Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP01_F_N22
         (911 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    22   5.8  
EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    22   7.6  

>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +1

Query: 847 PXXPPPPXPPP 879
           P  PP P PPP
Sbjct: 95  PTTPPTPSPPP 105


>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 21.8 bits (44), Expect = 7.6
 Identities = 12/46 (26%), Positives = 12/46 (26%)
 Frame = +2

Query: 740 VPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877
           VPP      P   P PPP            P         PP   P
Sbjct: 201 VPPTEDCDVPSTIPPPPPEEDDDSNIPQNNPKNKQHNFNLPPGAIP 246


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,324
Number of Sequences: 336
Number of extensions: 3447
Number of successful extensions: 10
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 25444518
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)