BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N22 (911 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 50 2e-06 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 44 2e-04 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 43 4e-04 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 42 7e-04 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.003 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 40 0.003 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 39 0.005 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 39 0.005 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 39 0.006 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 0.011 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 37 0.026 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 36 0.034 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.060 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 35 0.079 SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 0.16 SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) 28 0.16 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 34 0.18 SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 0.21 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 33 0.24 SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) 33 0.24 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 33 0.42 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 27 0.56 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 32 0.56 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 32 0.56 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 0.58 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 0.58 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 32 0.74 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 1.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 31 1.3 SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.3 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 31 1.3 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 31 1.3 SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 1.3 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 30 2.2 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 30 2.3 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 30 2.3 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 25 2.5 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 2.6 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 3.0 SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 30 3.0 SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) 30 3.0 SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) 29 3.9 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 29 3.9 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 3.9 SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) 29 5.2 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 5.2 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 5.2 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 5.2 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 29 6.9 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 29 6.9 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 29 6.9 SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) 29 6.9 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) 26 7.3 SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) 23 7.9 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) 24 8.2 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 9.1 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) 28 9.1 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.1 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 24 9.5 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/85 (34%), Positives = 29/85 (34%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PPP P P PP P P P PPP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP------- 417 Query: 823 XXXXXXXXPXXPPPPXPPPXXPPXL 897 P PPPP PPP PP L Sbjct: 418 --------PAPPPPPPPPPPPPPAL 434 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 PP P PP P P P PPPP P P P PP PP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPP 432 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 PP P PP P P P PPPP P P P PP PP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 46.4 bits (105), Expect = 3e-05 Identities = 27/80 (33%), Positives = 28/80 (35%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP + P P PP P P P PPP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP--------- 421 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 422 ---------PPPPPPPPPPP 432 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/72 (33%), Positives = 24/72 (33%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P PP P PP P P P PPPP P P P Sbjct: 365 PPPPPPPPPPPPSPPPPP-----PPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 854 XXPPXXPPXXPP 889 PP PP PP Sbjct: 420 PPPPPPPPPPPP 431 Score = 45.2 bits (102), Expect = 7e-05 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXX 895 PP P PP P P P PP P P P P PP PP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 896 XP 901 P Sbjct: 429 PP 430 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXX 895 PP P PP P P P PPPP P P P PP PP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPP-PQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 896 XP 901 P Sbjct: 425 PP 426 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/73 (30%), Positives = 22/73 (30%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP P PP P P P PPPP P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Query: 827 XPXXXXPXXXXPP 865 P PP Sbjct: 429 PPPPALRLACAPP 441 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G P P PP P P P P PP P P P PP PP Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA 419 Query: 884 PPXXXP 901 PP P Sbjct: 420 PPPPPP 425 Score = 41.9 bits (94), Expect = 7e-04 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXX 895 PP P PP P P P P PP P P P P PP PP Sbjct: 370 PPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Query: 896 XP 901 P Sbjct: 430 PP 431 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPS 771 PPPP PPP P P PP P P P+ Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 45.6 bits (103), Expect = 6e-05 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P PP+P P P P P PP P Sbjct: 84 PPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPS 143 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 144 PNAPYPPPPNPPYPPPLYPPPPNP 167 Score = 45.2 bits (102), Expect = 7e-05 Identities = 24/84 (28%), Positives = 26/84 (30%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXX 816 +PPP PPP P P P P P P+ P P PP Sbjct: 156 YPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPP 215 Query: 817 XXXXXXXXXXPXXPPPPXPPPXXP 888 P P PP PPP P Sbjct: 216 NAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 43.2 bits (97), Expect = 3e-04 Identities = 25/85 (29%), Positives = 27/85 (31%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXX 816 +PPPP PPP P+P PP P P P P P P Sbjct: 148 YPPPPNP--PYPPPLYPPPPNPPPPNAPYPPPPY-PPPPNPPYPPPPNPPYPPPPNAPNP 204 Query: 817 XXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP PPP P Sbjct: 205 PPPNPPYPPPPNAPNPPYPPPPNAP 229 Score = 42.7 bits (96), Expect = 4e-04 Identities = 25/90 (27%), Positives = 26/90 (28%), Gaps = 2/90 (2%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXV--PPXPXXXXPXXXPXPPPPXPXXX 811 F PP PP P PP+P PP P P P PP P Sbjct: 88 FSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAP 147 Query: 812 XXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 148 YPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Score = 42.7 bits (96), Expect = 4e-04 Identities = 28/85 (32%), Positives = 29/85 (34%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXX 816 +PPPP PPP P P PP P P P PPP PP Sbjct: 94 YPPPPYPPYPPPPPY------------PPPPNPPYPPPPNAPYP--PPPNPP-YPPPPNA 138 Query: 817 XXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP PPP PP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPP 163 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/90 (30%), Positives = 27/90 (30%), Gaps = 5/90 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXP--XXXXPXXXPXPP---PPXPXXX 811 PPP PP P P P PP P P P PP PP P Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Query: 812 XXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 169 PPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPX-PXXXXPXXXPXPPPPXPXXXXXXX 823 PPP PP PP P PP P P P P PP P Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPP 177 Query: 824 XXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 178 PYPPPPNP-PYPPPPNPPYPPPPNAP 202 Score = 42.3 bits (95), Expect = 5e-04 Identities = 25/86 (29%), Positives = 26/86 (30%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXG--PPXPXXPXPSXPPPXPPXXXXXXX 813 P PP PPP P P PP P P P+ P P PP Sbjct: 139 PYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPP 198 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPP 224 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 6/91 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXPXX 808 PPP PP P PP PP P P P PP PP P Sbjct: 95 PPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP 154 Query: 809 XXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP PP P Sbjct: 155 PYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Score = 41.9 bits (94), Expect = 7e-04 Identities = 28/91 (30%), Positives = 31/91 (34%), Gaps = 6/91 (6%) Frame = +1 Query: 637 FPPPPXXXXXXPP----PXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXX 804 +PPPP PP P P+P PP P P P+ P P PP Sbjct: 124 YPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLY-PPPPNPPPPNAPYPPPP---Y 179 Query: 805 XXXXXXXXXXXXXXPXXPPP--PXPPPXXPP 891 P PPP P PPP PP Sbjct: 180 PPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 41.1 bits (92), Expect = 0.001 Identities = 27/91 (29%), Positives = 28/91 (30%), Gaps = 6/91 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPF-PXXXXVPPXPXXXXPXXXPXPPPP----XPXXX 811 PPP PP P P+ P PP P P P PPPP P Sbjct: 149 PPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPN 208 Query: 812 XXXXXXPXXXXPXXXXPPXXP-PXXPPXXXP 901 P P PP P P PP P Sbjct: 209 PPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 3/88 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P PP P P P P P PPPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSP-NAPYPPPPNPPYPPPLYP 162 Query: 827 XPXXXXP---XXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 163 PPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/88 (30%), Positives = 27/88 (30%), Gaps = 3/88 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAP-PFPXXXXVPPXPXXXXPXXX--PXPPPPXPXXXXX 817 PP PP P AP P P PP P P P PPPP P Sbjct: 100 PPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Query: 818 XXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP PP P Sbjct: 160 LYPPPPNPPPPNAPYPP-PPYPPPPNPP 186 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/84 (29%), Positives = 25/84 (29%), Gaps = 3/84 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPX---PXXXXPXXXPXPPPPXPXXXXX 817 PPP PP PP P PP P P P PPPP P Sbjct: 126 PPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNP 185 Query: 818 XXXXPXXXXPXXXXPPXXPPXXPP 889 P P PP P PP Sbjct: 186 PYPPPPN--PPYPPPPNAPNPPPP 207 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/82 (30%), Positives = 25/82 (30%), Gaps = 1/82 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVP-PXPXXXXPXXXPXPPPPXPXXXXXXX 823 PP PP P PP P P P P P P PPPP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNP------- 193 Query: 824 XXPXXXXPXXXXPPXXPPXXPP 889 P P PP P PP Sbjct: 194 --PYPPPPNAPNPPPPNPPYPP 213 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P PP P P P PPP PP P PP PPP P Sbjct: 82 GHPPTNFSPNPPYPPPPYPPYPPP-PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 44.0 bits (99), Expect = 2e-04 Identities = 26/86 (30%), Positives = 28/86 (32%), Gaps = 2/86 (2%) Frame = +1 Query: 646 PPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXX 825 PP PPP P P G P P P + PPP PP Sbjct: 914 PPGGSVPPPPPPPGGNAPLP----PPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGG 969 Query: 826 XXXXXXXPXX--PPPPXPPPXXPPXL 897 P PPPP PPP PP + Sbjct: 970 APPLPPPPGGSAPPPPPPPPPPPPPM 995 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/80 (32%), Positives = 26/80 (32%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P G PP P P S PPP Sbjct: 923 PPPPGGNAPLPPPPPGGSAP----SQPPPPGGNAPPPPPPPGGSAPPP----GGGAPPLP 974 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 975 PPPGGSAPPPPPPPPPPPPP 994 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P PP P P P P PPPP Sbjct: 914 PPGGSVPPPP---PPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGA 970 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP PP P Sbjct: 971 PPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 3/57 (5%) Frame = +1 Query: 730 GXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPP---XPPPXXPP 891 G P P S PPP PP P PPPP PPP PP Sbjct: 905 GGSESPSASPPGGSVPPPPPP--PGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPP 959 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 43.6 bits (98), Expect = 2e-04 Identities = 27/85 (31%), Positives = 27/85 (31%), Gaps = 1/85 (1%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGX-PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXX 816 PPPP PPP G P P G PP P P PPP PP Sbjct: 328 PPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPS 387 Query: 817 XXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP P PP Sbjct: 388 SLGNP--------PPPPPPGRGAPP 404 Score = 39.1 bits (87), Expect = 0.005 Identities = 29/98 (29%), Positives = 30/98 (30%), Gaps = 4/98 (4%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXX-XXXXPPPXXXXXXXXXXRG--XPFPXGXXG-PPXPXXPXPSXP 777 Y + I PPPP PPP RG P P G P P P S Sbjct: 277 YDTTASLGIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQ 336 Query: 778 PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PP PPPP PPP P Sbjct: 337 RPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGP 374 Score = 33.5 bits (73), Expect = 0.24 Identities = 26/91 (28%), Positives = 26/91 (28%), Gaps = 11/91 (12%) Frame = +2 Query: 647 PPPXXXXXXPPXXXP------XXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP---PPX 799 PPP PP P GAPP P PP P P PP PP Sbjct: 317 PPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Query: 800 PXXXXXXXXXPXXXXPXXXXPP--XXPPXXP 886 P P PP PP P Sbjct: 377 PPPPIEGRPPSSLGNPPPPPPPGRGAPPPGP 407 Score = 32.7 bits (71), Expect = 0.42 Identities = 23/83 (27%), Positives = 23/83 (27%), Gaps = 3/83 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXX---PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXX 817 PPP PP P APP P PP P P PPPP Sbjct: 329 PPPSRSSQRPPPPSRGAPPPPSMGMAPP-PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPS 387 Query: 818 XXXXPXXXXPXXXXPPXXPPXXP 886 P P P P P Sbjct: 388 SLGNPPPPPPPGRGAPPPGPMIP 410 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/85 (24%), Positives = 21/85 (24%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P P P Sbjct: 297 PPPPSRGAPPPP--PSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMA 354 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P PP P Sbjct: 355 PPPVGGAAPPPPPPPPVGGPPPPPP 379 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP PP GAPP P P P P PPPP Sbjct: 288 PPPPSRGAAPPPP------SRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 3/65 (4%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXP---XPPPPXPXXXXXXXXXPXXXXPXXXXPPXXP 874 G PP P PP P P P PPP P P PP Sbjct: 284 GIQPPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 875 PXXPP 889 PP Sbjct: 344 GAPPP 348 Score = 28.3 bits (60), Expect = 9.1 Identities = 23/81 (28%), Positives = 23/81 (28%), Gaps = 4/81 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP----XPXXXX 814 PPP PP P G PP P P P PPPP P Sbjct: 306 PPPPSRGSAPP--PPPARMGTAPPPPPPSRSSQRPP----PPSRGAPPPPSMGMAPPPVG 359 Query: 815 XXXXXPXXXXPXXXXPPXXPP 877 P P PP PP Sbjct: 360 GAAPPPPPPPPVGGPPPPPPP 380 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 5/89 (5%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPX--XPXPSXPPPXPPXXXXXXX 813 P P PPP P GPP P P PPP PP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATV 176 Query: 814 XXXXXXXXXXXPXXP---PPPXPPPXXPP 891 P P PPP PPP PP Sbjct: 177 PAPAVPLAAASPPPPSGGPPPPPPPPPPP 205 Score = 40.7 bits (91), Expect = 0.002 Identities = 26/88 (29%), Positives = 27/88 (30%), Gaps = 2/88 (2%) Frame = +1 Query: 640 PPP--PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXX 813 PPP P PPP P GPP P P+ P P Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAAS 187 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPPXL 897 P PPPP PPP PP L Sbjct: 188 PPPPSGG----PPPPPPPPPPPPPPPIL 211 Score = 37.5 bits (83), Expect = 0.015 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 3/88 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P G PP PP P P PPP P Sbjct: 128 PPPTSPATRAPPPPPPIAPATGGPP-------PPPPIAPATGGPPPPPPIAPAATVPAPA 180 Query: 827 XPXXXX---PXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 181 VPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Score = 33.9 bits (74), Expect = 0.18 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 PP P P PPPP P P PP PP P P Sbjct: 112 PPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGP 164 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/81 (24%), Positives = 20/81 (24%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P G PP P P P P Sbjct: 129 PPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASP 188 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP PP Sbjct: 189 PPPSGGPPPPPPPPPPPPPPP 209 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPX 892 AP P PP P P PPPP P P PP PP P Sbjct: 116 APETPSQAPSPPPPPTS-PATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAA 174 Query: 893 XXP 901 P Sbjct: 175 TVP 177 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXP-PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PP P P P P PP PP P PPPP P P PP Sbjct: 96 PPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPP 152 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/55 (30%), Positives = 17/55 (30%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 AP P PP P P P PPPP P PP PP Sbjct: 92 APACPPACCAPPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPP 146 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P P P P PP Sbjct: 102 PPPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHS 161 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P P PPP P Sbjct: 162 VQLHASPPGPPPAPMPAPPPMVVP 185 Score = 31.1 bits (67), Expect = 1.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP ++ Sbjct: 105 PPPPPPPPPPPPPPPPIT 122 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 41.9 bits (94), Expect = 7e-04 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G GGGG G G G G G Sbjct: 779 GGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGD 838 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 839 GGGYADGDGGGGGGGGGGGGGGGGG 863 Score = 41.5 bits (93), Expect = 0.001 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GGGG G G G G Sbjct: 787 GGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGD 846 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 847 GGGGGGGGGGGGGGGGGGGGGGGGG 871 Score = 38.3 bits (85), Expect = 0.009 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GG G G G GG G Sbjct: 789 GGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGG 848 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 849 GGGGGGGGGGGGGGGGGGGGGGGGG 873 Score = 37.5 bits (83), Expect = 0.015 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GGGG G G G GG G Sbjct: 815 GGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGG 874 Query: 720 GG 715 GG Sbjct: 875 GG 876 Score = 37.1 bits (82), Expect = 0.020 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G G G G G G GG G Sbjct: 773 GGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGD 832 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG GG GGG Sbjct: 833 GGGFGDGGGYADGDGGGGGGGGGGG 857 Score = 35.5 bits (78), Expect = 0.060 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG G G G G G GG G G G G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGG 849 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 850 GGGGGGGGGGGGGGGGGGGGGGGGG 874 Score = 33.9 bits (74), Expect = 0.18 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG-A 712 GG G GG G G G GGGG G G G GG G GG Sbjct: 771 GGGGDGGDGG---GGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDG 827 Query: 711 PXPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 828 GGYGDGGGFGDGGGYADGDGGG 849 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G G GG G GG G G GGG Sbjct: 769 GGGGGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGG 820 Score = 28.7 bits (61), Expect = 6.9 Identities = 21/73 (28%), Positives = 21/73 (28%) Frame = -3 Query: 864 GGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGX 685 GG G G G GGGG G G G G G GG G Sbjct: 770 GGGGGDGGDGGGGGDGGGGGGGGGGGG-GGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGG 828 Query: 684 XXGGXXXXXXGGG 646 G GGG Sbjct: 829 GYGDGGGFGDGGG 841 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 30.7 bits (66), Expect(2) = 0.003 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P PP P P P PPP PP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P PPPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 1157 PPPPPPPPPPPP 1168 Score = 28.3 bits (60), Expect(2) = 0.003 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 1173 PPPPPPPPPPPP 1184 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG GGG G G G GG Sbjct: 62 GGGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGG 111 Score = 35.1 bits (77), Expect = 0.079 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGG 742 GG GG GG G G G GGGG G G G GG Sbjct: 64 GGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 795 GGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGGG G G G GG G GG G GG GGG Sbjct: 63 GGGGGGGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGG 112 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/55 (32%), Positives = 18/55 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXK 637 G GGGG G G G GG G GG G GG G K Sbjct: 70 GGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGGGGGGGVGRARFGSTYTK 124 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 3/83 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX---RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 PPPP PPP +G P P P P P + PPP PP Sbjct: 270 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 329 Query: 811 XXXXXXXXXXXXPXXPPPPXPPP 879 P PPP PP Sbjct: 330 LPPPPLRGQIAPP--PPPISKPP 350 Score = 35.5 bits (78), Expect = 0.060 Identities = 22/83 (26%), Positives = 22/83 (26%), Gaps = 2/83 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP PP PP P P PPP P Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 827 XPXXXXPXXXXP--PXXPPXXPP 889 P P P PP PP Sbjct: 370 GPPPPPPGRRPPSGKINPPPPPP 392 Score = 32.7 bits (71), Expect = 0.42 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 5/89 (5%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX---RGX--PFPXGXXGPPXPXXPXPSXPPPXPPXXXX 804 PPPP PPP RG P P PP P PP P Sbjct: 310 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 369 Query: 805 XXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP PP P Sbjct: 370 GPPPPPPGRRPPSGKINPPPPPPPAMDKP 398 Score = 31.5 bits (68), Expect = 0.98 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 3/84 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP P PP P P PP Sbjct: 243 PPPGENRPPPPMRGPT---SGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 299 Query: 827 XPXXXXPXXXXPP---XXPPXXPP 889 P PP PP PP Sbjct: 300 LPPSRDQAPAPPPPLNATPPPPPP 323 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/96 (28%), Positives = 29/96 (30%), Gaps = 9/96 (9%) Frame = +1 Query: 631 TIFPPPPXXXXXXP-PPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP----SXPPP---- 783 ++ PPP P PP RG P G PP P P S PPP Sbjct: 228 SLAPPPTGSSRPLPAPPPGENRPPPPMRG-PTSGGEPPPPKNAPPPPKRGSSNPPPPPTR 286 Query: 784 XPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P PPP P PP Sbjct: 287 GPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 322 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPP P RG P P P P PPP PP Sbjct: 429 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 478 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 39.1 bits (87), Expect = 0.005 Identities = 24/83 (28%), Positives = 26/83 (31%), Gaps = 3/83 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX---RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 PPPP PPP +G P P P P P + PPP PP Sbjct: 182 PPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVP 241 Query: 811 XXXXXXXXXXXXPXXPPPPXPPP 879 P PPP PP Sbjct: 242 LPPPPLRGQIAPP--PPPISKPP 262 Score = 35.5 bits (78), Expect = 0.060 Identities = 22/83 (26%), Positives = 22/83 (26%), Gaps = 2/83 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP PP PP P P PPP P Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 827 XPXXXXPXXXXP--PXXPPXXPP 889 P P P PP PP Sbjct: 282 GPPPPPPGRRPPSGKINPPPPPP 304 Score = 32.7 bits (71), Expect = 0.42 Identities = 24/89 (26%), Positives = 24/89 (26%), Gaps = 5/89 (5%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX---RGX--PFPXGXXGPPXPXXPXPSXPPPXPPXXXX 804 PPPP PPP RG P P PP P PP P Sbjct: 222 PPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPPPPGRAPQPLG 281 Query: 805 XXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP PP P Sbjct: 282 GPPPPPPGRRPPSGKINPPPPPPPAMDKP 310 Score = 31.5 bits (68), Expect = 0.98 Identities = 23/84 (27%), Positives = 23/84 (27%), Gaps = 3/84 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP P PP P P PP Sbjct: 155 PPPGENRPPPPMRGPT---SGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPP 211 Query: 827 XPXXXXPXXXXPP---XXPPXXPP 889 P PP PP PP Sbjct: 212 LPPSRDQAPAPPPPLNATPPPPPP 235 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/96 (28%), Positives = 29/96 (30%), Gaps = 9/96 (9%) Frame = +1 Query: 631 TIFPPPPXXXXXXP-PPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP----SXPPP---- 783 ++ PPP P PP RG P G PP P P S PPP Sbjct: 140 SLAPPPTGSSRPLPAPPPGENRPPPPMRG-PTSGGEPPPPKNAPPPPKRGSSNPPPPPTR 198 Query: 784 XPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P PPP P PP Sbjct: 199 GPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPP 234 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPP P RG P P P P PPP PP Sbjct: 341 PPPEPYQDTPKTYPSKNQQKANRGNPRPASSSRGAPPPVPPSRGPPPPPP 390 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.1 bits (87), Expect = 0.005 Identities = 27/87 (31%), Positives = 28/87 (32%), Gaps = 3/87 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX---RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 PPPP PPP + P P GPP P P PPP PP Sbjct: 347 PPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNG--- 403 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP PP PP Sbjct: 404 ---------------PPPPPPPTNGPP 415 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/57 (36%), Positives = 21/57 (36%) Frame = +1 Query: 622 TXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 T T PPPP PPP P P GPP P P PPP PP Sbjct: 361 TNNTPPPPPPTNKPPPPPPPTNGP-------PPPPPPTNGPPPPPPPTNGPPPPPPP 410 Score = 35.5 bits (78), Expect = 0.060 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G P P PP P P PPPP P P P P PP Sbjct: 341 GGGVNPPPPPTNNPPSPP---PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPP 397 Query: 884 PP 889 PP Sbjct: 398 PP 399 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP PP P G PP P PP P P P PPPP Sbjct: 365 PPPPPPTNKPPPPPPPTN-GPPPPPPPTNGPPPPPPPTNGP---PPPPPP 410 Score = 33.1 bits (72), Expect = 0.32 Identities = 24/80 (30%), Positives = 24/80 (30%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P PP P PP P P PPPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPP-PTNKPPPPPPPTNGP-----PPPPPPTNGPPPPPP 399 Query: 830 PXXXXPXXXXPPXXPPXXPP 889 P P PP P PP Sbjct: 400 PTNGPP----PPPPPTNGPP 415 Score = 32.7 bits (71), Expect = 0.42 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P PP P PP P P PPPP P Sbjct: 346 PPPPPTNNPPSPPPPT----NNTPPPPPPTNKPPPP---PPPTNGPPPPPPPTNGPPPPP 398 Query: 827 XPXXXXPXXXXPPXXPP 877 P P P PP Sbjct: 399 PPTNGPPPPPPPTNGPP 415 Score = 25.8 bits (54), Expect(2) = 5.9 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP P L Sbjct: 77 PPPPPPPPSSGPPL 90 Score = 21.4 bits (43), Expect(2) = 5.9 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +1 Query: 751 PXXPXPSXPPPXP 789 P P P PPP P Sbjct: 72 PSTPAPPPPPPPP 84 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 38.7 bits (86), Expect = 0.006 Identities = 24/94 (25%), Positives = 25/94 (26%) Frame = +1 Query: 598 MLVNYKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP 777 +L QT T PPP P P PP P P Sbjct: 654 LLTTADEQTRTTTSQEQEKLKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPP 713 Query: 778 PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPP 879 PP PP PPPP PPP Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 38.3 bits (85), Expect = 0.009 Identities = 20/72 (27%), Positives = 21/72 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P + P PP P P PPPP P P P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGC 736 Query: 854 XXPPXXPPXXPP 889 P PP PP Sbjct: 737 AGLPPPPPPPPP 748 Score = 31.9 bits (69), Expect = 0.74 Identities = 21/85 (24%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P +PP P P PPPP P Sbjct: 680 PPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPP-PSPQPGCAG 738 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P Sbjct: 739 LPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PPP G P P PP P PPP PP Sbjct: 716 PPPPPGCAGLPPP--PPSPQPGCAGLPPP-----PPPPPPGCAGLPPPPPP 759 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 30.7 bits (66), Expect(2) = 0.011 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G G G GG G+G P Sbjct: 348 GGGGGGGGGGGGRGGGGGFSSRGRGPP 374 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXP 703 G GGGG G G G GG +G P P Sbjct: 343 GGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPP 375 Score = 26.2 bits (55), Expect(2) = 0.011 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 342 GGGGGGGGGGGGGGG 356 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 36.7 bits (81), Expect = 0.026 Identities = 25/89 (28%), Positives = 27/89 (30%), Gaps = 4/89 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP--PXPXXXXXX 820 P P PP P +PP P +PP P P PPP P P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPP-PSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQP 1084 Query: 821 XXXPXXXXPXXXXP--PXXPPXXPPXXXP 901 P P P P PP P P Sbjct: 1085 VPPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXX 895 PP P VPP P P PPP P P P PP P PP Sbjct: 1019 PPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIP---PPRKPSPPPSEPAPPPRQ 1075 Query: 896 XP 901 P Sbjct: 1076 PP 1077 Score = 30.3 bits (65), Expect = 2.3 Identities = 19/75 (25%), Positives = 20/75 (26%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P +PP P PP P PPP P Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPP-PSEPAPPPRQPPPPSTSQPVPPPRQPDPIPTNPAH 1100 Query: 830 PXXXXPXXXXPPXXP 874 P P P P Sbjct: 1101 PTEPPPRQPKPTPAP 1115 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 36.7 bits (81), Expect = 0.026 Identities = 20/50 (40%), Positives = 20/50 (40%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P P PS PPP PP P P PP PPP PP Sbjct: 205 PPPPPRPPPSPPPPPPP----------------PSPSPPRPPPPPPPSPP 238 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPP 865 PP P PP P P P P PP P P P PP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 32.7 bits (71), Expect = 0.42 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 767 PXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PPPP P P P PP PP PP Sbjct: 198 PSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPP 238 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 PP P PP P P PPPP P P PP PP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLP-EPPPIPNMPPTLPP 260 Score = 31.5 bits (68), Expect = 0.98 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 PPPP PPP R P P PP P PPP P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPR--PPPPPPPSPPRPLAAKLPEPPPIP 252 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/66 (25%), Positives = 17/66 (25%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G P P PP P P P PPPP P P P Sbjct: 191 GTSHPTSPSQITQPPPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPP 250 Query: 884 PPXXXP 901 P P Sbjct: 251 IPNMPP 256 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP 793 PPP PP P PP P PP P P PPP Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPPRPPPPP----PPSPPRPLAAKLPEPPP 250 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/53 (35%), Positives = 19/53 (35%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXP 729 G GGG GGGG G GG GGG G G G G P Sbjct: 81 GGRGGGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFGGGGGGGFGSRARP 133 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGG G GG GGG G G G GG Sbjct: 85 GGFGGGGGFGGGGGG--------GFGGGGGGGFGGGGGGGGGFGGGGGGG 126 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGG 123 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.045 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 779 PXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PPPP P P P PP PP PP P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP 90 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PPP P P APP P P P P P P P P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAP 103 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/80 (26%), Positives = 22/80 (27%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXX 828 P PPP P P P P P+ PPP PP Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPP--------LPAP 94 Query: 829 XXXXXXPXXPPPPXPPPXXP 888 P PPP PP P Sbjct: 95 PPPPAQPAPQPPPAPPHFLP 114 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPP 783 PPPP P P P P P P P+ PPP Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPP 97 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 PP P P P PPP P P PP P PP P Sbjct: 50 PPPPPPSPPAAAPAAPPP-PAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQP 101 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP 790 PPP PP P PP P PP P P P PP Sbjct: 66 PPPAAAPAAPP---PPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/52 (30%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-SXPPPXPP 792 P PP PPP P PP P P P + P P PP Sbjct: 55 PSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPP 106 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPP PP P P PP P P P PPP PP Sbjct: 65 PPPPAAAPAAPPPPAAPPAAPPPPPPLP---APPPPPAQPAPQ-PPPAPP 110 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 35.9 bits (79), Expect = 0.045 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 3/88 (3%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP---XXXXX 807 FPPP PPP G P P P P P P PPP P Sbjct: 441 FPPPGAPHPRVPPPGAPHPRVPPP-GAPHPR----VPPPGAPHPRVPPPGAPHPRVPPPG 495 Query: 808 XXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 496 APHQRVPPPGAPHPRVPPPGAPHPRVPP 523 Score = 34.3 bits (75), Expect = 0.14 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 3/86 (3%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP---XXXXXXX 813 PPP PP G P P P P P P PPP P Sbjct: 402 PPPGAPHPRVPPPGASHQRVRPPGAPHPR----VPPPGAPHPRFPPPGAPHPRVPPPGAP 457 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 458 HPRVPPPGAPHPRVPPPGAPHPRVPP 483 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/83 (28%), Positives = 24/83 (28%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PP G P P P P P P PPP P Sbjct: 482 PPPGAPHPRVPPPGAPHQRVPPPGAPHPR----VPPPGAPHPRVPPPGAP-------HPR 530 Query: 823 XXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 531 VPPPGAPHPRVPPPGAPHPRVPP 553 Score = 33.1 bits (72), Expect = 0.32 Identities = 26/89 (29%), Positives = 26/89 (29%), Gaps = 6/89 (6%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPX----GXXGP--PXPXXPXPSXPPPXPPXXXX 804 PPP PP G P P G P P P P P PPP P Sbjct: 522 PPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP---- 577 Query: 805 XXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 578 ---HPRVPPPGTPHPRVPPPGAPHPKVPP 603 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PP G P P P P P P PPP P Sbjct: 562 PPPGAPHPRVPPPGAPHPRVPPPGTPHPR----VPPPGAPHPKVPPPGAP-------YQR 610 Query: 823 XXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P PP Sbjct: 611 LPYSGAYHPRLPPPGPPYQRVPP 633 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.045 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 3/86 (3%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP---XXXXXXX 813 PPP PP P P G P P P P PPP P Sbjct: 23 PPPNTTIPRAPPPNTAIPGDRPPNTPIP----GDPPPNIPIPGNPPPNTPIPGDPPPNTP 78 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP P P PP Sbjct: 79 IPGDPPPNTPIPGNPPPNTPIPGDPP 104 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPP PP P P G P P P P PPP P Sbjct: 73 PPPNTPIPGDPPPNTPIPGNPPPNTPIP----GDPPPNTPIPGDPPPNTP 118 Score = 28.7 bits (61), Expect = 6.9 Identities = 18/63 (28%), Positives = 18/63 (28%), Gaps = 3/63 (4%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPP---XPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPX 882 G P G P P P PPP P P PPP P P Sbjct: 2 GTPPNTAIPGDPPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDPPPNIPIPG 61 Query: 883 XPP 891 PP Sbjct: 62 NPP 64 >SB_6280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 35.5 bits (78), Expect = 0.060 Identities = 26/86 (30%), Positives = 26/86 (30%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXG- 724 G GG G GG G G G GGG G G G G T G Sbjct: 265 GGATGGGGGATGGGGGATG-GGGGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGA 323 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 324 TGGGVGATGGGGGATGGGGGVTGGGG 349 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G G GGG G G G G T G Sbjct: 258 GGATGGGGGATGGGGGATGGGG-GATGGGGGATGGGGGATGGGGGATGGGGGATGVGGGA 316 Query: 720 --GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 317 TGGGGGATGGGVGATGGGGGATGGGGG 343 Score = 34.7 bits (76), Expect = 0.10 Identities = 26/87 (29%), Positives = 26/87 (29%), Gaps = 2/87 (2%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G G GGG G G G G T G Sbjct: 272 GGATGGGGGATGGGGGATGGGG-GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGA 330 Query: 720 --GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 331 TGGGGGATGGGGGVTGGGGGATGGGGG 357 Score = 33.9 bits (74), Expect = 0.18 Identities = 25/89 (28%), Positives = 25/89 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG G G G G GGG G G G G T G G Sbjct: 279 GGATGGGGGATGGGG----GATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGG 334 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKNSXXC 622 G G GGG S C Sbjct: 335 GGATGGGGGVTGGGGGATGGGGGPGSGGC 363 Score = 33.1 bits (72), Expect = 0.32 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 1/85 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXG- 724 G GG G GG G G G GGG G G G G T G Sbjct: 244 GGATGGGGGATGGGGGATG-GGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGA 302 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGG 649 GG G GG GG Sbjct: 303 TGGGGGATGVGGGATGGGGGATGGG 327 Score = 31.9 bits (69), Expect = 0.74 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G G GG G G GG G Sbjct: 239 GRLGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGG 298 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGG 649 GG GG GG Sbjct: 299 GGGATGGGGGATGVGGGATGGGGG 322 Score = 31.9 bits (69), Expect = 0.74 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G G GG G G GG G GG Sbjct: 257 GGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGVGGG- 315 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 316 ATGGGGGATGGGVGATGGGGG 336 Score = 31.5 bits (68), Expect = 0.98 Identities = 25/92 (27%), Positives = 25/92 (27%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG G G G G GGG G G GG G GG Sbjct: 286 GGATGGGGGATGGGGGATGGGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGV- 344 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKNSXXCLRF 613 G GG G G L F Sbjct: 345 -TGGGGGATGGGGGPGSGGCGEDGTENVSLEF 375 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGK-GGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGG G G G G T G GG G GG GGG Sbjct: 248 GGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGGGATGGGG 300 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G GGG G G GGG G G GG P G Sbjct: 305 GGGGATGVGGGATGGGGGATGGGVGATGGGGGATGGGGGVTGGGGGATGGGGGPGSGG 362 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 35.1 bits (77), Expect = 0.079 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -3 Query: 795 GGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGGG G G G GG G+GG G GG GGG Sbjct: 191 GGGGYGGSKGGYGGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDYGGG 240 Score = 30.3 bits (65), Expect = 2.3 Identities = 21/68 (30%), Positives = 21/68 (30%) Frame = -3 Query: 876 GGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXX 697 GG GG G G G G GG G G G GG G GG Sbjct: 181 GGSQGGGYRSGGGGYGGSKGGY---GGGSGGGGYGGGRGGGGYGGGHGGGGYGGGGRHDY 237 Query: 696 XXGXXXGG 673 G GG Sbjct: 238 GGGSKGGG 245 >SB_26646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect = 0.10 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GGGG G G G GG G Sbjct: 36 GGGVGG--GGGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGA 93 Query: 720 G 718 G Sbjct: 94 G 94 Score = 31.9 bits (69), Expect = 0.74 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 2/64 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXX--GXXXXGXGGTXXXX 727 G GG G G G G G GGGG G G G GG Sbjct: 43 GGNGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGNGGAAGAAGAGAGGNVGGG 102 Query: 726 GKGG 715 G GG Sbjct: 103 GSGG 106 Score = 30.3 bits (65), Expect = 2.3 Identities = 23/81 (28%), Positives = 23/81 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G G G GG G G GG G GG Sbjct: 28 GGVGVGVGGGGVGGGGGNGGGAGN-----GVGAGGCGCGGGNDGGNGGGGAGNGGGGGGA 82 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 83 GNGGAAGAAGAGAGGNVGGGG 103 Score = 30.3 bits (65), Expect = 2.3 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G GG G G G GG G Sbjct: 29 GVGVGVGGGGVGGGGGNGGGAGNGVGAGGCGCGGGNDGGNG-GGGAGNGGGGGGAGNGGA 87 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GA GG GG Sbjct: 88 AGAAGAGAGGNVGGGGSGGVGGNGG 112 Score = 29.9 bits (64), Expect = 3.0 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKN 634 G GGGG G G GG G GG G GG GGG N Sbjct: 33 GVGGGGVGGGGG----NGGGAGNGVGAGGCGCGGGNDGGNGGGGAGNGGGGGGAGN 84 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGG G GG GG EG G G G G G Sbjct: 1756 GGFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGG 1813 Score = 32.3 bits (70), Expect = 0.56 Identities = 24/83 (28%), Positives = 24/83 (28%), Gaps = 2/83 (2%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG--GXGXXXGXXXXGXGGTXXXXGKGG 715 G GG GG G G GGG G G G GG G GG Sbjct: 1757 GFGGGGGGGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGG 1816 Query: 714 APXPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 1817 MGGGGEGMGAAGGGMGAGGEGGG 1839 Score = 31.5 bits (68), Expect = 0.98 Identities = 26/91 (28%), Positives = 28/91 (30%), Gaps = 1/91 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G GGGG G G GG G+ Sbjct: 1764 GGGMGGGGGMAGGGGGMGGGGMAAGGGEFGGGEGMGGGGMAGGGGGMGGGGGGM-GGGGE 1822 Query: 720 G-GAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GA G GG G K+S Sbjct: 1823 GMGAAGGGMGAGGEGGGAGGGGGGYSAQKSS 1853 >SB_11868| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 500 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 293 PPPPPPPPPLPP 304 Score = 28.3 bits (60), Expect(2) = 0.16 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 294 PPPPPPPPLPPP 305 Score = 24.6 bits (51), Expect(2) = 0.16 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 739 GPPXPXXPXPSXPPPXPP 792 GP P P PPP PP Sbjct: 282 GPTVPIPPTLPPPPPPPP 299 >SB_20622| Best HMM Match : zf-CHC2 (HMM E-Value=0.64) Length = 276 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 69 PPPPPPPPPLPP 80 Score = 28.3 bits (60), Expect(2) = 0.16 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 70 PPPPPPPPLPPP 81 Score = 24.6 bits (51), Expect(2) = 0.16 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 739 GPPXPXXPXPSXPPPXPP 792 GP P P PPP PP Sbjct: 58 GPTVPIPPTLPPPPPPPP 75 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P P P PPP PP P PP PPP PP Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPP-----------------PPQPSTPPPPPPSTPP 715 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P PPPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P P PPP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTP 714 Score = 28.3 bits (60), Expect = 9.1 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 746 PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P P PPPP P P P PP PP PP Sbjct: 670 PIQILPIPIQTMVPPPPPP--PPPPPPPPPPPPPQPSTPPPPPPSTPP 715 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 33.9 bits (74), Expect = 0.18 Identities = 27/87 (31%), Positives = 27/87 (31%), Gaps = 2/87 (2%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG--GXGXXXGXXXXGXGGTXXXX 727 G GG G GG G G G GGG G G G G GG Sbjct: 147 GYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYGGGGHGGGGYGGGGYGGGGGGYGGS 206 Query: 726 GKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG G GG GGG Sbjct: 207 GYGGG------GGYGGGGYGGGRSGGG 227 Score = 33.1 bits (72), Expect = 0.32 Identities = 27/89 (30%), Positives = 27/89 (30%), Gaps = 4/89 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXX-- 727 G GG GG GG G G G GGG G G G GG Sbjct: 125 GGRRGGGYGGGRGGGG--GYRSGGGYRGGGGYRGGGGGYRGRGRGGGGYGGGGYGGGGYG 182 Query: 726 --GKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG G GG GGG Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGG 211 >SB_17044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 386 Score = 27.1 bits (57), Expect(2) = 0.21 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PP PP Sbjct: 132 PGAPPPPPPPAVVPP 146 Score = 25.4 bits (53), Expect(2) = 0.21 Identities = 10/28 (35%), Positives = 11/28 (39%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 +G P P P P PPP PP Sbjct: 113 QGPPAPTSVPSGPRAPPGGPGAPPPPPP 140 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPP-XPXXPXPSXPP 780 PPP PPP G P P G GP P P P PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PPP G P G GP P P PP PP Sbjct: 29 PPPPPPYEAPPPPPGPPGPD----GPPGFPGPQGPNGPKGPPGLPGPPGPP 75 Score = 29.9 bits (64), Expect = 3.0 Identities = 26/95 (27%), Positives = 27/95 (28%), Gaps = 11/95 (11%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX----RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXX 807 PPPP PPP +G P G G P P P PP P Sbjct: 30 PPPPPYEAPPPPPGPPGPDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIG 89 Query: 808 XXXXXXXXXXXXXP------XXPPPPXPP-PXXPP 891 P P PP PP P PP Sbjct: 90 PPGLPGPNGVNGPPGELGDMGPPGPPGPPGPQMPP 124 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/59 (30%), Positives = 18/59 (30%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P G GPP P PP PP P PP PP P Sbjct: 186 GPPGPPGDMGPPGLPGPQGPQMPPGPP--GLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 242 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 712 GXPFPXGXXGPP-XPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P G GPP P P P PP P P PP PP P Sbjct: 271 GPPGPPGDMGPPGLPGPPGPQMPPGPP---GLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 327 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 712 GXPFPXGXXGPP-XPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P G GPP P P P PP P P PP PP P Sbjct: 356 GPPGPLGDVGPPGLPGPPGPQMPPGPP---GLPGAPGPKGPPGTNGPLGPPGDVGPPGNP 412 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 712 GXPFPXGXXGPP-XPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P G GPP P P P PP P P PP PP P Sbjct: 441 GPPGPLGDVGPPGLPGPPGPQMPPGPP---GLPGAPGPNGPPGINGPLGPPGEAGPPGNP 497 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +1 Query: 712 GXPFPXGXXGPP-XPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P G GPP P P P PP P P PP PP P Sbjct: 526 GPPGPLGDVGPPGLPGPPGPQMPPGPP---GLPGAPGPNGPPGINGPLGPPGEAGPPGNP 582 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXP-PPXPP 792 P G GPP P P PS P PP PP Sbjct: 621 PAGLPGPPGPASP-PSPPGPPGPP 643 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXP-PPXPP 792 P G GPP P P PS P PP PP Sbjct: 706 PPGLPGPPGPASP-PSPPGPPGPP 728 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXP-PPXPP 792 P G GPP P P PS P PP PP Sbjct: 791 PPGLPGPPGPASP-PSPPGPPGPP 813 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/24 (58%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXP-PPXPP 792 P G GPP P P PS P PP PP Sbjct: 876 PPGLPGPPGPASP-PSPPGPPGPP 898 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPP 792 G P G GPP P P PP PP Sbjct: 101 GPPGELGDMGPPGPPGPPGPQMPPGPP 127 Score = 28.3 bits (60), Expect = 9.1 Identities = 18/58 (31%), Positives = 18/58 (31%), Gaps = 3/58 (5%) Frame = +1 Query: 712 GXPFPXGXXGPP-XPXXPXPSXP--PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPP 876 G P P G PP P P P P PP P P PP PP Sbjct: 878 GLPGPPGPASPPSPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCPP 935 >SB_48719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1880 Score = 33.5 bits (73), Expect = 0.24 Identities = 23/75 (30%), Positives = 24/75 (32%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G GGGG G G G GG G+ Sbjct: 148 GRGGGRGRGGGEGGWGGRGGNGGGRGG------GEGGGGRGRGTGGGSRGGGGDGRGRGR 201 Query: 720 GGAPXPXXXXGXXXG 676 GG G G Sbjct: 202 GGTEERTRIEGYGSG 216 >SB_1800| Best HMM Match : LEA_4 (HMM E-Value=7.4) Length = 186 Score = 33.5 bits (73), Expect = 0.24 Identities = 24/81 (29%), Positives = 24/81 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG G G G GGG G G GG G GGA Sbjct: 73 GGATGGHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGATGGGVGATGGHGGA- 131 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 132 --TGGHGGATGGHGGATGGGG 150 Score = 32.3 bits (70), Expect = 0.56 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXG- 724 G GG G GG G G G GGG G G G G T G Sbjct: 59 GGATGGGGGATGGGGGATG-GHGGATGGGGGATGDGGGATGGGGGATGGGGGATGGHGGA 117 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG G G Sbjct: 118 TGGGVGATGGHGGATGGHGGATGGHG 143 Score = 31.5 bits (68), Expect = 0.98 Identities = 23/82 (28%), Positives = 23/82 (28%), Gaps = 2/82 (2%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXG--KGG 715 GG GG G G G GGGG G G GG G GG Sbjct: 40 GGATGGHGGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGG 99 Query: 714 APXPXXXXGXXXGGXXXXXXGG 649 G GG GG Sbjct: 100 GGGATGGGGGATGGHGGATGGG 121 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G G GG G G GG G Sbjct: 47 GGATGGGGGATGGGATGGGGGATGGGGGATGGHGGATGGGGGATGDGGGATGGGGGATG- 105 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GG Sbjct: 106 GGGGATGGHGGATGGGVGATGGHGG 130 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 32.7 bits (71), Expect = 0.42 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 730 GXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPPXL 897 G PP P P P PPP P P PPPP PPP P L Sbjct: 461 GQAPPPPPPPPPPPPPPPPP-------------------PPPPPPPFPPPPPPTPL 497 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P P PPPP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 32.7 bits (71), Expect = 0.42 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P P PPPP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 G PP P PP P P P PPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 G G P P PP P P P PP P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP 491 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 27.1 bits (57), Expect(2) = 0.56 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PP P PPP PP Sbjct: 530 PAPPPKPAPPPRSPP 544 Score = 23.8 bits (49), Expect(2) = 0.56 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 745 PXPXXPXPSXPPPXP 789 P P P P PPP P Sbjct: 522 PAPQPPSPPAPPPKP 536 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 32.3 bits (70), Expect = 0.56 Identities = 20/85 (23%), Positives = 20/85 (23%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P P P PP P P P P P P P Sbjct: 222 PAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPA 281 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 282 PPNPSIPLAPPNPYIPPAPPNLFIP 306 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 9/68 (13%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXP-XPP-------PPXPXXXXXXXXXPXXXXPXXXXPPX 868 +PP P PP P P P PP PP P P P PP Sbjct: 196 SPPIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAPPNPSKAIATPNPPMPETPLPPA 255 Query: 869 XP-PXXPP 889 P P PP Sbjct: 256 TPNPFIPP 263 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/86 (24%), Positives = 21/86 (24%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP P P P P PS P P Sbjct: 243 PNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPN 302 Query: 820 XXXXXXXXXPXXPPPPXPP--PXXPP 891 P PP P P P PP Sbjct: 303 LFIPSAPPNPHIPPAPPNPYIPTAPP 328 Score = 28.3 bits (60), Expect = 9.1 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 1/54 (1%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 PP P P P PP PP P P P PP P P P Sbjct: 176 PPKPPA--PSTIPTPPTPPAPPSPPIPTAPPTPPMPETPLPPGSPHIPPAPLHP 227 Score = 28.3 bits (60), Expect = 9.1 Identities = 21/85 (24%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P P P PP P +PP P P PP P Sbjct: 198 PIPTAPPTPPMPETPLPPGSPHIPPAPLHPHIPPAP-PNPSKAIATPNPPMP-ETPLPPA 255 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 256 TPNPFIPPASPNPSIPPAPPNPSIP 280 Score = 28.3 bits (60), Expect = 9.1 Identities = 19/64 (29%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 APP P P P P P P PP P P P P PP P Sbjct: 290 APPNPYIPPAP--PNLFIPSAPPNPHIPPAPPNPYIPTAPPNPSIPPAPPNPSIPPAPPN 347 Query: 890 XXXP 901 P Sbjct: 348 PSIP 351 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 32.3 bits (70), Expect = 0.56 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 PPPP PPP P P G PP P + PPP P Sbjct: 660 PPPPPP----PPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXP-----XPPPPXP 802 PP P GAPP P PP P P P PPPP P Sbjct: 662 PPPPPPPGGQAGGAPPPPP----PPLPGGAAPPPPPPIGGGAPPPPPP 705 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 25.4 bits (53), Expect(2) = 0.58 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 P P P P PPP PP Sbjct: 372 PCAPFAPPPPPPPPPPP 388 Score = 25.4 bits (53), Expect(2) = 0.58 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 856 PPPPXPPPXXP 888 PPPP PPP P Sbjct: 380 PPPPPPPPPAP 390 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.1 bits (62), Expect(2) = 0.58 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 424 PPPPPPPAPLPPPPPPP 440 Score = 21.8 bits (44), Expect(2) = 0.58 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXL 897 P PPPP P P L Sbjct: 435 PPPPPPPQPTTALPDPL 451 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/53 (32%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP 802 PPP PP G P P P P P P PP PP P Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGP 1289 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +2 Query: 740 VPPXPXXXXPXXXPX---PPPPXPXXXXXXXXXPXXXXPXXXXPPXXP-PXXPPXXXP 901 +PP P P P PPP P P P PP P P PP P Sbjct: 1234 MPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPGPPGPQP 1291 Score = 28.3 bits (60), Expect = 9.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPS 771 PPPP PP + P G GPP P P PS Sbjct: 1253 PPPPPGMRPMPPQPPFMPPPPRMQ----PPGPPGPPGPPGPQPS 1292 >SB_34030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.9 bits (69), Expect = 0.74 Identities = 17/49 (34%), Positives = 17/49 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXG 744 GG GGG GGGG G G GGG G G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGGDGDGDG 89 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPRXXXXXXXXXXGGG 669 GG GGG G G G GG G G GGG Sbjct: 43 GGGGGGGGGGGGGGGGGDGDGDGDGDANANADGGGGGGGGG 83 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 APP P PP P P P PPP P Sbjct: 180 APPPPGAPAAPPAPPFGGPPSAPPPPPAPP 209 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 31.9 bits (69), Expect = 0.74 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +2 Query: 689 PXXXXGXGAP---PFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXP 847 P G GAP P P P P P P PPPP P P P Sbjct: 281 PDIVTGGGAPVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP 793 PPP P P G PP P PP P P PPP Sbjct: 292 PPPPPADGSAPAPPPPPPPGGAPPPPPPP---PPPPPGDGGAPPPPPPP 337 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/50 (30%), Positives = 16/50 (32%) Frame = +2 Query: 740 VPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 +P P P PPP P P P PP PP PP Sbjct: 277 IPEVPDIVTGGGAPVPPP--PPADGSAPAPPPPPPPGGAPPPPPPPPPPP 324 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P+ PPP PP PPPP PPP PP Sbjct: 294 PPPADGSAPAPPPPPPPGGA------------------PPPPPPPPPPPP 325 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.9 bits (69), Expect = 0.74 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PPP RG P P PP P P P PP Sbjct: 459 PPPPGGMRGMPPPPMGMYPPP--RGFPPPPFGPPPPFYRGPPPPRGMPPPP 507 Score = 28.7 bits (61), Expect = 6.9 Identities = 21/81 (25%), Positives = 21/81 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP P PP P P P P Sbjct: 469 PPPPMGMYPPPRGFPPPPFG---PP-PPFYRGPPPPRGMPPPPRQRMPSQGPPQVHYPSQ 524 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P PP PP Sbjct: 525 DPQRLGAVKAMEKGEPPKAPP 545 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 31.5 bits (68), Expect = 0.98 Identities = 16/47 (34%), Positives = 16/47 (34%) Frame = +1 Query: 751 PXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P PP PP P PPPP PP PP Sbjct: 1423 PAPPPPMAFPPMPPAPGQVITHLQHIVHHKILPPPPPPPA-PPCPPP 1468 Score = 28.7 bits (61), Expect = 6.9 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 1/83 (1%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXX-PXPSXPPPXPPXXXXXX 810 I PPPP PPP + P P P P PP PP Sbjct: 1453 ILPPPP------PPPAPPCPPPCHVQSTQHTVDHSWAPSPVSAPLPMAAPPSPPQRIHHV 1506 Query: 811 XXXXXXXXXXXXPXXPPPPXPPP 879 PPPP PPP Sbjct: 1507 HTIVHHHVH------PPPPAPPP 1523 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP S Sbjct: 56 PPPPPPPPPPPPPPPPSS 73 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP S Sbjct: 57 PPPPPPPPPPPPPPPSSS 74 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 54 PPPPPPPPPPPPPPP 68 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 55 PPPPPPPPPPPPPPP 69 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 54 PPPPPPPPPPPPPPPPP 70 Score = 29.5 bits (63), Expect(2) = 0.98 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 55 PPPPPPPPPPPPPPPPP 71 Score = 21.0 bits (42), Expect(2) = 0.98 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 847 PXXPPPPXPPPXXP 888 P PPPP P P Sbjct: 65 PPPPPPPSSSPSRP 78 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 1308 PESPPPPPPPPPPPP 1322 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 1311 PPPPPPPPPPPPPPP 1325 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 1314 PPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 1312 PPPPPPPPPPPPPPLPP 1328 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP PP L Sbjct: 1313 PPPPPPPPPPPPPL 1326 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 P P P P PPP PP Sbjct: 1308 PESPPPPPPPPPPPPPP 1324 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 847 PXXPPPPXPPPXXP 888 P PPPP P P P Sbjct: 1317 PPPPPPPPPLPPTP 1330 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P PP P P P PPP PP Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP S Sbjct: 870 PPPPPPPPPPPPPPPPAS 887 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP S Sbjct: 871 PPPPPPPPPPPPPPPASS 888 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 864 PRRPPPPPPPPPPPP 878 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 867 PPPPPPPPPPPPPPP 881 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 868 PPPPPPPPPPPPPPP 882 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 869 PPPPPPPPPPPPPPP 883 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 869 PPPPPPPPPPPPPPPPP 885 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXP 789 R P P PP P P P PPP P Sbjct: 859 RPRPRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG EG G G GGP +G Sbjct: 424 GGPGGGYEGRGRGGRGGPRGGGPRG 448 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 31.1 bits (67), Expect = 1.3 Identities = 20/81 (24%), Positives = 20/81 (24%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P P P P P PP P P P P PP Sbjct: 150 PAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPP 209 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP P P Sbjct: 210 IPPIDPPRTQPPPIFPQPTTP 230 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPX 892 +P P PP P P P PP P P PP PP PP Sbjct: 159 SPIDPPRTQPPPIFPIDPPRTQPPPIPPIDPPRTQPPPIP-PIDPPRTQPPPIPPIDPPR 217 Query: 893 XXP 901 P Sbjct: 218 TQP 220 Score = 28.3 bits (60), Expect = 9.1 Identities = 17/62 (27%), Positives = 18/62 (29%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXX 895 P P +PP P P P P P P PP PP PP Sbjct: 147 PTTPAPMTLPPISPIDPPRTQPPPIFPIDPPRTQPPPIP-PIDPPRTQPPPIPPIDPPRT 205 Query: 896 XP 901 P Sbjct: 206 QP 207 Score = 26.2 bits (55), Expect(2) = 2.9 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 +F PP PP P P P PP P P P P P P Sbjct: 171 IFPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIFPQP 227 Score = 22.2 bits (45), Expect(2) = 2.9 Identities = 11/41 (26%), Positives = 11/41 (26%) Frame = +2 Query: 779 PXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P PP PP PP P Sbjct: 265 PVTCPPCPASSGCLVAAATGNLTVTLVPPSCPPCPPPVICP 305 >SB_56161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P P P PP PPPP PPP PP Sbjct: 139 PPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPG-NYPPPPAPPPAYPP 187 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 TI PPP P G P PP P P+ PP PP Sbjct: 134 TINYPPPGPQAPPPGSTVHYPPPQTTMGYPSAQPGFAPPGNYPPPPAPPPAYPP 187 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG--APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP PP P G PP P PP P P PPPP Sbjct: 280 PPPPPP---PPSNTPGMFASSGFQPPPPPPTDFAPPPPPPEPTSELPPPPPP 328 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXG 724 GG GG GG G G G GGGG G G G GG G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGG---GGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGG 673 G GGGG G G G GG G GG G GG Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG G G G G GG G GG G GG G G Sbjct: 657 GDGGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGG G G G GG G GG G GG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAG 710 Score = 30.3 bits (65), Expect = 2.3 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXG 676 G GGGG G G G GG G GGA G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDG 714 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/57 (29%), Positives = 18/57 (31%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GGGG G G G GG G GG G G G N+ Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSNN 722 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/65 (27%), Positives = 21/65 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNSXXC 622 G GGGG G G G GG G GG G G G N+ Sbjct: 667 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAGAGDDDGDGDVDSNNNLSD 726 Query: 621 LRFII 607 L+ + Sbjct: 727 LQLTV 731 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 31.1 bits (67), Expect = 1.3 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXX-VPPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP P P G PP P V P P P P P P P Sbjct: 118 PPPPYSPIPPQVPYP----GAAGPPMPHPTASVYPPPGGYPPTSYP--PQPYPAQPYPQQ 171 Query: 824 XXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 172 GYPPQPPPQAYPQPGYPPQGYPPTGP 197 >SB_58915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP P S Sbjct: 158 PPPPPPPPLIPSDTS 172 Score = 23.8 bits (49), Expect(2) = 1.3 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 P P P+ PPP PP Sbjct: 148 PTAPMVTTPAPPPPPPP 164 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 11/67 (16%) Frame = +1 Query: 730 GXXGPPXPXXPX----PSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-------PPXPP 876 G GPP P P PPP PP P PP PP PP Sbjct: 382 GPGGPPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Query: 877 PXXPPXL 897 P P + Sbjct: 442 PSDAPWI 448 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP+ P P P P PPPP Sbjct: 401 PPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPP 441 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 PP P P PPPP P P PP PP P P Sbjct: 386 PPPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPP-PPPGFPQFQPP 437 Score = 28.3 bits (60), Expect = 9.1 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 5/56 (8%) Frame = +1 Query: 640 PPP---PXXXXXXPPPXXXXXXXXXXRGXPFPX--GXXGPPXPXXPXPSXPPPXPP 792 PPP P PPP P+ G PP P P PPP PP Sbjct: 387 PPPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPP 442 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 30.7 bits (66), Expect = 1.7 Identities = 23/87 (26%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXX--GPPXPXXPXPSXPPPXPPXXXXXXXX 816 PP PPP P P G GPP P P P P Sbjct: 2115 PPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVP 2174 Query: 817 XXXXXXXXXXPXXPPPPXPPPXXPPXL 897 P PPP PP PP + Sbjct: 2175 PPMGAP----PSGPPPMGAPPSGPPPM 2197 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 30.7 bits (66), Expect = 1.7 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP P P P P P P Sbjct: 909 PPPLPLAPEPPPPLPP-------PPPPIQTTRPTVPTTPTTQASTTRPTPPPPTSALPPP 961 Query: 827 XPXXXXPXXXXPPXXPPXXP 886 P P PP PP P Sbjct: 962 IPATQVPPPPLPPLPPPPPP 981 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 280 PPPPPPPPPPPPPPP 294 Score = 25.4 bits (53), Expect(2) = 2.2 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P PPP PP Sbjct: 274 PPPLCAPPPPPPPPPPP 290 Score = 23.4 bits (48), Expect(2) = 2.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 285 PPPPPPPPPPGAKKP 299 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 79 PPPPPPPPPPPPPPP 93 Score = 25.4 bits (53), Expect(2) = 2.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P PPP PP Sbjct: 73 PPPLCAPPPPPPPPPPP 89 Score = 23.4 bits (48), Expect(2) = 2.3 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 84 PPPPPPPPPPGAKKP 98 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 30.3 bits (65), Expect = 2.3 Identities = 29/95 (30%), Positives = 30/95 (31%), Gaps = 5/95 (5%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXPXXXXG---XGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 LF PP PP P G GAPP P +PP P P P PP P Sbjct: 210 LFADAPPIQTSTSLPPMIPPVGMLGHPPMGAPPPP--HSMPP-PGMPPPGMMP-PPGFPP 265 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPP--XXPPXXXP 901 P P P PP PP P Sbjct: 266 MGMPGMGGMPPPGMPPPMPPGGMPPNMEQPPPPPP 300 Score = 30.3 bits (65), Expect = 2.3 Identities = 24/87 (27%), Positives = 24/87 (27%), Gaps = 2/87 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXX--PXPPPPXPXXXXXX 820 PPP PP P G G P P PP P P P PPPP Sbjct: 253 PPPGMMP--PPGFPPMGMPGMGGMPPPGMP--PPMPPGGMPPNMEQPPPPPPSSGVSNSG 308 Query: 821 XXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 309 MMPPHMQNPQHMGHQMMPGMMPQQFPP 335 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP P Sbjct: 820 PPPPPPPPPEEP 831 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPP 792 P P P PPP PP Sbjct: 813 PHEDSPPPPPPPPPPP 828 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPP 792 P P P PS P P PP Sbjct: 293 PKPRTPTPSPPTPTPP 308 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PP P PPP P L Sbjct: 302 PPTPTPPPRSPTPL 315 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP 793 F PP PP P G P FP P P P PPP Sbjct: 271 FNQAPPGFPPRWGPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPP 323 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/58 (27%), Positives = 17/58 (29%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 G PP P +PP P P PPP P P P PP Sbjct: 118 GGYVPPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPP 175 >SB_55438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 198 SSADRAESQHQREDEAQNTYEIHFTEIL*CRRI 100 + D E + + E+E +++YE +TEIL RR+ Sbjct: 341 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRV 373 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -3 Query: 198 SSADRAESQHQREDEAQNTYEIHFTEIL*CRRI 100 + D E + + E+E +++YE +TEIL RR+ Sbjct: 985 NQVDGEEEEEEEEEEEEDSYEDEYTEILQRRRV 1017 >SB_11420| Best HMM Match : MBOAT (HMM E-Value=6.9e-06) Length = 628 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 213 PPPPPPPPPPPPMLA 227 Score = 28.7 bits (61), Expect = 6.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP PP + Sbjct: 212 PPPPPPPPPPPPPM 225 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 211 PPPPPPPPPPPP 222 >SB_52684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 139 PPQPSPPQPPQPPPQPP 155 >SB_33565| Best HMM Match : SET (HMM E-Value=3.99931e-42) Length = 601 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/49 (34%), Positives = 18/49 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXG 744 GG GGG GGGG G G G G +G G G G Sbjct: 310 GGGDGGGGGGGGGGGGGDGGGDGDGDGDGDGDGDGDGDG-DGDGDDGWG 357 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 29.5 bits (63), Expect = 3.9 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 3/58 (5%) Frame = -3 Query: 795 GGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGG---XXXXXXGGGXXKNS 631 GGG G G G GG G+GG G GG GGG +NS Sbjct: 100 GGGYGGSSRGGYGGGRGGGGYGGGRGGGGYGGGRGGGYGGGRRDYGGGSKGGGYDRNS 157 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEG 765 G GGG GGGG G GG GGG G Sbjct: 443 GGDGGGDGGGGGDGGGDGIDGGDGGGDGGGDGGGDGGGDGG 483 >SB_32451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGG G GG G G G G G GG Sbjct: 775 GGGYGGGHRGGGGYGGGGHRGGSYSGYRGSYKSGGYGQGSGGYG-QGSGG 823 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGG GG GGG G G G GG Sbjct: 730 GGRGGGGYGGGYNDRRMQQGGYGNRSGGGYRGGGGYGGG--GGGYRGGGG 777 >SB_5429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 29.5 bits (63), Expect = 3.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 157 PPQPSPPQPPQPPPQPP 173 >SB_44584| Best HMM Match : DEAD_2 (HMM E-Value=0.12) Length = 540 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXG 750 GG GGG GGGG G G GG + G G Sbjct: 82 GGCGGGGGGGGGVGGGGGGGGGGGDDCEDGGGDDGEDGGSDNDGDEG 128 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/55 (32%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXP--XPSXP--PPXPP 792 PPPP PP +G P G GPP P P P P PP Sbjct: 1662 PPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPP 1716 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPP 876 G P P G G P P P PP PP P P PP Sbjct: 1671 GPPGPDGPMGLPGPQGPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPGRDGPMGPP 1725 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P +PP P P PPPP Sbjct: 644 PPNPFFGGIPPPPPGGGMFPPPPPPPP 670 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P PP P P PPP PP Sbjct: 225 PPPPAAPAPPPPPAAAPPPPPPPPP 249 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 1/53 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXX-PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PPP PP P PP P +P P PPPP P Sbjct: 289 PPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 29.1 bits (62), Expect = 5.2 Identities = 24/97 (24%), Positives = 25/97 (25%) Frame = +1 Query: 607 NYKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPX 786 N S + PPP PPP P PP P PPP Sbjct: 341 NIDSALHKPVIVPPPNLLFSFPPPPIIPIPPP---AMPAMFNPHVPPPMIGPVTVPPPPL 397 Query: 787 PPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPPXL 897 P P PPPP P P L Sbjct: 398 IPPPQASIPPPTMIQTLPP-PSVPPPPIGVPNRPSVL 433 Score = 28.7 bits (61), Expect = 6.9 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP 790 L F PPP PP P PP VPP P P PP Sbjct: 357 LLFSFPPPPIIPIPPPAM-PAMFNPHVPPPMIGPVTVPPPPLIPPPQASIPPP 408 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPP 792 P P P PS PPP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPP 792 P P P PS PPP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 31 PPPPSPPPSPPP 42 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 154 PPPPSPPPSPPP 165 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P PP P +PP P P PPPP P Sbjct: 542 PAVAPAVTPSEEPPPPPPGVDIPP-PLPPSEDPKPPPPPPEP 582 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAP---PFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P P G P +P PP P P P PPP Sbjct: 37 PPPSSVPVSYPGPPPAMYAVPGMPMPPAYPGMPTYPPQPMQFLPGTLPGMPPP 89 >SB_1089| Best HMM Match : AbfB (HMM E-Value=0.034) Length = 472 Score = 28.7 bits (61), Expect = 6.9 Identities = 23/81 (28%), Positives = 24/81 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G GG+ GGA Sbjct: 110 GGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQ-EGGGQGGAQAGGSTSGSSSGGA- 167 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 168 --TSGGGGVSGSSGTSIAGGG 186 Score = 28.3 bits (60), Expect = 9.1 Identities = 23/78 (29%), Positives = 24/78 (30%) Frame = -3 Query: 864 GGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGX 685 GG G G G GG G G G GG G+GGA G Sbjct: 104 GGTAEGGGEAGGEAGGQAGGGGQAGGQAGSQAGGGAAGGGGQEG-GGQGGAQAGGSTSGS 162 Query: 684 XXGGXXXXXXGGGXXKNS 631 GG GGG S Sbjct: 163 SSGG---ATSGGGGVSGS 177 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 6.9 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXV-PPXPXXXXPXXXPXPPPPXP 802 P P G PPF PP P P PPPP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHPAAAPPPPPLPAGVPAPPPPPPPP 322 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXP 762 PPPP PPP P P G PP P P Sbjct: 282 PPPPLTGGMLPPPFGGHPAAAPPP-PPLPAGVPAPPPPPPP 321 >SB_47598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2332 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P P P P P P PP PPP P Sbjct: 942 PTPPPSPPPKEPTPPPSSKPSPVKEIKPKKPIEKFISRPKPPTPPPVVSP 991 >SB_36310| Best HMM Match : DEAD (HMM E-Value=1.4) Length = 1042 Score = 26.2 bits (55), Expect(2) = 7.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 Query: 721 FPXGXXGPPXPXXPXPSXPPPXP 789 FP P P P P PPP P Sbjct: 1003 FPRAARPPDSPRDPPPITPPPPP 1025 Score = 20.6 bits (41), Expect(2) = 7.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 847 PXXPPPPXPPPXXP 888 P PPP P P P Sbjct: 1017 PPITPPPPPVPWFP 1030 >SB_44752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 421 Score = 23.4 bits (48), Expect(2) = 7.9 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P PPP PP Sbjct: 199 PPPPLDDLDDLPPPPPP 215 Score = 23.4 bits (48), Expect(2) = 7.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 856 PPPPXPPP 879 PPPP PPP Sbjct: 210 PPPPPPPP 217 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 25.8 bits (54), Expect(2) = 8.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PP PP Sbjct: 95 PPPPATPPPPTMPPTPP 111 Score = 21.0 bits (42), Expect(2) = 8.1 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 Query: 847 PXXPPPPXPPPXXP 888 P PPP P P P Sbjct: 108 PTPPPPQTPAPPGP 121 >SB_45152| Best HMM Match : DUF320 (HMM E-Value=2.9) Length = 293 Score = 23.8 bits (49), Expect(2) = 8.2 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG G G GGGG G Sbjct: 232 GGVWGNGGGGGGGGG 246 Score = 23.0 bits (47), Expect(2) = 8.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGP 738 GG GGG G G G P Sbjct: 238 GGGGGGGGGYSGGGSGNP 255 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 160 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 161 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 134 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 135 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 163 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 136 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 164 Score = 28.3 bits (60), Expect = 9.1 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GGGG G G G GG G GG Sbjct: 137 GGGGGGGGGGGGGGGGGGGGGGGGGGGGG 165 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 142 PPPPPPPPSPPP 153 Score = 28.3 bits (60), Expect = 9.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXL 897 P PPP PPP PP L Sbjct: 144 PPPPPPSPPPPCHPPAL 160 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 9.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P VPP P P PPPP P Sbjct: 783 PTKPATPRVPPNIPSRPPGARPTPPPPPP 811 >SB_20156| Best HMM Match : GED (HMM E-Value=6.8e-16) Length = 172 Score = 28.3 bits (60), Expect = 9.1 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXP 754 PPP P P GAPP P +P P Sbjct: 136 PPPVDNSDFDPRRPPAPPKPGGAPPIPGRPPIPSRP 171 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 28.3 bits (60), Expect = 9.1 Identities = 20/81 (24%), Positives = 20/81 (24%), Gaps = 3/81 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXG---XXGPPXPXXPXPSXPPPXPPXXXXXX 810 PPPP PPP G P P P P P P PP Sbjct: 790 PPPPGLARPNPPPPNPPLQVTSIPGEPAPPFVKLIASAMAAAFPFPFNPAPAPPITPDDT 849 Query: 811 XXXXXXXXXXXXPXXPPPPXP 873 P PP P Sbjct: 850 ITRSAVHNLPPCPPDPPQRLP 870 >SB_42380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1430 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 794 PPPPPPPPPPPP 805 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 360 PPPPPPPPPTPP 371 Score = 28.3 bits (60), Expect = 9.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 361 PPPPPPPPTPPP 372 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 24.2 bits (50), Expect(2) = 9.5 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +1 Query: 739 GPPXPXXPXPSXPPPXPP 792 G P P S PPP PP Sbjct: 183 GSPTEDTPWTSVPPPPPP 200 Score = 22.2 bits (45), Expect(2) = 9.5 Identities = 9/15 (60%), Positives = 9/15 (60%), Gaps = 3/15 (20%) Frame = +1 Query: 856 PPPPXP---PPXXPP 891 PPPP P PP PP Sbjct: 197 PPPPGPGGIPPPPPP 211 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,926,399 Number of Sequences: 59808 Number of extensions: 388722 Number of successful extensions: 5631 Number of sequences better than 10.0: 98 Number of HSP's better than 10.0 without gapping: 859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2564 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2633701421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -