 30.3 bits (65), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXP 923 P PP PPP PPPP P Sbjct: 7 PPPPVQPAPPPPPPPPEEDLSPP 29 Score = 29.9 bits (64), Expect = 5.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPP 902 P PP P P P PPPP Sbjct: 5 PLPPPPVQPAPPPPPP 20 Score = 29.1 bits (62), Expect = 9.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 868 PPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P P P PP PP PP Sbjct: 4 PPLPPPPVQPAPPPPPPPPEEDLSPP 29 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 38.3 bits (85), Expect = 0.015 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P PPPP PPP PP P P PPP Sbjct: 587 PPAPPMLKAIPPPPPPMAPSMMPPPPPPC--PGAPPPPP 623 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPPP P PPPPP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPP-----CPGAPPPPP 623 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 808 PPPPXPX----PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPP P PP P PPP P PPP P P PP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPAPP 634 Score = 34.3 bits (75), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP P P PPP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPP 613 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXP-----XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P P P P P Sbjct: 597 PPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPAPPKVDLPKKNVPQPTNP 649 Score = 29.9 bits (64), Expect = 5.4 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP--XPPXPXXXXXXXPPPPXXXXPXX 894 P P + PP P P+ A PPPP P PP P P PP P Sbjct: 588 PAPPMLKAIPP--PPPPM----APSMMPPPPPPCPGAPPPPPSMAQTMAPAPPKVDLPKK 641 Query: 895 PPPXP 909 P P Sbjct: 642 NVPQP 646 >AY119041-1|AAM50901.1| 393|Drosophila melanogaster LP06455p protein. Length = 393 Score = 38.3 bits (85), Expect = 0.015 Identities = 17/28 (60%), Positives = 17/28 (60%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGGGG GG G G G G GGG G GG Sbjct: 169 GGGGGLGGNGGGGGGLLGGGGGDNGGGG 196 Score = 35.5 bits (78), Expect = 0.11 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GG G GGG GG GG GG G G Sbjct: 173 GLGGNGGGGGGLLGGGGGDNGGGGGLLG 200 Score = 35.1 bits (77), Expect = 0.14 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 937 GGGXGGXGXGXXGGGGXGGGXXGXGG 860 GGG G G G G GG GGG G GG Sbjct: 164 GGGLLGGGGGLGGNGGGGGGLLGGGG 189 Score = 34.7 bits (76), Expect = 0.19 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXG 868 GGG GGG GG GGG GG G G Sbjct: 164 GGGLLGGGGGLGGNGGGGGGLLGGGG 189 Score = 34.3 bits (75), Expect = 0.25 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGGXXGXXG 868 G GGG G GG GG GG GG G G Sbjct: 169 GGGGGLGGNGGGGGGLLGGGGGDNGGGG 196 Score = 32.3 bits (70), Expect = 1.0 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = -2 Query: 926 GGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 GGG GG GG G GGGG G GG GGGG Sbjct: 164 GGGLLGGGGG--LGGNGGGGGG----LLGGGGGDNGGGGG 197 >AY118955-1|AAM50815.1| 911|Drosophila melanogaster LD35748p protein. Length = 911 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGG 860 GG G GG G GGGG GGG G GG Sbjct: 204 GGTAGPGGTGGSGGGGGGGGGGGGGVGG 231 Score = 35.9 bits (79), Expect = 0.082 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXG 854 GGG G G G GGGG GGG G G G Sbjct: 203 GGGTAGPGGTGGSGGGGGGGGGGGGGVGG 231 Score = 34.3 bits (75), Expect = 0.25 Identities = 14/22 (63%), Positives = 14/22 (63%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G GG G GGG GG GGG GG Sbjct: 210 GGTGGSGGGGGGGGGGGGGVGG 231 Score = 32.7 bits (71), Expect = 0.76 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 945 GGGXGXGGGXXGGXGGGXGGXXGXXGXG 862 GGG GG G GGG GG G G G Sbjct: 203 GGGTAGPGGTGGSGGGGGGGGGGGGGVG 230 Score = 31.9 bits (69), Expect = 1.3 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXG 889 G GG G GGG GG GGG G Sbjct: 208 GPGGTGGSGGGGGGGGGGGGG 228 Score = 29.5 bits (63), Expect = 7.1 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 951 GXGGGXGXGGGXXGGXGGGXGG 886 G G G GG GG GGG GG Sbjct: 205 GTAGPGGTGGSGGGGGGGGGGG 226 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 38.3 bits (85), Expect = 0.015 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +1 Query: 829 PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPP 945 PP P PPPP PPP PP P P PPP Sbjct: 548 PPAPPMLKAIPPPPPPMAPSMMPPPPPPC--PGAPPPPP 584 Score = 37.9 bits (84), Expect = 0.020 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P PP P PP P PPPP P PPPPP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPP-----CPGAPPPPP 584 Score = 36.3 bits (80), Expect = 0.062 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 4/49 (8%) Frame = +1 Query: 808 PPPPXPX----PPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 PPP P PP P PPP P PPP P P PP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPAPP 595 Score = 34.3 bits (75), Expect = 0.25 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P PPP PP P P PPP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPP 574 Score = 31.1 bits (67), Expect = 2.3 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 5/53 (9%) Frame = +1 Query: 808 PPPPXP-----XPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 PPPP P PP P PPPP P P P P P Sbjct: 558 PPPPPPMAPSMMPPPPPPCPGAPPPPPSMAQTMAPAPPKVDLPKKNVPQPTNP 610 Score = 29.9 bits (64), Expect = 5.4 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 2/65 (3%) Frame = +1 Query: 721 PILPXNQTXPPXIPXXPIFXLXAXRXTXXPPPPXP--XPPXPXXXXXXXPPPPXXXXPXX 894 P P + PP P P+ A PPPP P PP P P PP P Sbjct: 549 PAPPMLKAIPP--PPPPM----APSMMPPPPPPCPGAPPPPPSMAQTMAPAPPKVDLPKK 602 Query: 895 PPPXP 909 P P Sbjct: 603 NVPQP 607 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 38.3 bits (85), Expect = 0.015 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 822 PXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P + PP P P P P P PP PPPPP Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPP 487 Score = 37.9 bits (84), Expect = 0.020 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 816 PXPXPPXTXXXXXPXPPXPXXPPPXPPPPXXPXPXPPXPPPPP 944 P P P P P P P P P PP PPPPP Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 489 Score = 37.9 bits (84), Expect = 0.020 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +2 Query: 863 PXPXXPXXPPXPPPXPPXXPPPXPXPPP 946 P P P P P PP PPP P PPP Sbjct: 463 PEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Score = 37.5 bits (83), Expect = 0.027 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +1 Query: 823 PXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPPPXP 951 P P PP P P P P PPP P PPP P Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPP 489 Score = 37.1 bits (82), Expect = 0.035 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = +3 Query: 855 PXPPXPXXPPPXPPPPXXPXPXPPXPPP 938 P P P P PPP P P PP PPP Sbjct: 463 PEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Score = 36.7 bits (81), Expect = 0.047 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 807 PXXPXPXPPXTXXXXXPXPPXPXXPPPXPPP 899 P P P P P PP P PPP PPP Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 Score = 33.9 bits (74), Expect = 0.33 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +1 Query: 811 PPPXPXPPXPXXXXXXXPPPPXXXXPXXPPPXPPXXPPPXPXPP 942 P P P P P PP PP PPP P PP Sbjct: 447 PAPLSSTPVKCDVPPEPEPLSPVKKPAAAPPPPPPPPPPPPPPP 490 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 38.3 bits (85), Expect = 0.015 Identities = 20/47 (42%), Positives = 20/47 (42%) Frame = -2 Query: 941 GGXGXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGGXN 801 G G GGG GG GG G GGG G GG GGG N Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGN 69 Score = 37.1 bits (82), Expect = 0.035 Identities = 24/52 (46%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = -2 Query: 950 GXGGGXGXGGGXXGG-XGGGXXGXXXXGGGGXXXXXXXGXG---GXGXGGGG 807 G GGG GGG GG GGG G GG G G G G G GGGG Sbjct: 39 GFGGGP-YGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGG 89 Score = 36.3 bits (80), Expect = 0.062 Identities = 23/53 (43%), Positives = 23/53 (43%), Gaps = 6/53 (11%) Frame = -2 Query: 950 GXGGGXGXG---GGXXGGXGGGXXGXXXXGGGGXXXXXXXGXG---GXGXGGG 810 G GGG G G GG GG GG G GGG G G G G GGG Sbjct: 26 GFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGG 78 Score = 35.9 bits (79), Expect = 0.082 Identities = 24/64 (37%), Positives = 26/64 (40%), Gaps = 2/64 (3%) Frame = -2 Query: 944 GGGXGXGGGXXGGXGGGXXGXXXXG--GGGXXXXXXXGXGGXGXGGGGXNVXRXAXRXKI 771 GGG G GG GG GGG G GGG G GG G GGG + + Sbjct: 46 GGGFG-GGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHG-GGRGGGGGAASASASSSASAA 103 Query: 770 GXXG 759 G G Sbjct: 104 GGGG 107 Score = 34.7 bits (76), Expect = 0.19 Identities = 18/42 (42%), Positives = 18/42 (42%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXG 815 GGG GG G GGG GGG G G GG G G Sbjct: 37 GGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGG 78 Score = 33.5 bits (73), Expect = 0.44 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = -2 Query: 950 GXGGGX---GXGGGXXGGXGGGXXGXXXXGGGGXXXXXXXGXGGXGXGGGG 807 G GGG G G GG GGG GGGG GGGG Sbjct: 57 GFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGGGAASASASSSASAAGGGG 107 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 943 GGGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G G GGG GG G G G G G G Sbjct: 32 GGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGG 77 Score = 33.1 bits (72), Expect = 0.58 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 940 GGGGXGGXGXGXXGGGGXGGGXXGXGGXGXXXXXVXGGXGXGXXG 806 GGG GG G GGG GGG G G GG G G Sbjct: 46 GGGFGGGPYGGGFGGGPYGGGFGNPYGGGFGGGRRHGGGRGGGGG 90 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,922,878 Number of Sequences: 53049 Number of extensions: 1550342 Number of successful extensions: 119710 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 6191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39196 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4730695893 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -