BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N22 (911 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 45 1e-04 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 45 1e-04 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 45 1e-04 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 45 1e-04 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 45 1e-04 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 45 1e-04 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 42 0.001 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 42 0.001 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 42 0.001 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 42 0.001 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 42 0.001 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 41 0.002 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 41 0.002 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 40 0.004 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 40 0.004 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 40 0.005 AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p pro... 40 0.005 AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-P... 40 0.005 AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-P... 40 0.005 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 40 0.005 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 40 0.005 BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p pro... 40 0.006 BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p pro... 40 0.006 AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-P... 40 0.006 AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-P... 40 0.006 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 39 0.008 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 39 0.008 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 39 0.011 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 39 0.011 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 39 0.011 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 38 0.014 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 38 0.019 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 38 0.019 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 38 0.019 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 38 0.019 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 38 0.025 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 38 0.025 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 38 0.025 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 38 0.025 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 38 0.025 AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA ... 29 0.044 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 37 0.044 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 37 0.044 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 37 0.044 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 36 0.058 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 36 0.058 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 36 0.058 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 36 0.058 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 36 0.058 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 36 0.058 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 36 0.058 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 36 0.058 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 36 0.058 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 36 0.058 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 36 0.077 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 36 0.10 BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p pro... 36 0.10 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 36 0.10 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 36 0.10 AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-P... 36 0.10 AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-P... 36 0.10 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 36 0.10 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 36 0.10 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 36 0.10 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 36 0.10 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 36 0.10 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 35 0.13 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 35 0.13 X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. 35 0.18 X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP pro... 35 0.18 X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous ... 35 0.18 X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. 35 0.18 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 35 0.18 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 35 0.18 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 35 0.18 BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p pro... 35 0.18 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 35 0.18 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 35 0.18 AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-P... 35 0.18 AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-P... 35 0.18 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 35 0.18 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 35 0.18 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 34 0.31 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 34 0.31 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 34 0.31 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 34 0.31 AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa pr... 34 0.31 AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-P... 34 0.31 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 34 0.31 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 34 0.31 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 34 0.31 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 33 0.41 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 33 0.41 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 33 0.41 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 33 0.41 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 33 0.41 AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p pro... 33 0.54 AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA... 33 0.54 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 33 0.54 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 26 0.63 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 26 0.63 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 26 0.63 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 33 0.72 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 33 0.72 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 32 0.95 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 32 0.95 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 32 0.95 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 32 0.95 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 32 0.95 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 32 0.95 AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-P... 25 0.96 AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p pro... 32 1.3 AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-P... 32 1.3 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 32 1.3 AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA... 32 1.3 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 32 1.3 X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal p... 31 1.7 BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p pro... 31 1.7 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 31 1.7 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 31 1.7 AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p pro... 31 1.7 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 31 1.7 AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA ... 31 1.7 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 31 1.7 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 31 1.7 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 31 1.7 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 31 1.7 AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA... 31 1.7 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 31 1.7 X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. 31 2.2 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 31 2.2 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 31 2.2 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 31 2.2 AY069496-1|AAL39641.1| 771|Drosophila melanogaster LD22279p pro... 31 2.2 AF057162-1|AAC62005.1| 745|Drosophila melanogaster Medea protein. 31 2.2 AF041439-1|AAC38972.1| 771|Drosophila melanogaster maternal eff... 31 2.2 AF039233-1|AAC25634.1| 771|Drosophila melanogaster MEDEA protein. 31 2.2 AF039232-1|AAC09260.1| 745|Drosophila melanogaster MEDEA protein. 31 2.2 AF027729-1|AAC38971.1| 771|Drosophila melanogaster Medea protein. 31 2.2 AF019754-1|AAC35437.1| 682|Drosophila melanogaster Medea-A prot... 31 2.2 AE014297-4770|AAF57172.1| 771|Drosophila melanogaster CG1775-PA... 31 2.2 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 31 2.2 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 31 2.2 AE014297-2380|AAF55445.1| 210|Drosophila melanogaster CG14323-P... 25 2.3 AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-P... 28 2.6 AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-P... 31 2.9 AE014296-3128|AAF49173.1| 224|Drosophila melanogaster CG14089-P... 31 2.9 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 31 2.9 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 31 2.9 BT003747-1|AAO41408.1| 256|Drosophila melanogaster RH72336p pro... 27 3.0 AE014297-3911|AAF56559.1| 256|Drosophila melanogaster CG14542-P... 27 3.0 AY094715-1|AAM11068.1| 243|Drosophila melanogaster GH16325p pro... 27 3.0 AE014134-1970|AAF53017.1| 874|Drosophila melanogaster CG6700-PA... 25 3.5 BT022137-1|AAY51532.1| 388|Drosophila melanogaster IP01552p pro... 27 3.7 AE014296-2362|AAF49756.1| 388|Drosophila melanogaster CG7345-PA... 27 3.7 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 30 3.8 U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor ... 30 3.8 M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein... 30 3.8 M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha rec... 30 3.8 M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha rec... 30 3.8 M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha rec... 30 3.8 BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p pro... 30 3.8 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 30 3.8 BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro... 30 3.8 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 30 3.8 AY118625-1|AAM49994.1| 177|Drosophila melanogaster RE24635p pro... 30 3.8 AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro... 30 3.8 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 30 3.8 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 30 3.8 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 30 3.8 AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. 30 3.8 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 30 3.8 AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB... 30 3.8 AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA... 30 3.8 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 30 3.8 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 30 3.8 AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-P... 30 3.8 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 30 3.8 AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB... 30 3.8 AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA... 30 3.8 AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD... 30 3.8 AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC... 30 3.8 AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-P... 30 3.8 AE014296-1597|AAF50311.1| 606|Drosophila melanogaster CG10537-P... 30 3.8 AE014296-1596|AAN11988.1| 606|Drosophila melanogaster CG10537-P... 30 3.8 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 30 3.8 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 30 3.8 AE014134-1929|AAF52989.1| 177|Drosophila melanogaster CG7299-PA... 30 3.8 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 30 3.8 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 30 3.8 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 30 3.8 AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-P... 25 4.2 DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selen... 26 4.3 AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selen... 26 4.3 AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA... 26 4.3 AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p pro... 26 4.3 AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p pro... 25 4.6 BT021292-1|AAX33440.1| 416|Drosophila melanogaster RE27549p pro... 26 4.8 AE013599-3395|AAF46845.1| 416|Drosophila melanogaster CG5821-PA... 26 4.8 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 30 5.1 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 30 5.1 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 30 5.1 BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p pro... 30 5.1 BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p pro... 30 5.1 BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p pro... 30 5.1 BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p pro... 30 5.1 AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p pro... 30 5.1 AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p pro... 30 5.1 AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p pro... 30 5.1 AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH0791... 30 5.1 AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA... 30 5.1 AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD... 30 5.1 AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC... 30 5.1 AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-P... 30 5.1 AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA... 30 5.1 AE014134-147|AAF51462.1| 119|Drosophila melanogaster CG13947-PA... 30 5.1 AE014297-1125|AAF54511.2| 3111|Drosophila melanogaster CG3996-PA... 26 5.3 AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig iso... 25 5.6 AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p pro... 25 5.6 AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-P... 25 5.6 BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p pro... 26 6.1 AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-P... 26 6.1 AE014297-3394|AAS65199.1| 515|Drosophila melanogaster CG33111-P... 26 6.1 AE014297-3393|AAF56193.2| 515|Drosophila melanogaster CG33111-P... 26 6.1 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 29 6.7 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 29 6.7 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 29 6.7 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 29 6.7 AM294876-1|CAL26862.1| 158|Drosophila melanogaster CG10853 prot... 26 6.8 AE014134-2943|AAF53677.2| 822|Drosophila melanogaster CG15160-P... 25 7.6 AY128473-1|AAM75066.1| 657|Drosophila melanogaster RE28759p pro... 25 7.7 X71974-1|CAA50794.1| 196|Drosophila melanogaster GCR 17 protein. 29 8.8 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 29 8.8 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 29 8.8 AY118420-1|AAM48449.1| 250|Drosophila melanogaster RE74758p pro... 29 8.8 AY113357-1|AAM29362.1| 445|Drosophila melanogaster GM14473p pro... 29 8.8 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 29 8.8 AY061579-1|AAL29127.1| 613|Drosophila melanogaster SD02991p pro... 29 8.8 AM294871-1|CAL26857.1| 148|Drosophila melanogaster CG10853 prot... 29 8.8 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 29 8.8 AF247763-1|AAF74194.1| 613|Drosophila melanogaster SCAR protein. 29 8.8 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 29 8.8 AE014297-2460|AAN13763.1| 445|Drosophila melanogaster CG7187-PC... 29 8.8 AE014297-2459|AAN13762.1| 445|Drosophila melanogaster CG7187-PB... 29 8.8 AE014297-2458|AAF55508.1| 445|Drosophila melanogaster CG7187-PA... 29 8.8 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 29 8.8 AE014297-426|AAF51896.2| 171|Drosophila melanogaster CG15597-PA... 29 8.8 AE014296-1850|AAF50135.2| 250|Drosophila melanogaster CG12523-P... 29 8.8 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 29 8.8 AE014134-2001|AAF53042.1| 613|Drosophila melanogaster CG4636-PA... 29 8.8 BT023503-1|AAY84903.1| 1327|Drosophila melanogaster LD20030p pro... 27 9.4 AF116572-1|AAD31170.1| 1327|Drosophila melanogaster ribonuclease... 27 9.4 AE013599-540|AAF59169.1| 1327|Drosophila melanogaster CG8730-PA ... 27 9.4 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 523 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 581 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 582 PPGPPGPTRPGPPGPPGPTRPGPP 605 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 525 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 584 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 585 PPGPTRPGPPGPPGPTRPGPP 605 Score = 35.5 bits (78), Expect = 0.10 Identities = 26/98 (26%), Positives = 28/98 (28%), Gaps = 3/98 (3%) Frame = +1 Query: 604 VNYKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP- 777 + Y T P PP P G P G GP P P P+ P Sbjct: 461 IPYTPDNGPTGPPAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPN 520 Query: 778 -PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 PP PP P PP P PP P Sbjct: 521 GPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPP 558 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 508 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 567 Query: 886 PP 891 PP Sbjct: 568 PP 569 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 557 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 607 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 608 --TRPGPPGPTRPGPPGPSPNDP 628 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 488 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 514 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 519 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 578 Query: 866 XXPPXXPP 889 P PP Sbjct: 579 RPGPPGPP 586 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 522 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 581 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 582 PPGPPGPTRPGPPGP 596 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 197 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 201 PPGPTRPGPPGPPGPTRPGPP 221 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP--PPXPPXXXXXX 810 P PP P G P G GP P P P+ P PP PP Sbjct: 89 PAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPP 148 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P PP P Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 183 Query: 886 PP 891 PP Sbjct: 184 PP 185 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 223 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 224 --TRPGPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 104 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 130 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 194 Query: 866 XXPPXXPP 889 P PP Sbjct: 195 RPGPPGPP 202 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 198 PPGPPGPTRPGPPGP 212 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 553 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 611 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 555 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 614 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 615 PPGPTRPGPPGPPGPTRPGPP 635 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP--PPXPPXXXXXX 810 P PP P G P G GP P P P+ P PP PP Sbjct: 503 PAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPP 562 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P PP P Sbjct: 563 GPPGPKGPTKPGPFGPPGPPGPPGPP 588 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 538 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 597 Query: 886 PP 891 PP Sbjct: 598 PP 599 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 637 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 638 --TRPGPPGPTRPGPPGPSPNDP 658 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 518 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 544 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 608 Query: 866 XXPPXXPP 889 P PP Sbjct: 609 RPGPPGPP 616 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 612 PPGPPGPTRPGPPGP 626 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 553 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 611 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 612 PPGPPGPTRPGPPGPPGPTRPGPP 635 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 555 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 614 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 615 PPGPTRPGPPGPPGPTRPGPP 635 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP--PPXPPXXXXXX 810 P PP P G P G GP P P P+ P PP PP Sbjct: 503 PAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPP 562 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P PP P Sbjct: 563 GPPGPKGPTKPGPFGPPGPPGPPGPP 588 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 538 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 597 Query: 886 PP 891 PP Sbjct: 598 PP 599 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 637 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 638 --TRPGPPGPTRPGPPGPSPNDP 658 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 518 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 544 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 608 Query: 866 XXPPXXPP 889 P PP Sbjct: 609 RPGPPGPP 616 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 611 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 612 PPGPPGPTRPGPPGP 626 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 197 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 201 PPGPTRPGPPGPPGPTRPGPP 221 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP--PPXPPXXXXXX 810 P PP P G P G GP P P P+ P PP PP Sbjct: 89 PAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPP 148 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P PP P Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 183 Query: 886 PP 891 PP Sbjct: 184 PP 185 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 223 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 224 --TRPGPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 104 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 130 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 194 Query: 866 XXPPXXPP 889 P PP Sbjct: 195 RPGPPGPP 202 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 198 PPGPPGPTRPGPPGP 212 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 45.2 bits (102), Expect = 1e-04 Identities = 26/84 (30%), Positives = 26/84 (30%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PP G P P G GPP P P P PP PP Sbjct: 139 PGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGP-YGPPGPPGPTGPTRPG 197 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP Sbjct: 198 PPGPPGPTRPGPPGPPGPTRPGPP 221 Score = 37.9 bits (84), Expect = 0.019 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP G PP P PP P P P PP P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 827 XPXXXXPXXXXPPXXPPXXPP 889 P P PP PP Sbjct: 201 PPGPTRPGPPGPPGPTRPGPP 221 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/86 (27%), Positives = 25/86 (29%), Gaps = 3/86 (3%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPX-PSXP--PPXPPXXXXXX 810 P PP P G P G GP P P P+ P PP PP Sbjct: 89 PAPPYVHVVGPEGGFGGNGGKGDGGGVGPGGPGGPKGPGGPKGPNGPNGPPGPPGPPGPP 148 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P PP P Sbjct: 149 GPPGPKGPTKPGPFGPPGPPGPPGPP 174 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 1/62 (1%) Frame = +1 Query: 709 RGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPP-PPXPPPXX 885 +G P G GP P P PP PP P PP P P P Sbjct: 124 KGPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYG 183 Query: 886 PP 891 PP Sbjct: 184 PP 185 Score = 32.7 bits (71), Expect = 0.72 Identities = 23/83 (27%), Positives = 24/83 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PP P PP G P P G P P P P+ P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP--------- 223 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P Sbjct: 224 --TRPGPPGPTRPGPPGPSPNDP 244 Score = 31.5 bits (68), Expect = 1.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GG +G G G GGP P G G P+ Sbjct: 104 GGNGGKGDGGGV-GPGGPGGPKGPGGPK 130 Score = 31.1 bits (67), Expect = 2.2 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXXXXXPXXXXPXXXXPP 865 P G PP P P P P P PP PP P P P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPT 194 Query: 866 XXPPXXPP 889 P PP Sbjct: 195 RPGPPGPP 202 Score = 29.9 bits (64), Expect = 5.1 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 4/75 (5%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP-PPXP--XXXXXXXXXPXXXXPXXXX 859 P G PP P P P P P PP PP P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPG 197 Query: 860 PPXXP-PXXPPXXXP 901 PP P P P P Sbjct: 198 PPGPPGPTRPGPPGP 212 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/88 (30%), Positives = 28/88 (31%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXX 817 F PPP PP P PP P + P P P P PPPP P Sbjct: 129 FDPPPPHTIEPPPPPAPPTLV----PPPPPAPPTIKPPPPPAPPTVEP-PPPPPPAPPTV 183 Query: 818 XXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 184 EPPPPPPPAPTKVEPP--PPPAPAEVEP 209 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP PP P PP P P P PPPP P Sbjct: 141 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP-PPPPPPAPTKVEPP 199 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P P Sbjct: 200 PPPAPAEVEPPPPPAPTELEPPPPP 224 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P PP P PP P P P PPP P Sbjct: 109 PPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPP 165 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P PP P Sbjct: 166 APPTVEPPPPPPPAPPTVEPPPPPP 190 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 TI PPPP PP P P PP P P+ PP PP Sbjct: 136 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 195 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP P PP Sbjct: 196 VEPPPPPAPAEV-EPPPPPAPTELEPP 221 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P PP P P P+ P PP Sbjct: 151 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 210 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 211 PPPAPTELEP--PPPPAPPKVELP 232 Score = 37.9 bits (84), Expect = 0.019 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P PP P + P P P P PPP P Sbjct: 118 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP---TVEPPP 174 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 175 PPPPAPPTVEPPPPPPPAPTKVEP 198 Score = 37.9 bits (84), Expect = 0.019 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXV-PPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP PP PP P V PP P P PPPP P Sbjct: 152 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP----AEV 207 Query: 824 XXPXXXXPXXXXPPXXPPXXPP 889 P P PP PP PP Sbjct: 208 EPPPPPAPTELEPP--PPPAPP 227 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PPP P P G PP P P P PP Sbjct: 87 PAPPKVN---PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPP 143 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PP PPP P Sbjct: 144 APPTLVPPPPPAPPTIKPPPPPAP 167 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP------PXPXX 808 PPP P G +PP P P P PPP P P Sbjct: 95 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 154 Query: 809 XXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 155 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 185 Score = 35.9 bits (79), Expect = 0.077 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 4/81 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXP----PPPXPXXXX 814 PPP PP P PP P PP P P P P PPP P Sbjct: 163 PPPAPPTVEPPPPPPPAPPTVEPPPPP-----PPAPTKVEPPPPPAPAEVEPPPPPAPTE 217 Query: 815 XXXXXPXXXXPXXXXPPXXPP 877 P PP PP Sbjct: 218 LEPPPPPAPPKVELPPPPAPP 238 Score = 33.1 bits (72), Expect = 0.54 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PP P P PP P P PPP P Sbjct: 187 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 237 Score = 30.3 bits (65), Expect = 3.8 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 7/68 (10%) Frame = +2 Query: 719 PFPXXXXVPPXPXXXXPXXXPXPP-------PPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 P P PP P P P PP PP P P PP PP Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 146 Query: 878 XXPPXXXP 901 P P Sbjct: 147 TLVPPPPP 154 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPP--XPPXXXXXXX 813 PPPP PP P P P P P PS PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPT 134 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP PPP P Sbjct: 135 PSAPAPPPSYGPPQTPPPRPPPQPTP 160 Score = 41.9 bits (94), Expect = 0.001 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP R P P P P P PPP PP Sbjct: 105 PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPA 164 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP PP P Sbjct: 165 PSYGPPQPQPPAPQPPSPPSPQP 187 Score = 39.5 bits (88), Expect = 0.006 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 4/85 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVP----PXPXXXXPXXXPXPPPPXPXXXX 814 PPP PP P PP P P P P P P PP P P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP-PPRPPPQPTP 135 Query: 815 XXXXXPXXXXPXXXXPPXXPPXXPP 889 P P PP PP P Sbjct: 136 SAPAPPPSYGPPQTPPPRPPPQPTP 160 Score = 39.5 bits (88), Expect = 0.006 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P PP P P P P PPP P Sbjct: 103 PPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSA 162 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P PP P Sbjct: 163 PAPSYGPPQPQPPAPQPPSPPSPQP 187 Score = 39.5 bits (88), Expect = 0.006 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP--PXPXXPXPSXPPPXPPXXXXXXX 813 P P PPP G P P GP P P P P P P PP Sbjct: 216 PQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSE 275 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P P P P Sbjct: 276 YLPPPGENEVTPTQPQPTAPVPEYGP 301 Score = 34.3 bits (75), Expect = 0.24 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXX 856 P P PP P P P P P PPP P P P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP--Q 123 Query: 857 XPPXXPPXXPPXXXP 901 PP PP P P Sbjct: 124 TPPPRPPPQPTPSAP 138 Score = 34.3 bits (75), Expect = 0.24 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 6/90 (6%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P PP P P P P PP P P Sbjct: 129 PPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPG 188 Query: 830 PXXXXPXXXXP------PXXPPXXPPXXXP 901 P P P P PP PP P Sbjct: 189 PEYLPPDQPKPRPTPSRPQPPPPPPPRPQP 218 Score = 34.3 bits (75), Expect = 0.24 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 1/81 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P P P PP P P P PP P P Sbjct: 140 PPPSYG---PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAP-QPPSPPSPQPGPEYLPPD 195 Query: 827 XP-XXXXPXXXXPPXXPPXXP 886 P P PP PP P Sbjct: 196 QPKPRPTPSRPQPPPPPPPRP 216 Score = 34.3 bits (75), Expect = 0.24 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P P P P P PP P P PPPP P Sbjct: 180 PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGY 239 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P PP P Sbjct: 240 GPPTPPPGPG--PAQPAPQPPRPQP 262 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP-PXPXXXXXXXXXPXXXXPX 850 PP P G G PP P PP P P PPP P P P P Sbjct: 211 PPPPRPQPTPGYGPPPPPP----PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQ 266 Query: 851 XXXPPXXPPXXPP 889 P PP Sbjct: 267 PPRPQPGSEYLPP 279 Score = 32.3 bits (70), Expect = 0.95 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP-PPXPPXXXXXXXXXXX 825 P PPP R P P P P PS P PP P Sbjct: 70 PPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRP 129 Query: 826 XXXXXXXPXXPPPPXPPPXXPP 891 PPP PP PP Sbjct: 130 PPQPTPSAPAPPPSYGPPQTPP 151 Score = 31.1 bits (67), Expect = 2.2 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFP-XXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXX 820 PP PP P PP P PP P P PP P P Sbjct: 146 PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 821 XXXPXXXXPXXXXPP-XXPPXXPPXXXP 901 P P P PP PP P Sbjct: 206 PQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/85 (23%), Positives = 21/85 (24%), Gaps = 1/85 (1%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P + PP P P PPP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRP 154 Query: 830 PXXXXPXXXXPPXXPP-XXPPXXXP 901 P P P PP PP P Sbjct: 155 PPQPTPSAPAPSYGPPQPQPPAPQP 179 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/85 (24%), Positives = 21/85 (24%), Gaps = 2/85 (2%) Frame = +1 Query: 640 PPPPXXXXXXPP--PXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXX 813 PP P PP P P P P P P P P P P Sbjct: 169 PPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPP 228 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXP 888 PPP P P P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQP 253 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/85 (24%), Positives = 21/85 (24%), Gaps = 1/85 (1%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P P P PP P P P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQ 360 Query: 830 PXXXXPXXXXP-PXXPPXXPPXXXP 901 P P P P P P P Sbjct: 361 PQPPAPPAPAPGPTYQPRPPAPPAP 385 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P PP P PP P P P PPPP P Sbjct: 258 PRPQPPRPQPPRPQPGSEY---LPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQP 314 Query: 827 XPXXXXPXXXXPPXXP-PXXPPXXXP 901 P P P P PP P Sbjct: 315 RPPAPPAPAPGPTYQPRPPAPPAPAP 340 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 T P PP P P P P PP P P P PP Sbjct: 311 TYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPP----AP 366 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPPXLS 900 P PP P P PP S Sbjct: 367 PAPAPGPTYQPRPPAPPAPTPEYGPPPPTS 396 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/88 (30%), Positives = 28/88 (31%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXX 817 F PPP PP P PP P + P P P P PPPP P Sbjct: 392 FDPPPPHTIEPPPPPAPPTLV----PPPPPAPPTIKPPPPPAPPTVEP-PPPPPPAPPTV 446 Query: 818 XXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 447 EPPPPPPPAPTKVEPP--PPPAPAEVEP 472 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP PP P PP P P P PPPP P Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP-PPPPPPAPTKVEPP 462 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P P Sbjct: 463 PPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P PP P PP P P P PPP P Sbjct: 372 PPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPP 428 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P PP P Sbjct: 429 APPTVEPPPPPPPAPPTVEPPPPPP 453 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 TI PPPP PP P P PP P P+ PP PP Sbjct: 399 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 458 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP P PP Sbjct: 459 VEPPPPPAPAEV-EPPPPPAPTELEPP 484 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P PP P P P+ P PP Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 473 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 474 PPPAPTELEP--PPPPAPPKVELP 495 Score = 37.9 bits (84), Expect = 0.019 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P PP P + P P P P PPP P Sbjct: 381 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP---TVEPPP 437 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEP 461 Score = 37.9 bits (84), Expect = 0.019 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXV-PPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP PP PP P V PP P P PPPP P Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP----AEV 470 Query: 824 XXPXXXXPXXXXPPXXPPXXPP 889 P P PP PP PP Sbjct: 471 EPPPPPAPTELEPP--PPPAPP 490 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PPP P P G PP P P P PP Sbjct: 350 PAPPKVN---PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPP 406 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PP PPP P Sbjct: 407 APPTLVPPPPPAPPTIKPPPPPAP 430 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP------PXPXX 808 PPP P G +PP P P P PPP P P Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 809 XXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 35.9 bits (79), Expect = 0.077 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 4/81 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXP----PPPXPXXXX 814 PPP PP P PP P PP P P P P PPP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPP-----PPAPTKVEPPPPPAPAEVEPPPPPAPTE 480 Query: 815 XXXXXPXXXXPXXXXPPXXPP 877 P PP PP Sbjct: 481 LEPPPPPAPPKVELPPPPAPP 501 Score = 33.1 bits (72), Expect = 0.54 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PP P P PP P P PPP P Sbjct: 450 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Score = 30.3 bits (65), Expect = 3.8 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 7/68 (10%) Frame = +2 Query: 719 PFPXXXXVPPXPXXXXPXXXPXPP-------PPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 P P PP P P P PP PP P P PP PP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 878 XXPPXXXP 901 P P Sbjct: 410 TLVPPPPP 417 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 41.9 bits (94), Expect = 0.001 Identities = 27/88 (30%), Positives = 28/88 (31%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXX 817 F PPP PP P PP P + P P P P PPPP P Sbjct: 392 FDPPPPHTIEPPPPPAPPTLV----PPPPPAPPTIKPPPPPAPPTVEP-PPPPPPAPPTV 446 Query: 818 XXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 447 EPPPPPPPAPTKVEPP--PPPAPAEVEP 472 Score = 41.5 bits (93), Expect = 0.002 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP PP P PP P P P PPPP P Sbjct: 404 PPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEP-PPPPPPAPTKVEPP 462 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P P Sbjct: 463 PPPAPAEVEPPPPPAPTELEPPPPP 487 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P PP P PP P P P PPP P Sbjct: 372 PPAPPGVESPPGPQPPASPRFDPPP-PHTIEPPPPPAP--PTLVPPPPPAPPTIKPPPPP 428 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P PP P Sbjct: 429 APPTVEPPPPPPPAPPTVEPPPPPP 453 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/87 (28%), Positives = 26/87 (29%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 TI PPPP PP P P PP P P+ PP PP Sbjct: 399 TIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTK 458 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP P PP Sbjct: 459 VEPPPPPAPAEV-EPPPPPAPTELEPP 484 Score = 39.9 bits (89), Expect = 0.005 Identities = 24/84 (28%), Positives = 25/84 (29%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P PP P P P+ P PP Sbjct: 414 PPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPP 473 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 474 PPPAPTELEP--PPPPAPPKVELP 495 Score = 37.9 bits (84), Expect = 0.019 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P PP P + P P P P PPP P Sbjct: 381 PPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPP---TVEPPP 437 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 438 PPPPAPPTVEPPPPPPPAPTKVEP 461 Score = 37.9 bits (84), Expect = 0.019 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXV-PPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP PP PP P V PP P P PPPP P Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP----AEV 470 Query: 824 XXPXXXXPXXXXPPXXPPXXPP 889 P P PP PP PP Sbjct: 471 EPPPPPAPTELEPP--PPPAPP 490 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP PPP P P G PP P P P PP Sbjct: 350 PAPPKVN---PPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPP 406 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PP PPP P Sbjct: 407 APPTLVPPPPPAPPTIKPPPPPAP 430 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/91 (26%), Positives = 25/91 (27%), Gaps = 6/91 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP------PXPXX 808 PPP P G +PP P P P PPP P P Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Query: 809 XXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP PP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPAPPTVEP 448 Score = 35.9 bits (79), Expect = 0.077 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 4/81 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXP----PPPXPXXXX 814 PPP PP P PP P PP P P P P PPP P Sbjct: 426 PPPAPPTVEPPPPPPPAPPTVEPPPPP-----PPAPTKVEPPPPPAPAEVEPPPPPAPTE 480 Query: 815 XXXXXPXXXXPXXXXPPXXPP 877 P PP PP Sbjct: 481 LEPPPPPAPPKVELPPPPAPP 501 Score = 33.1 bits (72), Expect = 0.54 Identities = 16/51 (31%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PP P P PP P P PPP P Sbjct: 450 PPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPPAPPKVELPPPPAP 500 Score = 30.3 bits (65), Expect = 3.8 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 7/68 (10%) Frame = +2 Query: 719 PFPXXXXVPPXPXXXXPXXXPXPP-------PPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 P P PP P P P PP PP P P PP PP Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Query: 878 XXPPXXXP 901 P P Sbjct: 410 TLVPPPPP 417 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 41.9 bits (94), Expect = 0.001 Identities = 25/86 (29%), Positives = 25/86 (29%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPP--XPPXXXXXXX 813 PPPP PP P P P P P PS PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPT 134 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP PPP P Sbjct: 135 PSAPAPPPSYGPPQTPPPRPPPQPTP 160 Score = 41.9 bits (94), Expect = 0.001 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP R P P P P P PPP PP Sbjct: 105 PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPA 164 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 P P PP PP P Sbjct: 165 PSYGPPQPQPPAPQPPSPPSPQP 187 Score = 39.5 bits (88), Expect = 0.006 Identities = 25/85 (29%), Positives = 25/85 (29%), Gaps = 4/85 (4%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVP----PXPXXXXPXXXPXPPPPXPXXXX 814 PPP PP P PP P P P P P P PP P P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTP-PPRPPPQPTP 135 Query: 815 XXXXXPXXXXPXXXXPPXXPPXXPP 889 P P PP PP P Sbjct: 136 SAPAPPPSYGPPQTPPPRPPPQPTP 160 Score = 39.5 bits (88), Expect = 0.006 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP P P PP P P P P PPP P Sbjct: 103 PPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSA 162 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P PP P Sbjct: 163 PAPSYGPPQPQPPAPQPPSPPSPQP 187 Score = 39.5 bits (88), Expect = 0.006 Identities = 24/86 (27%), Positives = 24/86 (27%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP--PXPXXPXPSXPPPXPPXXXXXXX 813 P P PPP G P P GP P P P P P P PP Sbjct: 216 PQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRPQPGSE 275 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P P P P Sbjct: 276 YLPPPGENEVTPTQPQPTAPVPEYGP 301 Score = 34.3 bits (75), Expect = 0.24 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXX 856 P P PP P P P P P PPP P P P Sbjct: 66 PSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPP--Q 123 Query: 857 XPPXXPPXXPPXXXP 901 PP PP P P Sbjct: 124 TPPPRPPPQPTPSAP 138 Score = 34.3 bits (75), Expect = 0.24 Identities = 23/90 (25%), Positives = 23/90 (25%), Gaps = 6/90 (6%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P PP P P P P PP P P Sbjct: 129 PPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPG 188 Query: 830 PXXXXPXXXXP------PXXPPXXPPXXXP 901 P P P P PP PP P Sbjct: 189 PEYLPPDQPKPRPTPSRPQPPPPPPPRPQP 218 Score = 34.3 bits (75), Expect = 0.24 Identities = 24/81 (29%), Positives = 24/81 (29%), Gaps = 1/81 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P P P PP P P P PP P P Sbjct: 140 PPPSYG---PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAP-QPPSPPSPQPGPEYLPPD 195 Query: 827 XP-XXXXPXXXXPPXXPPXXP 886 P P PP PP P Sbjct: 196 QPKPRPTPSRPQPPPPPPPRP 216 Score = 34.3 bits (75), Expect = 0.24 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P P P P P PP P P PPPP P Sbjct: 180 PSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGY 239 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P PP P Sbjct: 240 GPPTPPPGPG--PAQPAPQPPRPQP 262 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/73 (30%), Positives = 22/73 (30%), Gaps = 1/73 (1%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPP-PXPXXXXXXXXXPXXXXPX 850 PP P G G PP P PP P P PPP P P P P Sbjct: 211 PPPPRPQPTPGYGPPPPPP----PPKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQ 266 Query: 851 XXXPPXXPPXXPP 889 P PP Sbjct: 267 PPRPQPGSEYLPP 279 Score = 32.3 bits (70), Expect = 0.95 Identities = 22/82 (26%), Positives = 22/82 (26%), Gaps = 1/82 (1%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP-PPXPPXXXXXXXXXXX 825 P PPP R P P P P PS P PP P Sbjct: 70 PPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRP 129 Query: 826 XXXXXXXPXXPPPPXPPPXXPP 891 PPP PP PP Sbjct: 130 PPQPTPSAPAPPPSYGPPQTPP 151 Score = 31.1 bits (67), Expect = 2.2 Identities = 24/88 (27%), Positives = 24/88 (27%), Gaps = 3/88 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFP-XXXXVPPXPXXXXPXXXPXPP-PPXPXXXXXX 820 PP PP P PP P PP P P PP P P Sbjct: 146 PPQTPPPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 821 XXXPXXXXPXXXXPP-XXPPXXPPXXXP 901 P P P PP PP P Sbjct: 206 PQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/85 (23%), Positives = 21/85 (24%), Gaps = 1/85 (1%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P + PP P P PPP Sbjct: 95 PPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRP 154 Query: 830 PXXXXPXXXXPPXXPP-XXPPXXXP 901 P P P PP PP P Sbjct: 155 PPQPTPSAPAPSYGPPQPQPPAPQP 179 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/85 (24%), Positives = 21/85 (24%), Gaps = 2/85 (2%) Frame = +1 Query: 640 PPPPXXXXXXPP--PXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXX 813 PP P PP P P P P P P P P P P Sbjct: 169 PPQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPP 228 Query: 814 XXXXXXXXXXXPXXPPPPXPPPXXP 888 PPP P P P Sbjct: 229 PPPKPQPTPGYGPPTPPPGPGPAQP 253 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/85 (24%), Positives = 21/85 (24%), Gaps = 1/85 (1%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP P P P P PP P P P PP P Sbjct: 301 PPPPAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQ 360 Query: 830 PXXXXPXXXXP-PXXPPXXPPXXXP 901 P P P P P P P Sbjct: 361 PQPPAPPAPAPGPTYQPRPPAPPAP 385 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P PP P PP P P P PPPP P Sbjct: 258 PRPQPPRPQPPRPQPGSEY---LPPPGENEVTPTQPQPTAPVPEYGPPPPAPPAGPTYQP 314 Query: 827 XPXXXXPXXXXPPXXP-PXXPPXXXP 901 P P P P PP P Sbjct: 315 RPPAPPAPAPGPTYQPRPPAPPAPAP 340 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/90 (25%), Positives = 23/90 (25%) Frame = +1 Query: 631 TIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXX 810 T P PP P P P P PP P P P PP Sbjct: 311 TYQPRPPAPPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPP----AP 366 Query: 811 XXXXXXXXXXXXPXXPPPPXPPPXXPPXLS 900 P PP P P PP S Sbjct: 367 PAPAPGPTYQPRPPAPPAPTPEYGPPPPTS 396 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX--RGXPFPXGXXG-PPXPXXPXPSXPP--PXPPXXXX 804 PP P P P RG G G P P P P PP P PP Sbjct: 76 PPGPPGLPGTPGPQGPKGHTGSKGERGEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKS 135 Query: 805 XXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 136 GHGHHDHHDHHHHHPAPPPPPPPPPPPPP 164 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 4/89 (4%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPP----PXPPXXX 801 I PP PP +G P G GPP P P PP P PP Sbjct: 182 IVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPP 241 Query: 802 XXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P P P P Sbjct: 242 PPPPPPPPSYPYPPYPYPPPGPYPGPWIP 270 Score = 38.3 bits (85), Expect = 0.014 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 14/98 (14%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP---PXPXXPXP-----------SXP 777 PPPP PPP P P P P P P S Sbjct: 152 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 211 Query: 778 PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP PP P PPPP PPP PP Sbjct: 212 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 249 Score = 34.7 bits (76), Expect = 0.18 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXP-PPPXPPP 879 G P P G G P P P PPP PP P P P P P P Sbjct: 222 GPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 278 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXP 762 +PPPP PPP G P P G G P P P Sbjct: 53 YPPPPPPP---PPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 2/68 (2%) Frame = +2 Query: 704 GXGAPPFPXXXXVP--PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 G PP P P P P P PPPP P P P P P Sbjct: 211 GPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIP 270 Query: 878 XXPPXXXP 901 P P Sbjct: 271 LPVPVPWP 278 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 41.1 bits (92), Expect = 0.002 Identities = 28/89 (31%), Positives = 28/89 (31%), Gaps = 5/89 (5%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXX--RGXPFPXGXXG-PPXPXXPXPSXPP--PXPPXXXX 804 PP P P P RG G G P P P P PP P PP Sbjct: 78 PPGPPGLPGTPGPQGPKGHTGSKGERGEKGERGHYGLPGQPGEPGPIGPPGLPGPPGHKS 137 Query: 805 XXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 138 GHGHHDHHDHHHHHPAPPPPPPPPPPPPP 166 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/89 (28%), Positives = 26/89 (29%), Gaps = 4/89 (4%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPP----PXPPXXX 801 I PP PP +G P G GPP P P PP P PP Sbjct: 184 IVTPPIIVPIPLPPQKGEHGHHHHHKGSKGPPGPPGPPGTGPPGPPGPPGTTYPQPPPPP 243 Query: 802 XXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P PP P P P P Sbjct: 244 PPPPPPPPSYPYPPYPYPPPGPYPGPWIP 272 Score = 38.3 bits (85), Expect = 0.014 Identities = 28/98 (28%), Positives = 28/98 (28%), Gaps = 14/98 (14%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP---PXPXXPXP-----------SXP 777 PPPP PPP P P P P P P S Sbjct: 154 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPPIIVPIPLPPQKGEHGHHHHHKGSKG 213 Query: 778 PPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP PP P PPPP PPP PP Sbjct: 214 PPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPP 251 Score = 34.7 bits (76), Expect = 0.18 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXP-PPPXPPP 879 G P P G G P P P PPP PP P P P P P P Sbjct: 224 GPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVPVPWP 280 Score = 29.9 bits (64), Expect = 5.1 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXP 762 +PPPP PPP G P P G G P P P Sbjct: 55 YPPPPPPP---PPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/68 (27%), Positives = 19/68 (27%), Gaps = 2/68 (2%) Frame = +2 Query: 704 GXGAPPFPXXXXVP--PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPP 877 G PP P P P P P PPPP P P P P P Sbjct: 213 GPPGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIP 272 Query: 878 XXPPXXXP 901 P P Sbjct: 273 LPVPVPWP 280 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGGG G G GG G GG Sbjct: 19 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 78 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 79 GAFGGRGGGGGRGGGGRGGGG 99 Score = 37.1 bits (82), Expect = 0.033 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GGGG G G GG G+ Sbjct: 33 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGG--GRGGGGRGGGGGGGRGAFGGRGGGGGR 90 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 91 GGG-------GRGGGGRGGGGRGGG 108 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G GGG G G G G G Sbjct: 27 GGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGG 86 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GG Sbjct: 87 GGGRGGGGRGGGGRGGGGRGGGAGG 111 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/74 (31%), Positives = 25/74 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG GGGG G G GGG + G G GG G+G Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGR---GRGGGGDRGGRGGFGGGRGGGGRGGG 73 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 74 GGGGRGAFGGRGGG 87 Score = 29.1 bits (62), Expect = 8.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G G GG G GG G GGG Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG 68 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 40.3 bits (90), Expect = 0.004 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGGG G G GG G GG Sbjct: 12 GGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGR 71 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 72 GAFGGRGGGGGRGGGGRGGGG 92 Score = 37.1 bits (82), Expect = 0.033 Identities = 27/85 (31%), Positives = 28/85 (32%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GGGG G G GG G+ Sbjct: 26 GGGGGGGGGGFGGGRGRGGGGDRGGRGGFGG--GRGGGGRGGGGGGGRGAFGGRGGGGGR 83 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 84 GGG-------GRGGGGRGGGGRGGG 101 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G GGG G G G G G Sbjct: 20 GGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGG 79 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GG Sbjct: 80 GGGRGGGGRGGGGRGGGGRGGGAGG 104 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/74 (31%), Positives = 25/74 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG GGGG G G GGG + G G GG G+G Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGR---GRGGGGDRGGRGGFGGGRGGGGRGGG 66 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 67 GGGGRGAFGGRGGG 80 Score = 29.1 bits (62), Expect = 8.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G G GG G GG G GGG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGG 61 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 39.9 bits (89), Expect = 0.005 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG G G G G G GG G G G GG G Sbjct: 231 GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGA 290 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GAP G G GGG Sbjct: 291 PGAPGSPGGGGFGGQGGGGGFGGGG 315 Score = 39.1 bits (87), Expect = 0.008 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGG---TXXXXGKG 718 GG G GG G G G GG G G G G GG + G+G Sbjct: 161 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 220 Query: 717 GAPXPXXXXGXXXGGXXXXXXGGG 646 GAP G GG GGG Sbjct: 221 GAPGGPGAPGG--GGFGGQGGGGG 242 Score = 38.3 bits (85), Expect = 0.014 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX-GGGGXGXXXGXXXXGXGGTXXXXG 724 G GG GG GG G G GGGG G G GG G Sbjct: 227 GAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRG 286 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGAP G GG GGG Sbjct: 287 GGGAPGAPGSPGG--GGFGGQGGGGG 310 Score = 37.9 bits (84), Expect = 0.019 Identities = 29/86 (33%), Positives = 30/86 (34%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXG-GGGXGXXXGXXXXGXGGTXXXXG 724 G GG G GG G G G G GGG G G G GG G Sbjct: 162 GGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGG---GSG 218 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGGG 646 +GGAP G GG GGG Sbjct: 219 RGGAP---GGPGAPGGGGFGGQGGGG 241 Score = 35.9 bits (79), Expect = 0.077 Identities = 27/86 (31%), Positives = 29/86 (33%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G GGGG G G G GG G+ Sbjct: 197 GSGGGGGGAGGGGGYGSGG--GSGRGGAPGGPGAPGGGGFGGQGG--GGGYGGAGGGAGR 252 Query: 720 GGAP-XPXXXXGXXXGGXXXXXXGGG 646 GG+P P G GG G G Sbjct: 253 GGSPGGPGSPGGGGFGGQGGAGGGYG 278 Score = 35.1 bits (77), Expect = 0.13 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GG G G G GG G Sbjct: 300 GGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGA 359 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 G+P G GG G G Sbjct: 360 PGSPGGGGFGGQGGGGGFGGGGGRG 384 Score = 34.7 bits (76), Expect = 0.18 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -3 Query: 888 GGXXGGXXGG-XXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGA 712 G GG GG G G G GGG G G GG G GGA Sbjct: 295 GSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGG-GGGRGGGGA 353 Query: 711 PXPXXXXGXXXGGXXXXXXGGG 646 P G GG GGG Sbjct: 354 PGAPGAPGSPGGGGFGGQGGGG 375 Score = 34.7 bits (76), Expect = 0.18 Identities = 26/85 (30%), Positives = 27/85 (31%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GG G G G G G G Sbjct: 361 GSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFG-GQGGGGGYGGGAGRGGAPGA 419 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 G+P G GG GGG Sbjct: 420 PGSPGGGGFGGQGGGGGF--GAGGG 442 Score = 34.7 bits (76), Expect = 0.18 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGGXXGGXXXXG--XXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GG GG G G GGGG G G G GG G GG Sbjct: 391 GSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGG--GRGGAGG 448 Query: 714 AP-XPXXXXGXXXGGXXXXXXGGG 646 AP P G GG G G Sbjct: 449 APGGPGSPGGPGYGGGAGGPGGAG 472 Score = 34.3 bits (75), Expect = 0.24 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 1/81 (1%) Frame = -3 Query: 885 GXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-GXXXGXXXXGXGGTXXXXGKGGAP 709 G GG GG G G GGGG G G G GG G G+P Sbjct: 268 GGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSP 327 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 328 GGGGYGG--QGGAGGGYGGGG 346 Score = 33.9 bits (74), Expect = 0.31 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG G G G G GGG G G G G G Sbjct: 170 GQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSG----GGSGRGGAPGG 225 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGG 649 GAP G GG GG Sbjct: 226 PGAPGGGGFGGQGGGGGYGGAGGG 249 Score = 33.9 bits (74), Expect = 0.31 Identities = 25/89 (28%), Positives = 25/89 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GGG G G G GG G Sbjct: 396 GGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGS 455 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGGXXKN 634 G P G GG G G N Sbjct: 456 PGGPGYGGGAG-GPGGAGGRPGGPGLPGN 483 Score = 32.7 bits (71), Expect = 0.72 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGG--XXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG G GG G G GGGG G G G GG G+GG Sbjct: 265 GGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG-----GRGG 319 Query: 714 AP-XPXXXXGXXXGGXXXXXXGGG 646 AP P G GG G G Sbjct: 320 APGAPGSPGGGGYGGQGGAGGGYG 343 Score = 32.3 bits (70), Expect = 0.95 Identities = 29/89 (32%), Positives = 30/89 (33%), Gaps = 4/89 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXG--GX--XXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXX 733 G GG GG G G G G GGGG G G G GG Sbjct: 325 GSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGG--- 381 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G+GGAP G GG GGG Sbjct: 382 --GRGGAPGAPGSPG--GGGFGGQGGGGG 406 Score = 31.5 bits (68), Expect = 1.7 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 3/88 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX--GGGGXGXXXGXXXXGXG-GTXXX 730 G GG G GG G G G GGGG G G G G Sbjct: 202 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGS 261 Query: 729 XGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG G GG GGG Sbjct: 262 PGGGGFGGQGGAGGGYGGGGGGGRGGGG 289 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G GGG G G G G+ Sbjct: 276 GYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQ 335 Query: 720 GGAPXPXXXXGXXXGG 673 GGA G GG Sbjct: 336 GGAGGGYGGGGGRGGG 351 Score = 29.5 bits (63), Expect = 6.7 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GG G G GG G Sbjct: 184 GGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGY 243 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGG 649 GGA G GG GG Sbjct: 244 GGA-GGGAGRGGSPGGPGSPGGGG 266 >AY071088-1|AAL48710.1| 173|Drosophila melanogaster RE15531p protein. Length = 173 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGG G G G GG G GG Sbjct: 23 GGLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGY 82 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 83 SGGYSNGGGYSGGGGYSGGGG 103 >AE014298-2545|AAF48713.1| 173|Drosophila melanogaster CG10598-PA, isoform A protein. Length = 173 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGG G G G GG G GG Sbjct: 23 GGLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGY 82 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 83 SGGYSNGGGYSGGGGYSGGGG 103 >AE014298-2544|AAN09437.1| 230|Drosophila melanogaster CG10598-PB, isoform B protein. Length = 230 Score = 39.9 bits (89), Expect = 0.005 Identities = 25/81 (30%), Positives = 25/81 (30%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGG G G G GG G GG Sbjct: 80 GGLLGGGGGGGGSIGGGAGGIGQLLQSKLGGLGGGLGGGLGGLSGGLGGKLGGGGGGGGY 139 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G G GGG Sbjct: 140 SGGYSNGGGYSGGGGYSGGGG 160 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGG G GG GGG G G G P P G G Sbjct: 51 GGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGG 108 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 878 GGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GGG GGGG G GG GGG G G G GG Sbjct: 44 GGGFGGGGGFG-GGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 792 GGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGG G G G GG G GG P G GG GGG Sbjct: 44 GGGFGGGGGF---GGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGG 89 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 39.9 bits (89), Expect = 0.005 Identities = 21/58 (36%), Positives = 21/58 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGG G GG GGG G G G P P G G Sbjct: 51 GGFGGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGGNNGLGGFANGRPIAPGGGG 108 Score = 39.9 bits (89), Expect = 0.005 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG G G G G G GG G G G GG G Sbjct: 303 GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGA 362 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GAP G G GGG Sbjct: 363 PGAPGSPGGGGFGGQGGGGGFGGGG 387 Score = 39.1 bits (87), Expect = 0.008 Identities = 27/84 (32%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGG---TXXXXGKG 718 GG G GG G G G GG G G G G GG + G+G Sbjct: 233 GGGYSGGPGGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRG 292 Query: 717 GAPXPXXXXGXXXGGXXXXXXGGG 646 GAP G GG GGG Sbjct: 293 GAP---GGPGAPGGGGFGGQGGGG 313 Score = 38.3 bits (85), Expect = 0.014 Identities = 28/86 (32%), Positives = 28/86 (32%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX-GGGGXGXXXGXXXXGXGGTXXXXG 724 G GG GG GG G G GGGG G G GG G Sbjct: 299 GAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRG 358 Query: 723 KGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGAP G GG GGG Sbjct: 359 GGGAPGAPGSPGG--GGFGGQGGGGG 382 Score = 35.9 bits (79), Expect = 0.077 Identities = 27/86 (31%), Positives = 29/86 (33%), Gaps = 1/86 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G GGGG G G G GG G+ Sbjct: 269 GSGGGGGGAGGGGGYGSGG--GSGRGGAPGGPGAPGGGGFGGQGG--GGGYGGAGGGAGR 324 Query: 720 GGAP-XPXXXXGXXXGGXXXXXXGGG 646 GG+P P G GG G G Sbjct: 325 GGSPGGPGSPGGGGFGGQGGAGGGYG 350 Score = 35.1 bits (77), Expect = 0.13 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GG G G G GG G Sbjct: 372 GGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGA 431 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 G+P G GG G G Sbjct: 432 PGSPGGGGFGGQGGGGGFGGGGGRG 456 Score = 34.7 bits (76), Expect = 0.18 Identities = 26/82 (31%), Positives = 26/82 (31%), Gaps = 1/82 (1%) Frame = -3 Query: 888 GGXXGGXXGG-XXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGA 712 G GG GG G G G GGG G G GG G GGA Sbjct: 367 GSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGG-GGGRGGGGA 425 Query: 711 PXPXXXXGXXXGGXXXXXXGGG 646 P G GG GGG Sbjct: 426 PGAPGAPGSPGGGGFGGQGGGG 447 Score = 34.7 bits (76), Expect = 0.18 Identities = 26/85 (30%), Positives = 27/85 (31%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GG G G G G G G Sbjct: 433 GSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFG-GQGGGGGYGGGAGRGGAPGA 491 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 G+P G GG GGG Sbjct: 492 PGSPGGGGFGGQGGGGGF--GAGGG 514 Score = 34.7 bits (76), Expect = 0.18 Identities = 27/84 (32%), Positives = 27/84 (32%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGGXXGGXXXXG--XXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 G GG GG G G GGGG G G G GG G GG Sbjct: 463 GSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGG--GRGGAGG 520 Query: 714 AP-XPXXXXGXXXGGXXXXXXGGG 646 AP P G GG G G Sbjct: 521 APGGPGSPGGPGYGGGAGGPGGAG 544 Score = 34.3 bits (75), Expect = 0.24 Identities = 25/81 (30%), Positives = 26/81 (32%), Gaps = 1/81 (1%) Frame = -3 Query: 885 GXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-GXXXGXXXXGXGGTXXXXGKGGAP 709 G GG GG G G GGGG G G G GG G G+P Sbjct: 340 GGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSP 399 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 400 GGGGYGG--QGGAGGGYGGGG 418 Score = 33.9 bits (74), Expect = 0.31 Identities = 25/84 (29%), Positives = 25/84 (29%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG G G G G GGG G G G G G Sbjct: 242 GQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSG----GGSGRGGAPGG 297 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGG 649 GAP G GG GG Sbjct: 298 PGAPGGGGFGGQGGGGGYGGAGGG 321 Score = 33.9 bits (74), Expect = 0.31 Identities = 25/89 (28%), Positives = 25/89 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GGG G G G GG G Sbjct: 468 GGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAGGGRGGAGGAPGGPGS 527 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGGXXKN 634 G P G GG G G N Sbjct: 528 PGGPGYGGGAG-GPGGAGGRPGGPGLPGN 555 Score = 32.7 bits (71), Expect = 0.72 Identities = 27/84 (32%), Positives = 28/84 (33%), Gaps = 3/84 (3%) Frame = -3 Query: 888 GGXXGG--XXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG G GG G G GGGG G G G GG G+GG Sbjct: 337 GGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG-----GRGG 391 Query: 714 AP-XPXXXXGXXXGGXXXXXXGGG 646 AP P G GG G G Sbjct: 392 APGAPGSPGGGGYGGQGGAGGGYG 415 Score = 32.3 bits (70), Expect = 0.95 Identities = 29/89 (32%), Positives = 30/89 (33%), Gaps = 4/89 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXG--GX--XXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXX 733 G GG GG G G G G GGGG G G G GG Sbjct: 397 GSPGGGGYGGQGGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGGGFGGGG--- 453 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G+GGAP G GG GGG Sbjct: 454 --GRGGAPGAPGSPG--GGGFGGQGGGGG 478 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -1 Query: 878 GGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GGG GGGG G GG GGG G G G GG Sbjct: 44 GGGFGGGGGFG-GGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGG 88 Score = 31.5 bits (68), Expect = 1.7 Identities = 26/88 (29%), Positives = 26/88 (29%), Gaps = 3/88 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX--GGGGXGXXXGXXXXGXG-GTXXX 730 G GG G GG G G G GGGG G G G G Sbjct: 274 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGGAGRGGSPGGPGS 333 Query: 729 XGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG G GG GGG Sbjct: 334 PGGGGFGGQGGAGGGYGGGGGGGRGGGG 361 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/49 (36%), Positives = 18/49 (36%) Frame = -3 Query: 792 GGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGG G G G GG G GG P G GG GGG Sbjct: 44 GGGFGGGGGF---GGGGAGGGYGGGGGGGPAGGFGGGPGGGGAGGFGGG 89 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G G GGG G G G G+ Sbjct: 348 GYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQ 407 Query: 720 GGAPXPXXXXGXXXGG 673 GGA G GG Sbjct: 408 GGAGGGYGGGGGRGGG 423 Score = 29.5 bits (63), Expect = 6.7 Identities = 23/84 (27%), Positives = 23/84 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GG G G GG G Sbjct: 256 GGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGY 315 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGG 649 GGA G GG GG Sbjct: 316 GGA-GGGAGRGGSPGGPGSPGGGG 338 >BT003283-1|AAO25040.1| 178|Drosophila melanogaster HL05737p protein. Length = 178 Score = 39.5 bits (88), Expect = 0.006 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXG-GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GG G G G G GGG EG G G GG G+G P Sbjct: 89 GGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGP 148 Query: 710 R 708 R Sbjct: 149 R 149 >BT001384-1|AAN71139.1| 178|Drosophila melanogaster GH03391p protein. Length = 178 Score = 39.5 bits (88), Expect = 0.006 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXG-GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GG G G G G GGG EG G G GG G+G P Sbjct: 89 GGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGP 148 Query: 710 R 708 R Sbjct: 149 R 149 >AE014297-1707|AAS65146.1| 178|Drosophila melanogaster CG16901-PD, isoform D protein. Length = 178 Score = 39.5 bits (88), Expect = 0.006 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXG-GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GG G G G G GGG EG G G GG G+G P Sbjct: 89 GGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGP 148 Query: 710 R 708 R Sbjct: 149 R 149 >AE014297-1706|AAF54963.2| 344|Drosophila melanogaster CG16901-PB, isoform B protein. Length = 344 Score = 39.5 bits (88), Expect = 0.006 Identities = 23/61 (37%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXG-GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GG G G G G GGG EG G G GG G+G P Sbjct: 255 GGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGNMGGGRGGP 314 Query: 710 R 708 R Sbjct: 315 R 315 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 39.1 bits (87), Expect = 0.008 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 751 PXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P PPP PP P PPPP PPP P Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 685 Score = 33.5 bits (73), Expect = 0.41 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 767 PXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PPPP P P P PP PP PP P Sbjct: 642 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPP-PPPPPPPVPYP 685 Score = 30.7 bits (66), Expect = 2.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 PP P P P PPP P PPPP P P P Sbjct: 642 PPPPPPPPP--PPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 688 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 767 PXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXPXXF 910 P P PPPP P P P PP PP P + Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPY 686 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPF-PXGXXGPPXPXXPXPSXP 777 +PPPP PPP P P PP P P P P Sbjct: 641 YPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 688 Score = 29.1 bits (62), Expect = 8.8 Identities = 16/57 (28%), Positives = 18/57 (31%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GG G G G G G GG+ GG GGG N+ Sbjct: 443 GVGGAGAGANAGGFGGGADANSGANGGGGSAGANAGANGGFGGFGGFGGGGGGGANA 499 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 39.1 bits (87), Expect = 0.008 Identities = 17/47 (36%), Positives = 17/47 (36%) Frame = +1 Query: 751 PXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P PPP PP P PPPP PPP P Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYP 825 Score = 33.5 bits (73), Expect = 0.41 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +2 Query: 767 PXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PPPP P P P PP PP PP P Sbjct: 782 PPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPP-PPPPPPPVPYP 825 Score = 30.7 bits (66), Expect = 2.9 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 PP P P P PPP P PPPP P P P Sbjct: 782 PPPPPPPPP--PPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 828 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 767 PXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXPXXF 910 P P PPPP P P P PP PP P + Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPY 826 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/48 (31%), Positives = 16/48 (33%), Gaps = 1/48 (2%) Frame = +1 Query: 637 FPPPPXXXXXXPPPXXXXXXXXXXRGXPF-PXGXXGPPXPXXPXPSXP 777 +PPPP PPP P P PP P P P P Sbjct: 781 YPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPPVPYPYTP 828 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 38.7 bits (86), Expect = 0.011 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P PPP P PPP PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P PP PP PP P Sbjct: 44 FPTPSAPAPPPKPRPPP--PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 0.95 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P P P P PP P Sbjct: 37 FPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP 96 Score = 31.1 bits (67), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP-PXPXXPXPSXPPPXPP 792 P PP PPP P P P P P PS PPP P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 38.7 bits (86), Expect = 0.011 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P PPP P PPP PPP P Sbjct: 45 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P PP PP PP P Sbjct: 44 FPTPSAPAPPPKPRPPP--PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 0.95 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P P P P PP P Sbjct: 37 FPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP 96 Score = 31.1 bits (67), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP-PXPXXPXPSXPPPXPP 792 P PP PPP P P P P P PS PPP P Sbjct: 50 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 101 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 38.7 bits (86), Expect = 0.011 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P P PP P P P PPP P PPP PPP P Sbjct: 27 PTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P PP PP PP P Sbjct: 26 FPTPSAPAPPPKPRPPP--PPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 Score = 32.3 bits (70), Expect = 0.95 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 722 FPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 FP P P P P PPPP P P P P PP P Sbjct: 19 FPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAP 78 Score = 31.1 bits (67), Expect = 2.2 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 1/52 (1%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGP-PXPXXPXPSXPPPXPP 792 P PP PPP P P P P P PS PPP P Sbjct: 32 PAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDP 83 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 38.3 bits (85), Expect = 0.014 Identities = 23/84 (27%), Positives = 24/84 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP PFP P P + P PP Sbjct: 568 PPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPPTSKYLPP 627 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P P P PPP PP Sbjct: 628 PQVKQGYDYPK-PAIPFPPPTNPP 650 Score = 35.9 bits (79), Expect = 0.077 Identities = 21/82 (25%), Positives = 22/82 (26%) Frame = +1 Query: 646 PPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXX 825 PP PPP PFP P P + P P PP Sbjct: 160 PPVTTTQAPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKKYLPPP 219 Query: 826 XXXXXXXPXXPPPPXPPPXXPP 891 P P PPP PP Sbjct: 220 QVKQGYDYPKPAIPFPPPTNPP 241 Score = 35.9 bits (79), Expect = 0.077 Identities = 23/86 (26%), Positives = 23/86 (26%), Gaps = 2/86 (2%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP PFP P P PP P Sbjct: 207 PPPPPTKKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYLPPVVPTSPPVPKYVPPPTPTY 266 Query: 820 XXXXXXXXXPXXPPP--PXPPPXXPP 891 P P P PPP PP Sbjct: 267 IPPPPKKQGYDYPKPAIPFPPPTAPP 292 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/83 (26%), Positives = 23/83 (27%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PPP PFP PP P + PP Sbjct: 305 PPPPPPKYLPPPQVKQGYDYPKPAIPFPP-PTAPPQKYLPPVTTTKAPPPPPTVKYLPPP 363 Query: 823 XXXXXXXXPXXPPPPXPPPXXPP 891 P P P PPP PP Sbjct: 364 QVKQGYDYP-KPAVPFPPPTNPP 385 Score = 32.3 bits (70), Expect = 0.95 Identities = 28/103 (27%), Positives = 29/103 (28%), Gaps = 9/103 (8%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXP--XPSXPP- 780 Y T PPPP PPP PFP PP P P+ PP Sbjct: 341 YLPPVTTTKAPPPPPTVKYLPPPQVKQGYDYPKPAVPFPP-PTNPPQKYLPPVVPTTPPQ 399 Query: 781 ----PXPPXXXXXXXXXXXXXXXXXXPXXPPP--PXPPPXXPP 891 P P P P P PPP PP Sbjct: 400 PKYLPPPKPTNPPQPKYLPPPQPKSGYDYPKPAIPFPPPTNPP 442 Score = 32.3 bits (70), Expect = 0.95 Identities = 19/76 (25%), Positives = 19/76 (25%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP PFP P P PP P Sbjct: 616 PPPPPTSKYLPPPQVKQGYDYPKPAIPFPPPTNPPQKYIPPVVPTSPPTPKYLPPPQVKQ 675 Query: 820 XXXXXXXXXPXXPPPP 867 P PP P Sbjct: 676 GYDYPKPVIPFPPPAP 691 Score = 31.5 bits (68), Expect = 1.7 Identities = 20/79 (25%), Positives = 21/79 (26%), Gaps = 1/79 (1%) Frame = +1 Query: 646 PPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXX 825 PP PPP PFP P P + P PP Sbjct: 260 PPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVK 319 Query: 826 XXXXXXXPXXP-PPPXPPP 879 P P PPP PP Sbjct: 320 QGYDYPKPAIPFPPPTAPP 338 Score = 29.1 bits (62), Expect = 8.8 Identities = 25/91 (27%), Positives = 25/91 (27%), Gaps = 7/91 (7%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP--PPXP---PXXXX 804 P P PPP PFP PP P P P PP P P Sbjct: 465 PTNPPQPKYLPPPQPKSGYDYPKPAIPFP-APTNPPQKYLPPPVIPTSPPVPKYLPPTNP 523 Query: 805 XXXXXXXXXXXXXXPXXPPP--PXPPPXXPP 891 P P P PPP PP Sbjct: 524 PTPQYLPPVQVKQGYDYPKPAIPFPPPTAPP 554 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.019 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP PP P P PPPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPP------PPPPPPMPGRAGGPPPPPPPPGMGGP--- 566 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 567 -PPPPMPGMMRPGGGPPPPPMMMGP 590 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP G P P PP P PPP PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPPPPPGMGGPPP 568 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 569 PPMPGMMRPGGGPPPP 584 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPX 868 P G GAPP P PP P P PPPP P P PP Sbjct: 515 PPPPGGGGAPPPPP----PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 869 XPPXXPPXXXP 901 P P P Sbjct: 571 MPGMMRPGGGP 581 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP 777 PPPP PPP G P P GP P P P Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLKP 601 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.019 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP PP P P PPPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPP------PPPPPPMPGRAGGPPPPPPPPGMGGP--- 566 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 567 -PPPPMPGMMRPGGGPPPPPMMMGP 590 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP G P P PP P PPP PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPPPPPGMGGPPP 568 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 569 PPMPGMMRPGGGPPPP 584 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPX 868 P G GAPP P PP P P PPPP P P PP Sbjct: 515 PPPPGGGGAPPPPP----PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 869 XPPXXPPXXXP 901 P P P Sbjct: 571 MPGMMRPGGGP 581 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP 777 PPPP PPP G P P GP P P P Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLKP 601 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.019 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP PP P P PPPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPP------PPPPPPMPGRAGGPPPPPPPPGMGGP--- 566 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 567 -PPPPMPGMMRPGGGPPPPPMMMGP 590 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP G P P PP P PPP PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPPPPPGMGGPPP 568 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 569 PPMPGMMRPGGGPPPP 584 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPX 868 P G GAPP P PP P P PPPP P P PP Sbjct: 515 PPPPGGGGAPPPPP----PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 869 XPPXXPPXXXP 901 P P P Sbjct: 571 MPGMMRPGGGP 581 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP 777 PPPP PPP G P P GP P P P Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLKP 601 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 37.9 bits (84), Expect = 0.019 Identities = 25/85 (29%), Positives = 25/85 (29%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P G PP PP P P PPPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPP------PPPPPPMPGRAGGPPPPPPPPGMGGP--- 566 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PP P P Sbjct: 567 -PPPPMPGMMRPGGGPPPPPMMMGP 590 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/76 (28%), Positives = 22/76 (28%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP G P P PP P PPP PP Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPP-----PPPPMPGRAGGPPPPPPPPGMGGPPP 568 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 569 PPMPGMMRPGGGPPPP 584 Score = 36.3 bits (80), Expect = 0.058 Identities = 22/71 (30%), Positives = 22/71 (30%) Frame = +2 Query: 689 PXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPX 868 P G GAPP P PP P P PPPP P P PP Sbjct: 515 PPPPGGGGAPPPPP----PPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Query: 869 XPPXXPPXXXP 901 P P P Sbjct: 571 MPGMMRPGGGP 581 Score = 29.5 bits (63), Expect = 6.7 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXP 777 PPPP PPP G P P GP P P P Sbjct: 556 PPPPPPGMGGPPPPPMPGMMRPGGGPPPPPMMMGPMVPVLPHGLKP 601 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 37.5 bits (83), Expect = 0.025 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GGG G G G GG G Sbjct: 30 GGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGG--GGFSSGGGGGFSSGVGG 87 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 36.7 bits (81), Expect = 0.044 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G GGGG G G G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGS 101 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 102 GGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 36.3 bits (80), Expect = 0.058 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 4/105 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG----GXGXXXGXXXXGXGGTXX 733 G GG GG GG G G GGG G G G GG Sbjct: 34 GGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGF 93 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNSXXCLRFIIY*H 598 G GG G GG GGG ++ IY H Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLVQKHIYVH 138 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGG G GG GGG G G GG G G Sbjct: 29 GGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 873 GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG--APXPX 700 G GG G G GGG G G G GG G GG + Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Query: 699 XXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 87 GGGGGGFGGGFGGGSGGG 104 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 37.5 bits (83), Expect = 0.025 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GGG G G G GG G Sbjct: 30 GGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGG--GFSSGGGGGFSSGGGG 87 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 36.7 bits (81), Expect = 0.044 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G GGGG G G G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGS 101 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 102 GGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 36.3 bits (80), Expect = 0.058 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 4/105 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG----GXGXXXGXXXXGXGGTXX 733 G GG GG GG G G GGG G G G GG Sbjct: 34 GGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGF 93 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNSXXCLRFIIY*H 598 G GG G GG GGG ++ IY H Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLVQKHIYVH 138 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 873 GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG--APXPX 700 G GG G G GGG G G G GG G GG + Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 699 XXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 87 GGGGGGFGGGFGGGSGGG 104 Score = 29.1 bits (62), Expect = 8.8 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = -1 Query: 890 GGXXGGGXGGGG--XXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GG G GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 37.5 bits (83), Expect = 0.025 Identities = 26/81 (32%), Positives = 27/81 (33%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G G GG G G G GG G+GG Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFG-GGRGAFGGRGGG- 67 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 68 GGRGGGGRGGGGRGGGGRGGG 88 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 37.5 bits (83), Expect = 0.025 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GGG G G G GG G Sbjct: 30 GGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGG--GFSSGGGGGFSSGGGG 87 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 36.7 bits (81), Expect = 0.044 Identities = 29/105 (27%), Positives = 32/105 (30%), Gaps = 4/105 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG----GXGXXXGXXXXGXGGTXX 733 G GG GG GG G G GGG G G G GG Sbjct: 34 GGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGF 93 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNSXXCLRFIIY*H 598 G GG G GG GGG + ++ IY H Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGATTLVQKHIYVH 138 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 873 GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG--APXPX 700 G GG G G GGG G G G GG G GG + Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 699 XXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 87 GGGGGGFGGGFGGGSGGG 104 Score = 29.1 bits (62), Expect = 8.8 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = -1 Query: 890 GGXXGGGXGGGG--XXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GG G GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 37.5 bits (83), Expect = 0.025 Identities = 26/85 (30%), Positives = 26/85 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G GGG G G G GG G Sbjct: 30 GGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGG--GFSSGGGGGFSSGGGG 87 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 88 GGGGGFGGGFGGGSGGGSGGGFGGG 112 Score = 36.7 bits (81), Expect = 0.044 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G GGGG G G G G Sbjct: 42 GGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGS 101 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 102 GGGSGGGFGGGGSIGGFGGGGGGGG 126 Score = 36.3 bits (80), Expect = 0.058 Identities = 29/105 (27%), Positives = 31/105 (29%), Gaps = 4/105 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGG----GXGXXXGXXXXGXGGTXX 733 G GG GG GG G G GGG G G G GG Sbjct: 34 GGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGF 93 Query: 732 XXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNSXXCLRFIIY*H 598 G GG G GG GGG ++ IY H Sbjct: 94 GGGFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLVQKHIYVH 138 Score = 29.1 bits (62), Expect = 8.8 Identities = 22/78 (28%), Positives = 23/78 (29%), Gaps = 2/78 (2%) Frame = -3 Query: 873 GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG--APXPX 700 G GG G G GGG G G G GG G GG + Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 699 XXXGXXXGGXXXXXXGGG 646 G GG GGG Sbjct: 87 GGGGGGFGGGFGGGSGGG 104 Score = 29.1 bits (62), Expect = 8.8 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = -1 Query: 890 GGXXGGGXGGGG--XXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GG G GG GGG G G GG G G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 >AE014298-962|AAF46206.1| 230|Drosophila melanogaster CG4547-PA protein. Length = 230 Score = 28.7 bits (61), Expect(2) = 0.044 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP PP + Sbjct: 171 PPPPCPPPSLPPSM 184 Score = 27.1 bits (57), Expect(2) = 0.044 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 P P P P+ PPP PP Sbjct: 161 PAAPCPPQPAPPPPCPP 177 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 36.7 bits (81), Expect = 0.044 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 545 Query: 854 XXPPXXPP 877 PP PP Sbjct: 546 GIPPPPPP 553 Score = 34.7 bits (76), Expect = 0.18 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 APP P PP P P P PPPP P P P PP P Sbjct: 484 APPPPPPP--PPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFP-XXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP P P PP P PP P P PPPP P Sbjct: 486 PPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 545 Query: 824 XXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 546 GIPPPPPPMSASPSKTTISPAPLPDP 571 Score = 33.1 bits (72), Expect = 0.54 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP---SXPPPXPP 792 + PPPP PPP P G PP P P PPP PP Sbjct: 498 VAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 553 Score = 31.5 bits (68), Expect = 1.7 Identities = 19/74 (25%), Positives = 20/74 (27%) Frame = +1 Query: 670 PPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXP 849 PPP P P PP P + PPP PP Sbjct: 485 PPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 544 Query: 850 XXPPPPXPPPXXPP 891 PPP PP P Sbjct: 545 GGIPPPPPPMSASP 558 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 497 FVAPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 540 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 500 PPPPPPPPPPPPPLA 514 Score = 29.5 bits (63), Expect = 6.7 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 490 PPPPLPAFVAPPP-------------PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 536 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 537 PPAPIEGGGGIPPPPP 552 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 36.7 bits (81), Expect = 0.044 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 640 Query: 854 XXPPXXPP 877 PP PP Sbjct: 641 GIPPPPPP 648 Score = 34.7 bits (76), Expect = 0.18 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 APP P PP P P P PPPP P P P PP P Sbjct: 579 APPPPPPP--PPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXX-VPPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP P P PP P PP P P PPPP P Sbjct: 581 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 640 Query: 824 XXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 641 GIPPPPPPMSASPSKTTISPAPLPDP 666 Score = 33.1 bits (72), Expect = 0.54 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP---SXPPPXPP 792 + PPPP PPP P G PP P P PPP PP Sbjct: 593 VAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 648 Score = 31.5 bits (68), Expect = 1.7 Identities = 19/74 (25%), Positives = 20/74 (27%) Frame = +1 Query: 670 PPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXP 849 PPP P P PP P + PPP PP Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 639 Query: 850 XXPPPPXPPPXXPP 891 PPP PP P Sbjct: 640 GGIPPPPPPMSASP 653 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 592 FVAPPPPPP----PPPPPPPMANYGAPP-------PPPPPPPGSGSAPPPPPPAP 635 Score = 29.5 bits (63), Expect = 6.7 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 585 PPPPLPAFVAPPP-------------PPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 631 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 632 PPAPIEGGGGIPPPPP 647 Score = 29.1 bits (62), Expect = 8.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP ++ Sbjct: 595 PPPPPPPPPPPPPMA 609 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 36.7 bits (81), Expect = 0.044 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 773 Query: 854 XXPPXXPP 877 PP PP Sbjct: 774 GIPPPPPP 781 Score = 34.7 bits (76), Expect = 0.18 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 APP P PP P P P PPPP P P P PP P Sbjct: 712 APPPPPPP--PPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/86 (25%), Positives = 22/86 (25%), Gaps = 1/86 (1%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXX-VPPXPXXXXPXXXPXPPPPXPXXXXXXX 823 PPP P P PP P PP P P PPPP P Sbjct: 714 PPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGG 773 Query: 824 XXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 774 GIPPPPPPMSASPSKTTISPAPLPDP 799 Score = 33.1 bits (72), Expect = 0.54 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 3/56 (5%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP---SXPPPXPP 792 + PPPP PPP P G PP P P PPP PP Sbjct: 726 VAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPP 781 Score = 31.5 bits (68), Expect = 1.7 Identities = 19/74 (25%), Positives = 20/74 (27%) Frame = +1 Query: 670 PPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXP 849 PPP P P PP P + PPP PP Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 772 Query: 850 XXPPPPXPPPXXPP 891 PPP PP P Sbjct: 773 GGIPPPPPPMSASP 786 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/55 (34%), Positives = 19/55 (34%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 725 FVAPPPPPP----PPPPPPPMANYGAPP-------PPPPPPPGSGSAPPPPPPAP 768 Score = 29.5 bits (63), Expect = 6.7 Identities = 21/76 (27%), Positives = 21/76 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 718 PPPPLPAFVAPPP-------------PPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPP 764 Query: 820 XXXXXXXXXPXXPPPP 867 PPPP Sbjct: 765 PPAPIEGGGGIPPPPP 780 Score = 29.1 bits (62), Expect = 8.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP ++ Sbjct: 728 PPPPPPPPPPPPPMA 742 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 36.3 bits (80), Expect = 0.058 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 535 Query: 854 XXPPXXPP 877 P PP Sbjct: 536 GGIPPPPP 543 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +2 Query: 653 PXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXP 832 P PP P PP P PP P P PPPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 833 XXXXPXXXXPPXXPP 877 PP PP Sbjct: 530 APIEGGGGIPPPPPP 544 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P PPPP P Sbjct: 481 PPPLHAFVAPPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 537 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 538 IPPPPPPMSASPSKTTISPAPLPDP 562 Score = 33.1 bits (72), Expect = 0.54 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-----SXPPPXPP 792 + PPPP PPP P P G P P P P PPP PP Sbjct: 488 VAPPPPPPPPPPPPPPLANYGAPPPPPPP-PPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 APP P PP P P PPPP P P P PP P Sbjct: 474 APPPPPPP--PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 PP P V P P P PPPP P P P P PP P Sbjct: 480 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 491 PPPPPPPPPPPPPLA 505 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 487 FVAPPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 531 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 480 PPPPLHAFVAPPPP------------PPPPPPPPPPLANYGAPP-PPPPPPPGSGSAPPP 526 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 PPPP P P Sbjct: 527 PPPAPIEGGGGIPPPPPPMSASP 549 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP-XPXXXXXXXXXPXXXXPXX 853 P P APP P PP P PPPP P P P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVV 380 Query: 854 XXPPXXPPXXPPXXXP 901 PP PP PP P Sbjct: 381 APPP--PPPPPPAAVP 394 Score = 33.1 bits (72), Expect = 0.54 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP PP P P P PPPP Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXG-APPFPXXXX----VPPXPXXXXPXXXPXPPPPXP 802 PP PP P G APP P PP P P P PPPP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAP-PPPPPP 388 Score = 30.7 bits (66), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P PPPP P P PP PP P P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP--PPAAVPPPPPPPMPVGEIP 407 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PPP P PP P P P+ PP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPP 398 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP-XPXXXXXXXXXPXXXXPXX 853 P P APP P PP P PPPP P P P Sbjct: 288 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVV 347 Query: 854 XXPPXXPPXXPPXXXP 901 PP PP PP P Sbjct: 348 APPP--PPPPPPAAVP 361 Score = 33.1 bits (72), Expect = 0.54 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP PP P P P PPPP Sbjct: 326 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 366 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXG-APPFPXXXX----VPPXPXXXXPXXXPXPPPPXP 802 PP PP P G APP P PP P P P PPPP P Sbjct: 301 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAP-PPPPPP 355 Score = 30.7 bits (66), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P PPPP P P PP PP P P Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP--PPAAVPPPPPPPMPVGEIP 374 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PPP P PP P P P+ PP PP Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPP 365 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP-XPXXXXXXXXXPXXXXPXX 853 P P APP P PP P PPPP P P P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVV 380 Query: 854 XXPPXXPPXXPPXXXP 901 PP PP PP P Sbjct: 381 APPP--PPPPPPAAVP 394 Score = 33.1 bits (72), Expect = 0.54 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP PP P P P PPPP Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXG-APPFPXXXX----VPPXPXXXXPXXXPXPPPPXP 802 PP PP P G APP P PP P P P PPPP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAP-PPPPPP 388 Score = 30.7 bits (66), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P PPPP P P PP PP P P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP--PPAAVPPPPPPPMPVGEIP 407 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PPP P PP P P P+ PP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPP 398 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 36.3 bits (80), Expect = 0.058 Identities = 23/76 (30%), Positives = 23/76 (30%), Gaps = 1/76 (1%) Frame = +2 Query: 677 PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP-XPXXXXXXXXXPXXXXPXX 853 P P APP P PP P PPPP P P P Sbjct: 321 PTRHPSNGNQRTAPPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVV 380 Query: 854 XXPPXXPPXXPPXXXP 901 PP PP PP P Sbjct: 381 APPP--PPPPPPAAVP 394 Score = 33.1 bits (72), Expect = 0.54 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP PP P P P PPPP Sbjct: 359 PPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 5/56 (8%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXG-APPFPXXXX----VPPXPXXXXPXXXPXPPPPXP 802 PP PP P G APP P PP P P P PPPP P Sbjct: 334 PPLPPARQPPPAVPVTVPGAARAPPPPNRPPPISTAPPPPPVSAPVVAP-PPPPPP 388 Score = 30.7 bits (66), Expect = 2.9 Identities = 17/59 (28%), Positives = 17/59 (28%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P PPPP P P PP PP P P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPP--PPAAVPPPPPPPMPVGEIP 407 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 649 PXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PPP P PP P P P+ PP PP Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPP 398 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 36.3 bits (80), Expect = 0.058 Identities = 24/88 (27%), Positives = 25/88 (28%), Gaps = 5/88 (5%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXG----PPXPXXPXPSXPPPXPP-XXXXX 807 PPP PP P P PP P P P+ PP PP Sbjct: 237 PPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPA 296 Query: 808 XXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PPP PPP PP Sbjct: 297 TYLPPTNKPLPPVTTRLPPPPPPPRTPP 324 Score = 35.1 bits (77), Expect = 0.13 Identities = 24/88 (27%), Positives = 25/88 (28%), Gaps = 5/88 (5%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PP P P P P P + PP PP Sbjct: 280 PPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTKPPTTRPPA 339 Query: 823 XXXXXXXXPXXPPP-----PXPPPXXPP 891 P PPP P PPP PP Sbjct: 340 TYLPPTNKP--PPPVTTRRPTPPPTRPP 365 Score = 33.1 bits (72), Expect = 0.54 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +1 Query: 622 TXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 T T PPPP PP P P P P P+ PPP P Sbjct: 524 TVRTTRPPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPPPP 579 Score = 31.5 bits (68), Expect = 1.7 Identities = 23/83 (27%), Positives = 24/83 (28%), Gaps = 4/83 (4%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPX--PXXXXPXXXPXPPPP--XPXXXXX 817 PP PP P PP P +PP P P PPPP P Sbjct: 185 PPTRPPTRPPTRPPTRPPTR--PPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRP 242 Query: 818 XXXXPXXXXPXXXXPPXXPPXXP 886 P P PP P P Sbjct: 243 PTRPPTTRPPATYLPPTNKPLPP 265 Score = 31.5 bits (68), Expect = 1.7 Identities = 22/81 (27%), Positives = 22/81 (27%), Gaps = 5/81 (6%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPX--PXXXXPXXXPXP---PPPXPXXXXXXXXXPXX 838 PP P PP P PP P P P PP P Sbjct: 257 PPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPP 316 Query: 839 XXPXXXXPPXXPPXXPPXXXP 901 P PP PP PP P Sbjct: 317 PPPPRTPPPTRPPTKPPTTRP 337 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P PP P P PP PP PP P Sbjct: 190 PTRPPTRPPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRP 242 Score = 30.7 bits (66), Expect = 2.9 Identities = 21/87 (24%), Positives = 22/87 (25%), Gaps = 2/87 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXX--GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXX 820 PPP PP P P P +PP P PP P Sbjct: 237 PPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPA 296 Query: 821 XXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P Sbjct: 297 TYLPPTNKPLPPVTTRLPPPPPPPRTP 323 Score = 30.3 bits (65), Expect = 3.8 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP P P P P P P+ PP PP Sbjct: 364 PPPPPTRASTPAPTYLPPT-----NKPLPPVTVRTTVRTTPRPTPPPTKPPTRPPTTYLP 418 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP PP PP Sbjct: 419 PPTVRTTRPP---PPPTRPPTKPP 439 Score = 30.3 bits (65), Expect = 3.8 Identities = 22/84 (26%), Positives = 23/84 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP P P P P P P+ PP PP Sbjct: 575 PPPPPTRASTPAPTYLPPT-----NKPLPPVTVRTTVRTTPRPTLPPTKPPTRPPTTYLP 629 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 P PPP PP PP Sbjct: 630 PPSVRTTRPP---PPPTRPPTKPP 650 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/84 (22%), Positives = 20/84 (23%) Frame = +2 Query: 650 PPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXX 829 PP PP P P P +PP P PP P Sbjct: 197 PPTRPPTRPPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYL 256 Query: 830 PXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P P Sbjct: 257 PPTNKPLPPVTTRLPPPPPSPRTP 280 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +1 Query: 742 PPXPXXPXPSXPPPX--PPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 PP P P+ PP PP P PPP PPP PP Sbjct: 530 PPPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTPPPTRPPP--PP 579 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 36.3 bits (80), Expect = 0.058 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P P Sbjct: 486 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 545 Query: 854 XXPPXXPP 877 P PP Sbjct: 546 GGIPPPPP 553 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +2 Query: 653 PXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXP 832 P PP P PP P PP P P PPPP P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Query: 833 XXXXPXXXXPPXXPP 877 PP PP Sbjct: 540 APIEGGGGIPPPPPP 554 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P PPPP P Sbjct: 491 PPPLHAFVAPPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 547 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 548 IPPPPPPMSASPSKTTISPAPLPDP 572 Score = 33.1 bits (72), Expect = 0.54 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-----SXPPPXPP 792 + PPPP PPP P P G P P P P PPP PP Sbjct: 498 VAPPPPPPPPPPPPPPLANYGAPPPPPPP-PPGSGSAPPPPPPAPIEGGGGIPPPPPP 554 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 APP P PP P P PPPP P P P PP P Sbjct: 484 APPPPPPP--PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 PP P V P P P PPPP P P P P PP P Sbjct: 490 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 501 PPPPPPPPPPPPPLA 515 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 497 FVAPPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 541 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 490 PPPPLHAFVAPPPP------------PPPPPPPPPPLANYGAPP-PPPPPPPGSGSAPPP 536 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 PPPP P P Sbjct: 537 PPPAPIEGGGGIPPPPPPMSASP 559 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 36.3 bits (80), Expect = 0.058 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P P Sbjct: 476 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 535 Query: 854 XXPPXXPP 877 P PP Sbjct: 536 GGIPPPPP 543 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +2 Query: 653 PXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXP 832 P PP P PP P PP P P PPPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 833 XXXXPXXXXPPXXPP 877 PP PP Sbjct: 530 APIEGGGGIPPPPPP 544 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P PPPP P Sbjct: 481 PPPLHAFVAPPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 537 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 538 IPPPPPPMSASPSKTTISPAPLPDP 562 Score = 33.1 bits (72), Expect = 0.54 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-----SXPPPXPP 792 + PPPP PPP P P G P P P P PPP PP Sbjct: 488 VAPPPPPPPPPPPPPPLANYGAPPPPPPP-PPGSGSAPPPPPPAPIEGGGGIPPPPPP 544 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 APP P PP P P PPPP P P P PP P Sbjct: 474 APPPPPPP--PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 PP P V P P P PPPP P P P P PP P Sbjct: 480 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 491 PPPPPPPPPPPPPLA 505 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 487 FVAPPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 531 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 480 PPPPLHAFVAPPPP------------PPPPPPPPPPLANYGAPP-PPPPPPPGSGSAPPP 526 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 PPPP P P Sbjct: 527 PPPAPIEGGGGIPPPPPPMSASP 549 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 36.3 bits (80), Expect = 0.058 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P P Sbjct: 634 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 693 Query: 854 XXPPXXPP 877 P PP Sbjct: 694 GGIPPPPP 701 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +2 Query: 653 PXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXP 832 P PP P PP P PP P P PPPP P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Query: 833 XXXXPXXXXPPXXPP 877 PP PP Sbjct: 688 APIEGGGGIPPPPPP 702 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P PPPP P Sbjct: 639 PPPLHAFVAPPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 695 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 696 IPPPPPPMSASPSKTTISPAPLPDP 720 Score = 33.1 bits (72), Expect = 0.54 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-----SXPPPXPP 792 + PPPP PPP P P G P P P P PPP PP Sbjct: 646 VAPPPPPPPPPPPPPPLANYGAPPPPPPP-PPGSGSAPPPPPPAPIEGGGGIPPPPPP 702 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 APP P PP P P PPPP P P P PP P Sbjct: 632 APPPPPPP--PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 PP P V P P P PPPP P P P P PP P Sbjct: 638 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 649 PPPPPPPPPPPPPLA 663 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 645 FVAPPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 689 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 638 PPPPLHAFVAPPPP------------PPPPPPPPPPLANYGAPP-PPPPPPPGSGSAPPP 684 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 PPPP P P Sbjct: 685 PPPAPIEGGGGIPPPPPPMSASP 707 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 36.3 bits (80), Expect = 0.058 Identities = 20/68 (29%), Positives = 20/68 (29%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXX 853 PP P APP P PP P P PPPP P P Sbjct: 581 PPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 640 Query: 854 XXPPXXPP 877 P PP Sbjct: 641 GGIPPPPP 648 Score = 35.1 bits (77), Expect = 0.13 Identities = 20/75 (26%), Positives = 20/75 (26%) Frame = +2 Query: 653 PXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXP 832 P PP P PP P PP P P PPPP P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Query: 833 XXXXPXXXXPPXXPP 877 PP PP Sbjct: 635 APIEGGGGIPPPPPP 649 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PPP PP P PP PP P P PPPP P Sbjct: 586 PPPLHAFVAPPPPPPPPPP---PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGG 642 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P P P Sbjct: 643 IPPPPPPMSASPSKTTISPAPLPDP 667 Score = 33.1 bits (72), Expect = 0.54 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 5/58 (8%) Frame = +1 Query: 634 IFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXP-----SXPPPXPP 792 + PPPP PPP P P G P P P P PPP PP Sbjct: 593 VAPPPPPPPPPPPPPPLANYGAPPPPPPP-PPGSGSAPPPPPPAPIEGGGGIPPPPPP 649 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +2 Query: 713 APPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 APP P PP P P PPPP P P P PP P Sbjct: 579 APPPPPPP--PPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 PP P V P P P PPPP P P P P PP P Sbjct: 585 PPPPLHAFVAPPPPPPPP-----PPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 29.9 bits (64), Expect = 5.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP PP L+ Sbjct: 596 PPPPPPPPPPPPPLA 610 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/56 (33%), Positives = 19/56 (33%) Frame = +2 Query: 635 FFXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 F PPP P P GAPP PP P P PPPP P Sbjct: 592 FVAPPPPPPP----PPPPPPPLANYGAPP-------PPPPPPPGSGSAPPPPPPAP 636 Score = 29.1 bits (62), Expect = 8.8 Identities = 23/83 (27%), Positives = 23/83 (27%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP P P PP P PPP PP Sbjct: 585 PPPPLHAFVAPPPP------------PPPPPPPPPPLANYGAPP-PPPPPPPGSGSAPPP 631 Query: 820 XXXXXXXXXPXXPPPPXPPPXXP 888 PPPP P P Sbjct: 632 PPPAPIEGGGGIPPPPPPMSASP 654 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 35.9 bits (79), Expect = 0.077 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = -1 Query: 878 GGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXPRXXX 699 GGG GGGG G GG GGG G G GG G G Sbjct: 22 GGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHG 81 Query: 698 XXXXXXXGGG 669 GGG Sbjct: 82 GGGGGGGGGG 91 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -3 Query: 795 GGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGGG G G G GG G GG G GG GGG Sbjct: 38 GGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGG 87 Score = 30.7 bits (66), Expect = 2.9 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G G GG G G G GGGG G G G GG G Sbjct: 28 GGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGG--GNGGGGKHGGGGG 85 Query: 720 GG 715 GG Sbjct: 86 GG 87 Score = 30.3 bits (65), Expect = 3.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = -3 Query: 795 GGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 GGGG G G G GG GG G GG GGG Sbjct: 37 GGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGG 86 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G GG KGG G GG G G Sbjct: 24 GGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNG 75 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 461 PPAPGG---PGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 432 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 356 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 400 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 453 Query: 884 P 886 P Sbjct: 454 P 454 >BT011110-1|AAR82777.1| 1777|Drosophila melanogaster LD32107p protein. Length = 1777 Score = 35.5 bits (78), Expect = 0.10 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P VPP P P P PPPP P Sbjct: 1273 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1301 Score = 25.4 bits (53), Expect(2) = 0.90 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P P P P P PP PP Sbjct: 1271 PTPPKPVAAPVPPPPLPLTPPAAPP 1295 Score = 25.4 bits (53), Expect(2) = 0.90 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 847 PXXPPPPXPPP 879 P PPPP PPP Sbjct: 1291 PAAPPPPPPPP 1301 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 430 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 463 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 464 PPAPGG---PGAPPPPPPPP 480 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 435 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 476 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 359 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 417 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 403 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 456 Query: 884 P 886 P Sbjct: 457 P 457 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 573 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 623 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 547 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 606 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 607 PPAPGG---PGAPPPPPPPP 623 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 570 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 578 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 619 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 502 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 560 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 546 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 599 Query: 884 P 886 P Sbjct: 600 P 600 >AE014298-1311|AAF46472.2| 1837|Drosophila melanogaster CG12124-PA protein. Length = 1837 Score = 35.5 bits (78), Expect = 0.10 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P VPP P P P PPPP P Sbjct: 1333 PPKPVAAPVPPPPLPLTPPAAPPPPPPPP 1361 Score = 25.4 bits (53), Expect(2) = 0.90 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P P P P P PP PP Sbjct: 1331 PTPPKPVAAPVPPPPLPLTPPAAPP 1355 Score = 25.4 bits (53), Expect(2) = 0.90 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 847 PXXPPPPXPPP 879 P PPPP PPP Sbjct: 1351 PAAPPPPPPPP 1361 >AE014134-2469|AAS64704.1| 1853|Drosophila melanogaster CG32972-PA, isoform A protein. Length = 1853 Score = 35.5 bits (78), Expect = 0.10 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 4/55 (7%) Frame = +1 Query: 739 GPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXP----PPXXPP 891 GPP P P P P PP P PPPP P PP PP Sbjct: 1791 GPPAFPLPPPRFPLPPPPFPFIGSLPEADSAVIAILPIPPPPPIPAFPRPPPRPP 1845 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 572 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 622 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 546 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 605 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 606 PPAPGG---PGAPPPPPPPP 622 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 569 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 577 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 618 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 501 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 559 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 545 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 598 Query: 884 P 886 P Sbjct: 599 P 599 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 461 PPAPGG---PGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 432 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 356 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 400 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 453 Query: 884 P 886 P Sbjct: 454 P 454 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 461 PPAPGG---PGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 432 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 356 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 400 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 453 Query: 884 P 886 P Sbjct: 454 P 454 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 427 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 477 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 401 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 460 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 461 PPAPGG---PGAPPPPPPPP 477 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 424 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 432 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 473 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 356 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 414 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 400 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 453 Query: 884 P 886 P Sbjct: 454 P 454 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 35.5 bits (78), Expect = 0.10 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 P PP PPP P G PP P P PPP PP Sbjct: 430 PAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPP 480 Score = 32.3 bits (70), Expect = 0.95 Identities = 21/80 (26%), Positives = 21/80 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P P PPP P P P PPP PP Sbjct: 404 PGGPPAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGP 463 Query: 820 XXXXXXXXXPXXPPPPXPPP 879 P PPPP PPP Sbjct: 464 PPAPGG---PGAPPPPPPPP 480 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 3/53 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXG---APPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP P G G APP P P P P P PPPP Sbjct: 427 PPPPAPPQMFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 632 LFFXXPPPXXXXXXPPXXXP-XXXXGXGAPPFPXXXXVPPXP 754 +F PPP PP P G G PP P PP P Sbjct: 435 MFNGAPPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPP 476 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 G P P P P PP P P PP P PPP P Sbjct: 359 GPPVPPPQQQAENPYGQVPMPPPMNPSQQQQPGQVPLNRMSSQGGPGGPPAPAPPPPPP 417 Score = 29.5 bits (63), Expect = 6.7 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +2 Query: 704 GXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXX 883 G G PP P PP P PPPP P P PP PP Sbjct: 403 GPGGPPAPAP---PPPPPSFGGAAGGGPPPPAPPQMFNGAPPP---PAMGGGPPPAPPAP 456 Query: 884 P 886 P Sbjct: 457 P 457 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 35.1 bits (77), Expect = 0.13 Identities = 16/50 (32%), Positives = 17/50 (34%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P P+ P PP P PPPP PPP PP Sbjct: 135 PQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEPPPPPPPPPPPTAPP 184 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 35.1 bits (77), Expect = 0.13 Identities = 18/56 (32%), Positives = 20/56 (35%) Frame = +1 Query: 721 FPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 +P P P P+ PPP PP P PPPP PPP P Sbjct: 33 YPEPYRNPNPNPVPDPTRPPPPPP------SPPCGRPPPGSPPPGPPPPGPPPGCP 82 Score = 30.7 bits (66), Expect = 2.9 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 746 PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P P PPPP P P P PP PP PP P Sbjct: 40 PNPNPVPDPTRPPPPPPSP---------PCGRPPPGSPPPGPPPPGPPPGCP 82 Score = 30.7 bits (66), Expect = 2.9 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G P P P P PPP PP Sbjct: 54 PPPSPPCGRPPPGSPPPGPPPPGPP 78 >X62636-1|CAA44502.1| 326|Drosophila melanogaster hrp36.1 protein. Length = 326 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGSGGGPWNNQGGGNGGWN 287 Score = 31.5 bits (68), Expect = 1.7 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 5/90 (5%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-----GXXXGXXXXGXGGTX 736 G GG G G G G GGGG G G G GG Sbjct: 207 GPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWN 266 Query: 735 XXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG P G GG GGG Sbjct: 267 QQGGSGGG--PWNNQGGGNGGWNGGGGGGG 294 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX-----GGGGXGXXXGXXXXGXGGTX 736 G GG GG GG G G G GGGG G G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 735 XXXGKGG 715 G+GG Sbjct: 311 GGGGQGG 317 >X59691-1|CAA42212.1| 386|Drosophila melanogaster P11 (hnRNP protein) protein. Length = 386 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGTGGGPWNNQGGGNGGWN 287 Score = 32.7 bits (71), Expect = 0.72 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXG---XGGGGXGXXXGXXXXGXGGTXXX 730 G GG GG GG G G G GGGG G G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 729 XGKGG 715 G GG Sbjct: 311 GGGGG 315 Score = 32.3 bits (70), Expect = 0.95 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GG G G G + G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGG- 309 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKNS 631 G G GGG +NS Sbjct: 310 --GGGGGGGFGNEYQQSYGGGPQRNS 333 >X58183-1|CAA41170.1| 386|Drosophila melanogaster heterogeneous nuclear ribonucleoproteinprotein. Length = 386 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGRGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGTGGGPWNNQGGGNGGWN 287 Score = 32.7 bits (71), Expect = 0.72 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXG---XGGGGXGXXXGXXXXGXGGTXXX 730 G GG GG GG G G G GGGG G G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 729 XGKGG 715 G GG Sbjct: 311 GGGGG 315 Score = 32.3 bits (70), Expect = 0.95 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GG G G G + G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGTGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGG- 309 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKNS 631 G G GGG +NS Sbjct: 310 --GGGGGGGFGNEYQQSYGGGPQRNS 333 >X54803-1|CAA38574.1| 386|Drosophila melanogaster Hrb87F protein. Length = 386 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGSGGGPWNNQGGGNGGWN 287 Score = 32.7 bits (71), Expect = 0.72 Identities = 21/65 (32%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXG---XGGGGXGXXXGXXXXGXGGTXXX 730 G GG GG GG G G G GGGG G G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGGG 310 Query: 729 XGKGG 715 G GG Sbjct: 311 GGGGG 315 Score = 32.3 bits (70), Expect = 0.95 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GG G G G + G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGGYGGGNSNGSWGGNGG- 309 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKNS 631 G G GGG +NS Sbjct: 310 --GGGGGGGFGNEYQQSYGGGPQRNS 333 Score = 31.5 bits (68), Expect = 1.7 Identities = 26/90 (28%), Positives = 26/90 (28%), Gaps = 5/90 (5%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-----GXXXGXXXXGXGGTX 736 G GG G G G G GGGG G G G GG Sbjct: 207 GPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWN 266 Query: 735 XXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GG P G GG GGG Sbjct: 267 QQGGSGGG--PWNNQGGGNGGWNGGGGGGG 294 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 34.7 bits (76), Expect = 0.18 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GGG G G G G G+G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGF-----GGRGGGGRGGGGFGGRGGRGGGGRG 697 >BT012315-1|AAS77440.1| 385|Drosophila melanogaster LD32727p protein. Length = 385 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGSGGGPWNNQGGGNGGWN 287 Score = 30.3 bits (65), Expect = 3.8 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-----GXXXGXXXXGXGGTX 736 G GG G G G G GGGG G G G GG Sbjct: 207 GPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWN 266 Query: 735 XXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GG P G GG GG NS Sbjct: 267 QQGGSGGG--PWNNQGGGNGGWNGGGGGGYGGGNS 299 Score = 30.3 bits (65), Expect = 3.8 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX-GGGGXGXXXGXXXXGXGGTXXXXG 724 G GG GG GG G G G GGG G G G G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 723 KGG 715 GG Sbjct: 311 GGG 313 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 151 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 209 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 210 GSSASSSVGVIGGG 223 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 31 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 80 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 268 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 322 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 323 GGGGSYGGGYGG 334 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 34.7 bits (76), Expect = 0.18 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GGG G G G G G+G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGF-----GGRGGGGRGGGGFGGRGGRGGGGRG 697 >AE014297-1716|AAF54967.1| 385|Drosophila melanogaster CG12749-PA, isoform A protein. Length = 385 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGSGGGPWNNQGGGNGGWN 287 Score = 30.3 bits (65), Expect = 3.8 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-----GXXXGXXXXGXGGTX 736 G GG G G G G GGGG G G G GG Sbjct: 207 GPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWN 266 Query: 735 XXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GG P G GG GG NS Sbjct: 267 QQGGSGGG--PWNNQGGGNGGWNGGGGGGYGGGNS 299 Score = 30.3 bits (65), Expect = 3.8 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGX-GGGGXGXXXGXXXXGXGGTXXXXG 724 G GG GG GG G G G GGG G G G G G Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 723 KGG 715 GG Sbjct: 311 GGG 313 >AE014297-1715|AAN13574.1| 325|Drosophila melanogaster CG12749-PB, isoform B protein. Length = 325 Score = 34.7 bits (76), Expect = 0.18 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG G GG G G GGG G G G G G+GG Sbjct: 203 GGRGGPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGS 262 Query: 708 XPXXXXGXXXGGXXXXXXGGGXXKN 634 G GG GG N Sbjct: 263 GGWNQQGGSGGGPWNNQGGGNGGWN 287 Score = 31.1 bits (67), Expect = 2.2 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXG--XGGGGXGXXXGXXXXGXGGTXXXX 727 G GG GG GG G G G GGGG G G GG Sbjct: 251 GGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGGYGGGNSNGSWGGNGGGG 310 Query: 726 GKG 718 G G Sbjct: 311 GGG 313 Score = 30.3 bits (65), Expect = 3.8 Identities = 27/95 (28%), Positives = 27/95 (28%), Gaps = 5/95 (5%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGX-----GXXXGXXXXGXGGTX 736 G GG G G G G GGGG G G G GG Sbjct: 207 GPRAGGRGGQGDRGQGGGGWGGQNRQNGGGNWGGAGGGGGFGNSGGNFGGGQGGGSGGWN 266 Query: 735 XXXGKGGAPXPXXXXGXXXGGXXXXXXGGGXXKNS 631 G GG P G GG GG NS Sbjct: 267 QQGGSGGG--PWNNQGGGNGGWNGGGGGGYGGGNS 299 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 34.7 bits (76), Expect = 0.18 Identities = 21/58 (36%), Positives = 22/58 (37%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GGG G G G G G+G Sbjct: 645 GGRGGGGRGGGGGFGGRGGGGRGGGGGF-----GGRGGGGRGGGGFGGRGGRGGGGRG 697 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 34.7 bits (76), Expect = 0.18 Identities = 24/74 (32%), Positives = 24/74 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G GG GGG G G GGP G G Sbjct: 137 GGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGG-GGGHSGGGGGIGGGPGFGGGIGGS 195 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 196 GSSASSSVGVIGGG 209 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG GG GG G G G GG Sbjct: 17 GGYGGGGGGGGGGHAGASASSSASAGAIGGGDGGGKLGGGYGSGGHGSGG 66 Score = 29.1 bits (62), Expect = 8.8 Identities = 21/72 (29%), Positives = 21/72 (29%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G GGGG G G G GG P Sbjct: 254 GGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPA-----VSLGGGP 308 Query: 708 XPXXXXGXXXGG 673 G GG Sbjct: 309 GGGGSYGGGYGG 320 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/94 (23%), Positives = 27/94 (28%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 ++++ +P PP P P P G P P P PPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 790 PXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP PP Sbjct: 638 P--------NYADYYPVWPPGLPPQPQPPMTTPP 663 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/94 (23%), Positives = 27/94 (28%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 ++++ +P PP P P P G P P P PPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 790 PXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP PP Sbjct: 638 P--------NYADYYPVSGPGLPPQPQPPMTTPP 663 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 33.9 bits (74), Expect = 0.31 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PPP P P G GPP P P + PP PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPP--PPPPSGNYGPPPP--PSGNYGPPPPP 482 Score = 31.5 bits (68), Expect = 1.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXP----XXPPPPXPPPXX 885 P P G GPP P PPP PP P PPPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYG 497 Query: 886 PP 891 PP Sbjct: 498 PP 499 Score = 30.3 bits (65), Expect = 3.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP PP P G PP P PP P P PPPP Sbjct: 437 PPPPSGNYGPPPPPPSGNYGPPPPP-PSGNYGPPPP----PSGNYGPPPP 481 Score = 29.9 bits (64), Expect = 5.1 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXP----XPPPP 796 PPP PP P G PP PP P P PPPP Sbjct: 448 PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 >AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p protein. Length = 581 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/94 (23%), Positives = 27/94 (28%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 ++++ +P PP P P P G P P P PPP Sbjct: 112 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 171 Query: 790 PXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP PP Sbjct: 172 P--------NYADYYPVSGPGLPPQPQPPMTTPP 197 >AF017777-12|AAC28405.1| 145|Drosophila melanogaster la costa protein. Length = 145 Score = 33.9 bits (74), Expect = 0.31 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 890 GGXXGGGXGGGGXX-GXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGX 714 GG G G G GG G GG GG G G GGP P G G Sbjct: 30 GGPGGPGRGRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGG 89 Query: 713 P 711 P Sbjct: 90 P 90 Score = 29.1 bits (62), Expect = 8.8 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 G G G G GG G GG GG G G G P P G G P+ Sbjct: 38 GRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPG---GPGGPGCPGGPGGPGGPK 94 >AE014298-3140|AAF50816.1| 145|Drosophila melanogaster CG12794-PA protein. Length = 145 Score = 33.9 bits (74), Expect = 0.31 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 890 GGXXGGGXGGGGXX-GXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGX 714 GG G G G GG G GG GG G G GGP P G G Sbjct: 30 GGPGGPGRGRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPGGPGGPGCPGGPGG 89 Query: 713 P 711 P Sbjct: 90 P 90 Score = 29.1 bits (62), Expect = 8.8 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 G G G G GG G GG GG G G G P P G G P+ Sbjct: 38 GRGGPGRGPGGPGGPGGRGPGGPGGPGGPGGPGGPGGPG---GPGGPGCPGGPGGPGGPK 94 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 33.9 bits (74), Expect = 0.31 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PPPP PPP P P G GPP P P + PP PP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPP--PPPPSGNYGPPPP--PSGNYGPPPPP 482 Score = 31.5 bits (68), Expect = 1.7 Identities = 19/62 (30%), Positives = 19/62 (30%), Gaps = 4/62 (6%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXP----XXPPPPXPPPXX 885 P P G GPP P PPP PP P PPPP Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYG 497 Query: 886 PP 891 PP Sbjct: 498 PP 499 Score = 30.3 bits (65), Expect = 3.8 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PPP PP P G PP P PP P P PPPP Sbjct: 437 PPPPSGNYGPPPPPPSGNYGPPPPP-PSGNYGPPPP----PSGNYGPPPP 481 Score = 29.9 bits (64), Expect = 5.1 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 4/54 (7%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXP----XPPPP 796 PPP PP P G PP PP P P PPPP Sbjct: 448 PPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPP 501 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/84 (26%), Positives = 22/84 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PPP G P P P PPP Sbjct: 310 PPPPKKVVYTPPPTGILKDDGYHYGQPSVKFEVSAP-PAPKVEYLPPPPTKKVYVAPPVY 368 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPP 891 PPPP PP PP Sbjct: 369 VPPPTKKVVVYTPPPPPPPVYIPP 392 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 4/59 (6%) Frame = +2 Query: 638 FXXPPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXV----PPXPXXXXPXXXPXPPPPXP 802 + PP PP P PP P V PP P P PPPP P Sbjct: 155 YVPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPTKKVVYTPPPPPPPP 213 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 33.9 bits (74), Expect = 0.31 Identities = 22/94 (23%), Positives = 27/94 (28%) Frame = +1 Query: 610 YKSQTXXTIFPPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXP 789 ++++ +P PP P P P G P P P PPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 790 PXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPP 891 P P PP P PP PP Sbjct: 638 P--------NYADYYPVSGPGLPPQPQPPMTTPP 663 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 33.5 bits (73), Expect = 0.41 Identities = 19/58 (32%), Positives = 21/58 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G GGGG G GG GGG +G G G G+G Sbjct: 27 GGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGGGGQG 84 Score = 32.3 bits (70), Expect = 0.95 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GG G G GG+ G Sbjct: 21 GLLGGGGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGGSQGGHGG 80 Query: 720 GG 715 GG Sbjct: 81 GG 82 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/87 (25%), Positives = 23/87 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP P P + P PP P P PPP Sbjct: 319 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 378 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPPXLS 900 PPPP P PP LS Sbjct: 379 GGAYSGWGGGYAPPPPPPCAPPPPALS 405 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +1 Query: 622 TXXTIFPPPPXXXXXXPPPXXXXXXXXXXRG-XPFPXGXXGPPXPXXPXPSXPPPXPP 792 T + PPPP PP G P P PP P PPP PP Sbjct: 358 TLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 415 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/87 (25%), Positives = 23/87 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP P P + P PP P P PPP Sbjct: 124 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 183 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPPXLS 900 PPPP P PP LS Sbjct: 184 GGAYSGWGGGYAPPPPPPCAPPPPALS 210 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +1 Query: 622 TXXTIFPPPPXXXXXXPPPXXXXXXXXXXRG-XPFPXGXXGPPXPXXPXPSXPPPXPP 792 T + PPPP PP G P P PP P PPP PP Sbjct: 163 TLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 220 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 33.5 bits (73), Expect = 0.41 Identities = 26/74 (35%), Positives = 26/74 (35%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GG GGGG G GG GGG G G G GG P G G P Sbjct: 21 GGGRRGGRGGGGGGGRSLGGF------------GGRGGGGFG-GRGGPGGTGGPGGFGGP 67 Query: 710 RXXXXXXXXXXGGG 669 GGG Sbjct: 68 GRFGGPGGLGGGGG 81 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G GG G GG P G G GGG Sbjct: 29 GGGGGGGRSLGGFGGRGGGGFGGRGGPGGTGGPGGFGGPGRFGGPGGLGGGG 80 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 33.5 bits (73), Expect = 0.41 Identities = 22/87 (25%), Positives = 23/87 (26%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 P PP P P + P PP P P PPP Sbjct: 689 PAPPGTQAPPPMPPPLMPWMSAPQPPPPATEPLNPPIPGTLPPLIPPPPGTSAPPMPPWG 748 Query: 820 XXXXXXXXXPXXPPPPXPPPXXPPXLS 900 PPPP P PP LS Sbjct: 749 GGAYSGWGGGYAPPPPPPCAPPPPALS 775 Score = 33.5 bits (73), Expect = 0.41 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = +1 Query: 622 TXXTIFPPPPXXXXXXPPPXXXXXXXXXXRG-XPFPXGXXGPPXPXXPXPSXPPPXPP 792 T + PPPP PP G P P PP P PPP PP Sbjct: 728 TLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPPPPPPP 785 >AY075448-1|AAL68261.2| 218|Drosophila melanogaster RE09269p protein. Length = 218 Score = 33.1 bits (72), Expect = 0.54 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G GGG G G G GG Sbjct: 80 GYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGGYGGGSS 139 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG GG GGG Sbjct: 140 GGYSGGHGGGWSSGGGYGGGGYGGG 164 Score = 30.3 bits (65), Expect = 3.8 Identities = 24/85 (28%), Positives = 24/85 (28%), Gaps = 4/85 (4%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXG----XXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 GG GG GG G G G GGGG G G G G G Sbjct: 79 GGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGGYGGGS 138 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 G G GG GG Sbjct: 139 SGGYSGGHGGGWSSGGGYGGGGYGG 163 Score = 29.5 bits (63), Expect = 6.7 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G G G G G GG G Sbjct: 76 GGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGG-GYGGGY 134 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G G GGG Sbjct: 135 GGGSSGGYSGGHGGGWSSGGGYGGG 159 >AE014297-116|AAF52115.2| 559|Drosophila melanogaster CG12586-PA protein. Length = 559 Score = 33.1 bits (72), Expect = 0.54 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -1 Query: 890 GGXXG-GGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGX 714 GG G GG GG G G GG GG G G GGP P G G Sbjct: 392 GGPMGPGGPGGPGGPGGPGGPGGPGGPGMPWGP-GGPGGPGGPNGPGGPGGPGGPGGPGG 450 Query: 713 P 711 P Sbjct: 451 P 451 Score = 31.5 bits (68), Expect = 1.7 Identities = 20/59 (33%), Positives = 20/59 (33%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GG G GG G GG GG G G GGP P G G P Sbjct: 383 GAPGGPNGPGGPMGPGGPGGPGGPGGPGGP--GGPGGPGMPWGPGGPGGPGGPNGPGGP 439 Score = 31.1 bits (67), Expect = 2.2 Identities = 21/59 (35%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = -1 Query: 890 GGXXG-GGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G GG GG G G G G G G G G GGP P G G Sbjct: 401 GGPGGPGGPGGPGGPGGPGMPWGPGGPGGPGGPNGPGGPGGPG-GPGGPGGPGGPCGPG 458 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 1/61 (1%) Frame = -1 Query: 890 GGXXG-GGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGX 714 GG G GG GG G G G G G G G G GGP P G Sbjct: 398 GGPGGPGGPGGPGGPGGPGGPGMPWGPGGPGGPGGPNGPGGPG-GPGGPGGPGGPGGPCG 456 Query: 713 P 711 P Sbjct: 457 P 457 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 33.1 bits (72), Expect = 0.54 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPPXLS 900 P PPPP PPP PP LS Sbjct: 228 PPPPPPPPPPPPPPPTLS 245 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 26.2 bits (55), Expect(2) = 0.63 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 42 GGGFGGGLGGGGGGG 56 Score = 25.4 bits (53), Expect(2) = 0.63 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPRXXXXXXXXXXGGG 669 GG GGG G G G G P P P GGG Sbjct: 95 GGGGGG--GGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 26.2 bits (55), Expect(2) = 0.63 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 42 GGGFGGGLGGGGGGG 56 Score = 25.4 bits (53), Expect(2) = 0.63 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPRXXXXXXXXXXGGG 669 GG GGG G G G G P P P GGG Sbjct: 95 GGGGGG--GGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 26.2 bits (55), Expect(2) = 0.63 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 42 GGGFGGGLGGGGGGG 56 Score = 25.4 bits (53), Expect(2) = 0.63 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPRXXXXXXXXXXGGG 669 GG GGG G G G G P P P GGG Sbjct: 95 GGGGGG--GGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPP-FPXXXXVPP-XPXXXXPXXXPXPPP 793 PPP PP P +PP FP V P P P P PPP Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 335 PPPPPPPPPPPPPPP 349 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 336 PPPPPPPPPPPPPPP 350 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 32.7 bits (71), Expect = 0.72 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 2/51 (3%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPP-FPXXXXVPP-XPXXXXPXXXPXPPP 793 PPP PP P +PP FP V P P P P PPP Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 335 PPPPPPPPPPPPPPP 349 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 336 PPPPPPPPPPPPPPP 350 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 32.3 bits (70), Expect = 0.95 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG GG G G G GG Sbjct: 187 GGRGGGGRGGGGGRG---GGGFRGGAGRNGGGGGGGGGFNRGRGGGGGGG 233 Score = 30.7 bits (66), Expect = 2.9 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = -1 Query: 878 GGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GGG GG G G G GGG G G G GG G P Sbjct: 9 GGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTGPP 64 Score = 30.7 bits (66), Expect = 2.9 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGG 673 G GGGG G G G GG G GG G GG Sbjct: 9 GGGGGGRGFGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGG 51 Score = 29.5 bits (63), Expect = 6.7 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG G GG G G GGG G G G GG G+G Sbjct: 8 GGGGGGGRGFGGGGGGRGFGGGGGGR--------GGGGGRGGGGGFGRGGGGRGGGRG 57 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 32.3 bits (70), Expect = 0.95 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G GG G GG G GG GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 358 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG GG GG G G G GGGG G G GG G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG-------GGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 32.3 bits (70), Expect = 0.95 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPPXL 897 PP P PPP P P PPPP PPP P L Sbjct: 170 PPSPPESK-YLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAPKKL 220 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 2/87 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXP--PPPXPXXXXXX 820 PP PP P PP P V P P P PPP P Sbjct: 137 PPEPVAKYLPPKVAP------SLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLP 190 Query: 821 XXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P Sbjct: 191 PAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 29.5 bits (63), Expect = 6.7 Identities = 22/81 (27%), Positives = 23/81 (28%), Gaps = 5/81 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPP-FPXXXXVPPXP--XXXXPXXXP--XPPPPXPXXX 811 PPP P P PP P +PP P P P PPPP P Sbjct: 157 PPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVA 216 Query: 812 XXXXXXPXXXXPXXXXPPXXP 874 P PP P Sbjct: 217 PKKLYLPPAEPETKYLPPSEP 237 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 32.3 bits (70), Expect = 0.95 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G GG G GG G GG GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 358 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG GG GG G G G GGGG G G GG G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG-------GGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 32.3 bits (70), Expect = 0.95 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G GGGG G G GG G GG G GG GGG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGG 264 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 310 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 358 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG GG GG G G G GGGG G G GG G GG Sbjct: 213 GGGGGGGGGGRGGFGGRRGGGG-------GGGGGGGGGGRFDRGGGGGGGRYDRGGGG 263 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 32.3 bits (70), Expect = 0.95 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXPPXL 897 PP P PPP P P PPPP PPP P L Sbjct: 170 PPSPPESK-YLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVAPKKL 220 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/87 (26%), Positives = 23/87 (26%), Gaps = 2/87 (2%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXP--PPPXPXXXXXX 820 PP PP P PP P V P P P PPP P Sbjct: 137 PPEPVAKYLPPKVAP------SLPPPPPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLP 190 Query: 821 XXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P Sbjct: 191 PAPVARYLPPKVAPSLPPPPPPPPVAP 217 Score = 29.5 bits (63), Expect = 6.7 Identities = 22/81 (27%), Positives = 23/81 (28%), Gaps = 5/81 (6%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPP-FPXXXXVPPXP--XXXXPXXXP--XPPPPXPXXX 811 PPP P P PP P +PP P P P PPPP P Sbjct: 157 PPPPVVAPKPTYLPPSPPESKYLPPPTPEVKYLPPAPVARYLPPKVAPSLPPPPPPPPVA 216 Query: 812 XXXXXXPXXXXPXXXXPPXXP 874 P PP P Sbjct: 217 PKKLYLPPAEPETKYLPPSEP 237 >AE014296-1757|AAF50200.2| 734|Drosophila melanogaster CG32050-PA protein. Length = 734 Score = 25.4 bits (53), Expect(2) = 0.96 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPP 792 P P PS PPP PP Sbjct: 559 PATESPPPSTPPPPPP 574 Score = 25.4 bits (53), Expect(2) = 0.96 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 847 PXXPPPPXPPP 879 P PPPP PPP Sbjct: 566 PSTPPPPPPPP 576 >AY075468-1|AAL68280.1| 127|Drosophila melanogaster RE28280p protein. Length = 127 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G G G G G G GG G GG P G GG GGG Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGG 74 >AE014298-2744|AAF48863.1| 1895|Drosophila melanogaster CG15040-PA protein. Length = 1895 Score = 31.9 bits (69), Expect = 1.3 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPP 796 PP P PP P P P PPPP Sbjct: 595 PPAPVPAPAPPAPPAHGPPPTPGPPPP 621 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 31.9 bits (69), Expect = 1.3 Identities = 25/90 (27%), Positives = 25/90 (27%), Gaps = 5/90 (5%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPP--FPXXXXVPPXPXXXXPXXXP---XPPPPXPXXX 811 PP PP P PP P PP P P P PPPP Sbjct: 119 PPEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEGQA 178 Query: 812 XXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP PP P P Sbjct: 179 LIMTLLP--PDPPEDQPPPPPPLLQPCGLP 206 Score = 31.5 bits (68), Expect = 1.7 Identities = 22/82 (26%), Positives = 22/82 (26%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 PPP PPP P P P P P PP PP Sbjct: 127 PPPLFQPLEPPPLF----------QPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEG 176 Query: 823 XXXXXXXXPXXPPPPXPPPXXP 888 P PP PPP P Sbjct: 177 QALIMTLLPPDPPEDQPPPPPP 198 Score = 30.7 bits (66), Expect = 2.9 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 2/51 (3%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPP--XPPPXXPP 891 P P P PPP PP PPP PPP PP Sbjct: 15 PLPPPPPGDQPPPPPPEDQPLLILLGQAEDPPEDQPPDPPPLFQPPPEEPP 65 >AE014134-1931|AAF52991.1| 127|Drosophila melanogaster CG7294-PA protein. Length = 127 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 801 GXGGGGXGXXXGXXXXGXGGTXXXXGKGGAPXPXXXXGXXXGGXXXXXXGGG 646 G G G G G G GG G GG P G GG GGG Sbjct: 23 GRPGFGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGGGPYGGGFGNPYGGG 74 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 31.9 bits (69), Expect = 1.3 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +1 Query: 745 PXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPPPXXP 888 P P P P PPP PP P PPPP PPP P Sbjct: 463 PPPPPPPPPPPPPPPP------------------PTEPPPPPPPPPEP 492 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P PP P P P+ PPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPP 487 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 463 PPPPPPPPPPPPPPP 477 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 464 PPPPPPPPPPPPPPP 478 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 465 PPPPPPPPPPPPPPP 479 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 469 PPPPPPPPPPPTEPP 483 Score = 29.5 bits (63), Expect = 6.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P P PPPP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >X97197-1|CAA65831.1| 366|Drosophila melanogaster spliceosomal protein protein. Length = 366 Score = 31.5 bits (68), Expect = 1.7 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P PP P G PP P +PP P P P P P Sbjct: 286 PAPFPATIPPPPLPPMTG---GQPPLPPAMGIPPPPRMMQPNAWAPPGMPAP-------- 334 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P P P Sbjct: 335 -PPRPPPTNWRPPPVPFPPTPYARP 358 >BT023489-1|AAY84889.1| 347|Drosophila melanogaster RE50839p protein. Length = 347 Score = 31.5 bits (68), Expect = 1.7 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P PP P G PP P +PP P P P P P Sbjct: 267 PAPFPATIPPPPLPPMTG---GQPPLPPAMGIPPPPRMMQPNAWAPPGMPAP-------- 315 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P P P Sbjct: 316 -PPRPPPTNWRPPPVPFPPTPYARP 339 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 588 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 616 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 549 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 577 >AY058599-1|AAL13828.1| 773|Drosophila melanogaster LD29226p protein. Length = 773 Score = 31.5 bits (68), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGP 738 G GGG GG G G GGG G G G GGP Sbjct: 460 GAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGP 510 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 394 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 422 >AE014298-857|AAF46136.1| 347|Drosophila melanogaster CG3780-PA protein. Length = 347 Score = 31.5 bits (68), Expect = 1.7 Identities = 23/85 (27%), Positives = 24/85 (28%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 P P PP P G PP P +PP P P P P P Sbjct: 267 PAPFPATIPPPPLPPMTG---GQPPLPPAMGIPPPPRMMQPNAWAPPGMPAP-------- 315 Query: 827 XPXXXXPXXXXPPXXPPXXPPXXXP 901 P P PP P P P Sbjct: 316 -PPRPPPTNWRPPPVPFPPTPYARP 339 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 549 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 577 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 588 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 616 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 31.5 bits (68), Expect = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 716 PPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 P P +PP P P P PPPP P Sbjct: 890 PAPPMLKAIPPPPPPMAPSMMPPPPPPCP 918 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 31.5 bits (68), Expect = 1.7 Identities = 24/85 (28%), Positives = 24/85 (28%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG G GG G GGGG G G GG G Sbjct: 23 GGSGGGWSSGGGGGGGHGGGGDVQIIKVITESGSSGGGGGGGGWSSGGGGGGGGWSSGGG 82 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G GG GGG Sbjct: 83 GGGGGWSSGGG---GGGWSSGGGGG 104 Score = 31.1 bits (67), Expect = 2.2 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G GGGG G G GG Sbjct: 83 GGGGGWSSGGGGGGWSSGGGGGSGSDVKLIKIISLGGGGGGHSGGGGGWSSGGGGGGWSS 142 Query: 720 GGA 712 GG+ Sbjct: 143 GGS 145 >AE013599-3146|AAF46686.2| 1215|Drosophila melanogaster CG4266-PA protein. Length = 1215 Score = 31.5 bits (68), Expect = 1.7 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGP 738 G GGG GG G G GGG G G G GGP Sbjct: 902 GAGTGGGGPGGRQQGPGFFNPRNPFNDNQRGRGGQSGGGVRGVGGGGGGGP 952 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 31.5 bits (68), Expect = 1.7 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G G G GGGG G G GG G+ Sbjct: 174 GGGGGGGFGGRGGGRGGGGRGGGG---------GRGGGGFRGGAGRNGGGGGGGGFNRGR 224 Query: 720 GG 715 GG Sbjct: 225 GG 226 Score = 31.1 bits (67), Expect = 2.2 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G G GGG G G G GG G P Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGF-GRGGGGRGGGRGAFDTGPP 66 Score = 29.5 bits (63), Expect = 6.7 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -1 Query: 878 GGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GGG GGGG G GG GG G G GG Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGG 218 >X62638-1|CAA44504.1| 345|Drosophila melanogaster hrp40.2 protein. Length = 345 Score = 31.1 bits (67), Expect = 2.2 Identities = 23/68 (33%), Positives = 24/68 (35%), Gaps = 8/68 (11%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXG-GXGGGXEGXGXXGXGGPXX------- 732 G GGG GG G G G G GGG EG G G GG Sbjct: 255 GGYGGGYGGYGAGGYGDYYAGGYYNGYDYGYDGYGYGGGFEGNGYGGGGGGGNMGGGRGG 314 Query: 731 PXGKGXPR 708 P G G P+ Sbjct: 315 PRGGGGPK 322 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXP 789 P P GPP P P P PPP P Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPP 111 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXP 789 P P GPP P P P PPP P Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPP 141 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 31.1 bits (67), Expect = 2.2 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 GG GGG G GG G G GGG G G G GG G P Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGF-GRGGGGRGGGRGAFDTGPP 66 >AY069496-1|AAL39641.1| 771|Drosophila melanogaster LD22279p protein. Length = 771 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AF057162-1|AAC62005.1| 745|Drosophila melanogaster Medea protein. Length = 745 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 278 PVPHGMPGMPGPMNPGPVMAPPPPP 302 >AF041439-1|AAC38972.1| 771|Drosophila melanogaster maternal effect enhancer of dpp protein. Length = 771 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AF039233-1|AAC25634.1| 771|Drosophila melanogaster MEDEA protein. Length = 771 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AF039232-1|AAC09260.1| 745|Drosophila melanogaster MEDEA protein. Length = 745 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 278 PVPHGMPGMPGPMNPGPVMAPPPPP 302 >AF027729-1|AAC38971.1| 771|Drosophila melanogaster Medea protein. Length = 771 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AF019754-1|AAC35437.1| 682|Drosophila melanogaster Medea-A protein. Length = 682 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AE014297-4770|AAF57172.1| 771|Drosophila melanogaster CG1775-PA, isoform A protein. Length = 771 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P G G P P P P PP PP Sbjct: 304 PVPHGMPGMPGPMNPGPVMAPPPPP 328 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXP 789 P P GPP P P P PPP P Sbjct: 118 PPPQRPWGPPPPPGPPPPGPPPPP 141 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 31.1 bits (67), Expect = 2.2 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXP 789 P P GPP P P P PPP P Sbjct: 88 PPPQRPWGPPPPPGPPPPGPPPPP 111 >AE014297-2380|AAF55445.1| 210|Drosophila melanogaster CG14323-PA protein. Length = 210 Score = 25.0 bits (52), Expect(2) = 2.3 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +1 Query: 712 GXPFPXGXXGPPXPXXPXPSXPPPXP 789 G P G P P P PPP P Sbjct: 131 GSPMGYGYLSGASPIRPAPPFPPPPP 156 Score = 24.6 bits (51), Expect(2) = 2.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PP P PPP PP S Sbjct: 149 PPFPPPPPGMPPPTS 163 >AE014297-2408|AAF55467.1| 1493|Drosophila melanogaster CG14318-PA protein. Length = 1493 Score = 28.3 bits (60), Expect(2) = 2.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 Query: 856 PPPPXPPPXXPP 891 PPPP PPP PP Sbjct: 611 PPPPPPPPVPPP 622 Score = 21.0 bits (42), Expect(2) = 2.6 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +1 Query: 730 GXXGPPXPXXPXPSXPPPXPP 792 G G P+ PPP PP Sbjct: 597 GGGGSSSRASSTPTPPPPPPP 617 >AE014298-2797|AAF48914.2| 193|Drosophila melanogaster CG14191-PA protein. Length = 193 Score = 30.7 bits (66), Expect = 2.9 Identities = 22/85 (25%), Positives = 22/85 (25%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G GG GG GG G GGG G G G GG Sbjct: 55 GYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGGGYGGGYGGGSS 114 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG GG G G Sbjct: 115 GGYSGGHGGGWSSGGGYGGGGYGSG 139 Score = 29.5 bits (63), Expect = 6.7 Identities = 23/85 (27%), Positives = 23/85 (27%) Frame = -3 Query: 900 GXXXGGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGK 721 G G GG GG G G G G G G G GG G Sbjct: 51 GGGGGYGGGGYGGGGYGGGGHGGGSTIKIIKVITDSGAGGGGYGGGYGGGHGG-GYGGGY 109 Query: 720 GGAPXPXXXXGXXXGGXXXXXXGGG 646 GG G G GGG Sbjct: 110 GGGSSGGYSGGHGGGWSSGGGYGGG 134 >AE014296-3128|AAF49173.1| 224|Drosophila melanogaster CG14089-PA protein. Length = 224 Score = 30.7 bits (66), Expect = 2.9 Identities = 21/83 (25%), Positives = 22/83 (26%) Frame = +1 Query: 643 PPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXXX 822 P P PP +G P P G G P P P P Sbjct: 80 PQPCGCPPGPPGPPGPPGQPGQKGYPGPKGSKGDPGEKGPRGDKGHPGMPGIPGQPGPQG 139 Query: 823 XXXXXXXXPXXPPPPXPPPXXPP 891 PP P PPP PP Sbjct: 140 PPGYPGGS--YPPYPYPPPPPPP 160 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPP 876 PP P P+ PPP PP PPPP PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGAL-PPPPPPP 315 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P PP P PPPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 30.7 bits (66), Expect = 2.9 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPPXXXXXXXXXXXXXXXXXXPXXPPPPXPP 876 PP P P+ PPP PP PPPP PP Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGAL-PPPPPPP 315 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 674 PPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXP 802 PP P PP P PP P PPPP P Sbjct: 272 PPPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 >BT003747-1|AAO41408.1| 256|Drosophila melanogaster RH72336p protein. Length = 256 Score = 27.1 bits (57), Expect(2) = 3.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GGP P G G Sbjct: 210 GGGAAGGGGASGGGAGGPGAPGGSG 234 Score = 22.2 bits (45), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 890 GGXXGGGXGGGG 855 GG GGG GGG Sbjct: 206 GGVGGGGAAGGG 217 >AE014297-3911|AAF56559.1| 256|Drosophila melanogaster CG14542-PA protein. Length = 256 Score = 27.1 bits (57), Expect(2) = 3.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GGP P G G Sbjct: 210 GGGAAGGGGASGGGAGGPGAPGGSG 234 Score = 22.2 bits (45), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 890 GGXXGGGXGGGG 855 GG GGG GGG Sbjct: 206 GGVGGGGAAGGG 217 >AY094715-1|AAM11068.1| 243|Drosophila melanogaster GH16325p protein. Length = 243 Score = 27.1 bits (57), Expect(2) = 3.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G G GGP P G G Sbjct: 197 GGGAAGGGGASGGGAGGPGAPGGSG 221 Score = 22.2 bits (45), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -1 Query: 890 GGXXGGGXGGGG 855 GG GGG GGG Sbjct: 193 GGVGGGGAAGGG 204 >AE014134-1970|AAF53017.1| 874|Drosophila melanogaster CG6700-PA protein. Length = 874 Score = 25.0 bits (52), Expect(2) = 3.5 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXPPPXPP 792 P G P PS PPP PP Sbjct: 80 PPGFSNALAAPPPLPSGPPPPPP 102 Score = 23.8 bits (49), Expect(2) = 3.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PP P Sbjct: 94 PSGPPPPPPPQIGQP 108 >BT022137-1|AAY51532.1| 388|Drosophila melanogaster IP01552p protein. Length = 388 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = -1 Query: 791 GGXGGGXEG---XGXXGXGGPXXPXGKGXPR 708 GG GGG G G G GP P G P+ Sbjct: 210 GGGGGGANGGVNAGGAGNSGPSGPGSVGSPK 240 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 878 GGGXGGGGXXG 846 GGG GGGG G Sbjct: 208 GGGGGGGGANG 218 >AE014296-2362|AAF49756.1| 388|Drosophila melanogaster CG7345-PA protein. Length = 388 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 3/31 (9%) Frame = -1 Query: 791 GGXGGGXEG---XGXXGXGGPXXPXGKGXPR 708 GG GGG G G G GP P G P+ Sbjct: 210 GGGGGGANGGVNAGGAGNSGPSGPGSVGSPK 240 Score = 22.2 bits (45), Expect(2) = 3.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 878 GGGXGGGGXXG 846 GGG GGGG G Sbjct: 208 GGGGGGGGANG 218 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 268 PLAPPPPPPPPPPPP 282 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 271 PPPPPPPPPPPPPPP 285 >U02042-1|AAA19249.1| 606|Drosophila melanogaster GABA receptor protein. Length = 606 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 512 GQGGGPPGGGGGGGGGGGPPEGGGDP 537 >M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein protein. Length = 1638 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 213 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 272 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 273 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >M69057-3|AAA28558.1| 595|Drosophila melanogaster GABA-alpha receptor protein. Length = 595 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 501 GQGGGPPGGGGGGGGGGGPPEGGGDP 526 >M69057-2|AAA28557.1| 601|Drosophila melanogaster GABA-alpha receptor protein. Length = 601 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 507 GQGGGPPGGGGGGGGGGGPPEGGGDP 532 >M69057-1|AAA28556.1| 606|Drosophila melanogaster GABA-alpha receptor protein. Length = 606 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 512 GQGGGPPGGGGGGGGGGGPPEGGGDP 537 >BT022701-1|AAY55117.1| 157|Drosophila melanogaster IP07196p protein. Length = 157 Score = 30.3 bits (65), Expect = 3.8 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGG-GXEGXGXXGXGGPXXPXGKGX 714 GG GG GG GG GG G G G GG P G G Sbjct: 41 GGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRNGPGGSGG 100 Query: 713 PRXXXXXXXXXXGGG 669 P GGG Sbjct: 101 PGGRNAPNGGGGGGG 115 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 746 PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 P P P PPPP P P PP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/80 (26%), Positives = 22/80 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P PP P +PP P PPPP P Sbjct: 33 PPAPVKSYIPPPPPPP-------PPAPKNTYIPPPAAPAKAYIPPPPPPPPP--APKNTY 83 Query: 827 XPXXXXPXXXXPPXXPPXXP 886 P P PP P Sbjct: 84 IPPAPAPVAPVETYIPPAAP 103 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P P P PPPP P P PP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 >BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p protein. Length = 1634 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 209 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 268 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 269 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P P PPP P P P P PP P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTP 207 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/79 (25%), Positives = 20/79 (25%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PP PFP P P P PP Sbjct: 171 PPPPSPPAMAPPLPAKPYPYPDLAAMPFP----DRPPAYTPTPDPMPPVGGVMVMPSPTP 226 Query: 820 XXXXXXXXXPXXPPPPXPP 876 PPPP PP Sbjct: 227 PPPAGGVLVMPRPPPPPPP 245 >AY118625-1|AAM49994.1| 177|Drosophila melanogaster RE24635p protein. Length = 177 Score = 30.3 bits (65), Expect = 3.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G GG G G GG GG G G GGP P G G Sbjct: 69 GGFGGPGQGGFGGPGGFEGQGGFGGQGGFGGQ-GGFGGQGGFGGPGGFGGPGGPGGFG 125 >AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p protein. Length = 1638 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 213 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 272 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 273 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 476 PPPPPPPPPPPPPPP 490 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 658 PPPPPPPPPPPPPPP 672 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 5/64 (7%) Frame = +1 Query: 616 SQTXXTIFPPPPXXXXXX-PPPXXXXXXXXXXRGXPFPX-GXXGPPXPXXPXPSXP---P 780 S T + PPPP PPP P P G G P P P S P Sbjct: 364 SSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVP 423 Query: 781 PXPP 792 P PP Sbjct: 424 PPPP 427 >AF053091-1|AAC06254.1| 2715|Drosophila melanogaster eyelid protein. Length = 2715 Score = 30.3 bits (65), Expect = 3.8 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PP P P G P+P G G P P P P P P Sbjct: 1314 PPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQP 1364 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 30.3 bits (65), Expect = 3.8 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 724 PXGXXGPPXPXXPXPSXPPPXPP 792 P PP P P P PPP PP Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPP 90 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 73 PPPPPPPPPPPPPPP 87 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 74 PPPPPPPPPPPPPPP 88 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 75 PPPPPPPPPPPPPPP 89 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 76 PPPPPPPPPPPPPPP 90 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 77 PPPPPPPPPPPPPPP 91 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 80 PPPPPPPPPPPPSPP 94 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 75 PPPPPPPPPPPPPPPPP 91 Score = 29.5 bits (63), Expect = 6.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 742 PPXPXXPXPSXPPPXPP 792 PP P P P PPP PP Sbjct: 78 PPPPPPPPPPPPPPSPP 94 >AE014297-2398|AAN13750.1| 2716|Drosophila melanogaster CG7467-PB, isoform B protein. Length = 2716 Score = 30.3 bits (65), Expect = 3.8 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PP P P G P+P G G P P P P P P Sbjct: 1315 PPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQP 1365 >AE014297-2396|AAF55457.1| 2703|Drosophila melanogaster CG7467-PA, isoform A protein. Length = 2703 Score = 30.3 bits (65), Expect = 3.8 Identities = 15/51 (29%), Positives = 16/51 (31%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PP P P G P+P G G P P P P P P Sbjct: 1302 PPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQP 1352 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 5/64 (7%) Frame = +1 Query: 616 SQTXXTIFPPPPXXXXXX-PPPXXXXXXXXXXRGXPFPX-GXXGPPXPXXPXPSXP---P 780 S T + PPPP PPP P P G G P P P S P Sbjct: 364 SSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVP 423 Query: 781 PXPP 792 P PP Sbjct: 424 PPPP 427 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 30.3 bits (65), Expect = 3.8 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 5/64 (7%) Frame = +1 Query: 616 SQTXXTIFPPPPXXXXXX-PPPXXXXXXXXXXRGXPFPX-GXXGPPXPXXPXPSXP---P 780 S T + PPPP PPP P P G G P P P S P Sbjct: 480 SSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVP 539 Query: 781 PXPP 792 P PP Sbjct: 540 PPPP 543 >AE014297-1019|AAN13441.1| 157|Drosophila melanogaster CG31415-PA protein. Length = 157 Score = 30.3 bits (65), Expect = 3.8 Identities = 22/75 (29%), Positives = 22/75 (29%), Gaps = 1/75 (1%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGG-GXEGXGXXGXGGPXXPXGKGX 714 GG GG GG GG GG G G G GG P G G Sbjct: 41 GGGPGGRGGGPPQKRGTCGPKPCGGQQCNKCGKGGPGGRGGPGGKGGGPGGRNGPGGSGG 100 Query: 713 PRXXXXXXXXXXGGG 669 P GGG Sbjct: 101 PGGRNAPNGGGGGGG 115 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 266 PLAPPPPPPPPPPPP 280 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 269 PPPPPPPPPPPPPPP 283 >AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB, isoform B protein. Length = 1638 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 213 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 272 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 273 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA, isoform A protein. Length = 1638 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 213 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 272 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 273 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 301 >AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD, isoform D protein. Length = 1634 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 209 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 268 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 269 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC, isoform C protein. Length = 1634 Score = 30.3 bits (65), Expect = 3.8 Identities = 23/89 (25%), Positives = 23/89 (25%), Gaps = 8/89 (8%) Frame = +2 Query: 647 PPPXXXXXXP--PXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPP------PPXP 802 PPP P P P G PP P P P P PP PP P Sbjct: 209 PPPGPPIGPPGAPGGPPPGSQHAGQPPVPPQQQQQPPPSAGTPPQCSTPPASNPYGPPVP 268 Query: 803 XXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P PP P P Sbjct: 269 GQKMQVAPPPPHMQQGQPLPPQPPQVGGP 297 >AE014296-1598|AAN11989.1| 585|Drosophila melanogaster CG10537-PB, isoform B protein. Length = 585 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 491 GQGGGPPGGGGGGGGGGGPPEGGGDP 516 >AE014296-1597|AAF50311.1| 606|Drosophila melanogaster CG10537-PA, isoform A protein. Length = 606 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 512 GQGGGPPGGGGGGGGGGGPPEGGGDP 537 >AE014296-1596|AAN11988.1| 606|Drosophila melanogaster CG10537-PC, isoform C protein. Length = 606 Score = 30.3 bits (65), Expect = 3.8 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -1 Query: 788 GXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG G G G GG P G G P Sbjct: 512 GQGGGPPGGGGGGGGGGGPPEGGGDP 537 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 658 PPPPPPPPPPPPPPP 672 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 658 PPPPPPPPPPPPPPP 672 >AE014134-1929|AAF52989.1| 177|Drosophila melanogaster CG7299-PA protein. Length = 177 Score = 30.3 bits (65), Expect = 3.8 Identities = 20/58 (34%), Positives = 20/58 (34%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG G G GG G G GG GG G G GGP P G G Sbjct: 69 GGFGGPGQGGFGGPGGFEGQGGFGGQGGFGGQ-GGFGGQGGFGGPGGFGGPGGPGGFG 125 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 718 PFPXGXXGPPXPXXPXPSXPPPXPP 792 P P PP P P P PPP PP Sbjct: 188 PPPPPPYYPPYPYYPPPPPPPPLPP 212 Score = 30.3 bits (65), Expect = 3.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 847 PXXPPPPXPPPXXPP 891 P PPPP PPP PP Sbjct: 199 PYYPPPPPPPPLPPP 213 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 30.3 bits (65), Expect = 3.8 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 Query: 746 PXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXP 886 P P P PPPP P P PP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPP 77 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/80 (26%), Positives = 22/80 (27%) Frame = +2 Query: 647 PPPXXXXXXPPXXXPXXXXGXGAPPFPXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXX 826 PP PP P PP P +PP P PPPP P Sbjct: 33 PPAPVKSYIPPPPPPP-------PPAPKNTYIPPPAAPAKAYIPPPPPPPPP--APKNTY 83 Query: 827 XPXXXXPXXXXPPXXPPXXP 886 P P PP P Sbjct: 84 IPPAPAPVAPVETYIPPAAP 103 Score = 29.5 bits (63), Expect = 6.7 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +2 Query: 743 PPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPP 889 P P P PPPP P P PP PP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPPPPPPAP 79 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 30.3 bits (65), Expect = 3.8 Identities = 16/59 (27%), Positives = 16/59 (27%) Frame = +2 Query: 725 PXXXXVPPXPXXXXPXXXPXPPPPXPXXXXXXXXXPXXXXPXXXXPPXXPPXXPPXXXP 901 P PP P P P PPP P P P P PP P Sbjct: 149 PGWQLPPPPPPLEEPEKCPLSPPPPPSPPAMAPPLPAKPYPYPDLAAMPFPDRPPAYTP 207 Score = 29.1 bits (62), Expect = 8.8 Identities = 20/79 (25%), Positives = 20/79 (25%) Frame = +1 Query: 640 PPPPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPPXXXXXXXXX 819 PPPP PP PFP P P P PP Sbjct: 171 PPPPSPPAMAPPLPAKPYPYPDLAAMPFP----DRPPAYTPTPDPMPPVGGVMVMPSPTP 226 Query: 820 XXXXXXXXXPXXPPPPXPP 876 PPPP PP Sbjct: 227 PPPAGGVLVMPRPPPPPPP 245 >AE014298-2787|AAF48900.2| 2030|Drosophila melanogaster CG32542-PA protein. Length = 2030 Score = 25.4 bits (53), Expect(2) = 4.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 859 PPPXPPPXXPP 891 PPP PPP PP Sbjct: 1777 PPPPPPPNGPP 1787 Score = 23.0 bits (47), Expect(2) = 4.2 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 646 PPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PP PPP G GPP PPP PP Sbjct: 1735 PPSGFQPQPPPGAFQALPPQAY-QAMQAGPPGPPMGPPQGYYGPPPPPP 1782 >DQ285021-1|ABB90104.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 61 GGGWGGGGGGGGGGG 75 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXG 744 GG GGG G G G G Sbjct: 67 GGGGGGGGGGGRPGSG 82 >AF396454-1|AAK72981.1| 110|Drosophila melanogaster G-rich selenoprotein protein. Length = 110 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 61 GGGWGGGGGGGGGGG 75 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXG 744 GG GGG G G G G Sbjct: 67 GGGGGGGGGGGRPGSG 82 >AE014298-1711|AAF48111.2| 110|Drosophila melanogaster CG1844-PA protein. Length = 110 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 61 GGGWGGGGGGGGGGG 75 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXG 744 GG GGG G G G G Sbjct: 67 GGGGGGGGGGGRPGSG 82 >AY060611-1|AAL28159.1| 108|Drosophila melanogaster GH03581p protein. Length = 108 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -1 Query: 890 GGXXGGGXGGGGXXG 846 GG GGG GGGG G Sbjct: 61 GGGWGGGGGGGGGGG 75 Score = 22.6 bits (46), Expect(2) = 4.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXG 744 GG GGG G G G G Sbjct: 67 GGGGGGGGGGGRPGSG 82 >AY060485-1|AAL25524.1| 696|Drosophila melanogaster SD09360p protein. Length = 696 Score = 25.4 bits (53), Expect(2) = 4.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 859 PPPXPPPXXPP 891 PPP PPP PP Sbjct: 443 PPPPPPPNGPP 453 Score = 23.0 bits (47), Expect(2) = 4.6 Identities = 14/49 (28%), Positives = 14/49 (28%) Frame = +1 Query: 646 PPXXXXXXPPPXXXXXXXXXXRGXPFPXGXXGPPXPXXPXPSXPPPXPP 792 PP PPP G GPP PPP PP Sbjct: 401 PPSGFQPQPPPGAFQALPPQAY-QAMQAGPPGPPMGPPQGYYGPPPPPP 448 >BT021292-1|AAX33440.1| 416|Drosophila melanogaster RE27549p protein. Length = 416 Score = 26.2 bits (55), Expect(2) = 4.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GGG G G G G G G R Sbjct: 269 GGGGGGGGGNGNGGAAGSGSNNGNGNQR 296 Score = 22.2 bits (45), Expect(2) = 4.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 887 GXXGGGXGGGG 855 G GGG GGGG Sbjct: 267 GAGGGGGGGGG 277 >AE013599-3395|AAF46845.1| 416|Drosophila melanogaster CG5821-PA protein. Length = 416 Score = 26.2 bits (55), Expect(2) = 4.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -1 Query: 791 GGXGGGXEGXGXXGXGGPXXPXGKGXPR 708 GG GGG G G G G G G R Sbjct: 269 GGGGGGGGGNGNGGAAGSGSNNGNGNQR 296 Score = 22.2 bits (45), Expect(2) = 4.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 887 GXXGGGXGGGG 855 G GGG GGGG Sbjct: 267 GAGGGGGGGGG 277 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 29.9 bits (64), Expect = 5.1 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGGG G G G GG G GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGG---------GGGGGGGGGGGGRFDRGGGGGGNGGGGGGR- 261 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 GG GGG Sbjct: 262 -------YDRGGGGGGGGGGG 275 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 363 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 29.9 bits (64), Expect = 5.1 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGGG G G G GG G GG Sbjct: 174 GGGGGGGGGGRGGFGGRRGG---------GGGGGGGGGGGGRFDRGGGGGGNGGGGGGR- 223 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 GG GGG Sbjct: 224 -------YDRGGGGGGGGGGG 237 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 277 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 325 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 29.9 bits (64), Expect = 5.1 Identities = 26/81 (32%), Positives = 26/81 (32%) Frame = -3 Query: 888 GGXXGGXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGGAP 709 GG GG GG G G G GGGG G G G GG G GG Sbjct: 212 GGGGGGGGGGRGGFGGRRGG---------GGGGGGGGGGGGRFDRGGGGGGNGGGGGGR- 261 Query: 708 XPXXXXGXXXGGXXXXXXGGG 646 GG GGG Sbjct: 262 -------YDRGGGGGGGGGGG 275 Score = 29.5 bits (63), Expect = 6.7 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGG 741 GG GGG GGGG G GG +G G G GG Sbjct: 315 GGGGGGGYGGGGGGGGYDRGNDRGSGGGGYHNR-DRGGNSQGGGGGGGGG 363 >BT030440-1|ABO52860.1| 1378|Drosophila melanogaster LD40879p protein. Length = 1378 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 1001 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 1057 >BT029136-1|ABJ17069.1| 1196|Drosophila melanogaster LD14750p protein. Length = 1196 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 819 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 875 >BT025041-1|ABE73212.1| 1255|Drosophila melanogaster LD15160p protein. Length = 1255 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 767 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 823 >BT024217-1|ABC86279.1| 1373|Drosophila melanogaster RE19210p protein. Length = 1373 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 885 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 941 >AY075564-1|AAL68371.1| 161|Drosophila melanogaster RH68528p protein. Length = 161 Score = 29.9 bits (64), Expect = 5.1 Identities = 25/83 (30%), Positives = 25/83 (30%), Gaps = 2/83 (2%) Frame = -3 Query: 888 GGXXG--GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG G G GG G G G GGG G G G G G GG Sbjct: 36 GGLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGG-PGFGGGPGFGGGQGFGGRPGFGG 94 Query: 714 APXPXXXXGXXXGGXXXXXXGGG 646 P G G GGG Sbjct: 95 GPGFGGGFGGGPGFGGGSGFGGG 117 >AY070547-1|AAL48018.1| 335|Drosophila melanogaster LD27487p protein. Length = 335 Score = 29.9 bits (64), Expect = 5.1 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGP 738 G GGG GGGG G GG G G G G G GP Sbjct: 20 GLLGGGGGGGGGGG-------LNLGGGGGNGGGGGGSGARGYGGHGPSGP 62 >AY058341-1|AAL13570.1| 1024|Drosophila melanogaster GH11706p protein. Length = 1024 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GGGG G GGG G G G GGP KG P Sbjct: 839 GGDGGGIGGGG------GARGVLGGGRSARGGGAGGGGFRGPGGPG-GGPGGGAWKGFP 890 >AF181637-1|AAD55423.1| 1266|Drosophila melanogaster BcDNA.GH07910 protein. Length = 1266 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 778 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 834 >AE014298-1420|AAF46562.2| 376|Drosophila melanogaster CG2962-PA protein. Length = 376 Score = 29.9 bits (64), Expect = 5.1 Identities = 18/50 (36%), Positives = 18/50 (36%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGP 738 G GGG GGGG G GG G G G G G GP Sbjct: 20 GLLGGGGGGGGGGG-------LNLGGGGGNGGGGGGSGARGYGGHGPSGP 62 >AE014298-554|AAS72337.3| 1254|Drosophila melanogaster CG32782-PD, isoform D protein. Length = 1254 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 766 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 822 >AE014298-553|AAN09104.4| 1254|Drosophila melanogaster CG32782-PC, isoform C protein. Length = 1254 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = -1 Query: 890 GGXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKG 717 GG GGG GGGG G GG GG G G G G G Sbjct: 766 GGVGGGGVGGGGGRGLSRSNSTQANQAQLLHNGGGGSGGNVG-NSGGVGDRLSDRGGG 822 >AE014297-1806|AAF55026.1| 1024|Drosophila melanogaster CG14355-PA protein. Length = 1024 Score = 29.9 bits (64), Expect = 5.1 Identities = 21/59 (35%), Positives = 21/59 (35%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGXGGPXXPXGKGXP 711 G GGG GGGG G GGG G G G GGP KG P Sbjct: 839 GGDGGGIGGGG------GARGVLGGGRSARGGGAGGGGFRGPGGPG-GGPGGGAWKGFP 890 >AE014134-1930|AAF52990.2| 161|Drosophila melanogaster CG7296-PA protein. Length = 161 Score = 29.9 bits (64), Expect = 5.1 Identities = 25/83 (30%), Positives = 25/83 (30%), Gaps = 2/83 (2%) Frame = -3 Query: 888 GGXXG--GXXGGXXXXGXXXXGXXXXXXXXXGXGGGGXGXXXGXXXXGXGGTXXXXGKGG 715 GG G G GG G G G GGG G G G G G GG Sbjct: 36 GGLGGRPGFGGGPGFGGGPGFGGGPGFGGRPGFGGG-PGFGGGPGFGGGQGFGGRPGFGG 94 Query: 714 APXPXXXXGXXXGGXXXXXXGGG 646 P G G GGG Sbjct: 95 GPGFGGGFGGGPGFGGGSGFGGG 117 >AE014134-147|AAF51462.1| 119|Drosophila melanogaster CG13947-PA protein. Length = 119 Score = 29.9 bits (64), Expect = 5.1 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -1 Query: 887 GXXGGGXGGGGXXGXXXXXXXXXXXXXXXXXXGGXGGGXEGXGXXGX-GGPXXPXGKGXP 711 G GG GG G GG GG +G G GGP P G G P Sbjct: 20 GGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPQGGPGGPGGPGGP 79 >AE014297-1125|AAF54511.2| 3111|Drosophila melanogaster CG3996-PA protein. Length = 3111 Score = 26.2 bits (55), Expect(2) = 5.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 856 PPPPXPPPXXPPXLS 900 PPPP PPP P L+ Sbjct: 1493 PPPPPPPPKERPVLA 1507 Score = 21.8 bits (44), Expect(2) = 5.3 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 766 PSXPPPXPP 792 PS PPP PP Sbjct: 1491 PSPPPPPPP 1499 >AY166752-1|AAN85714.1| 1400|Drosophila melanogaster loechrig isoform I protein. Length = 1400 Score = 25.4 bits (53), Expect(2) = 5.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 856 PPPPXPPPXXP 888 PPPP PPP P Sbjct: 279 PPPPPPPPPIP 289 Score = 22.6 bits (46), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PXXPPPPXPP 876 P PPPP PP Sbjct: 278 PPPPPPPPPP 287 >AY070541-1|AAL48012.1| 1400|Drosophila melanogaster LD22662p protein. Length = 1400 Score = 25.4 bits (53), Expect(2) = 5.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 856 PPPPXPPPXXP 888 PPPP PPP P Sbjct: 279 PPPPPPPPPIP 289 Score = 22.6 bits (46), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PXXPPPPXPP 876 P PPPP PP Sbjct: 278 PPPPPPPPPP 287 >AE014297-2948|AAF55864.2| 1400|Drosophila melanogaster CG17299-PF, isoform F protein. Length = 1400 Score = 25.4 bits (53), Expect(2) = 5.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 Query: 856 PPPPXPPPXXP 888 PPPP PPP P Sbjct: 279 PPPPPPPPPIP 289 Score = 22.6 bits (46), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 847 PXXPPPPXPP 876 P PPPP PP Sbjct: 278 PPPPPPPPPP 287 >BT010114-1|AAQ22583.1| 515|Drosophila melanogaster GH02426p protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 6.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP P L Sbjct: 396 PPPPPPPPPMPGKL 409 Score = 22.2 bits (45), Expect(2) = 6.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 760 PXPSXPPPXPP 792 P P PPP PP Sbjct: 392 PTPPPPPPPPP 402 >AE014297-3395|AAX52972.1| 515|Drosophila melanogaster CG33111-PC, isoform C protein. Length = 515 Score = 25.8 bits (54), Expect(2) = 6.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 856 PPPPXPPPXXPPXL 897 PPPP PPP P L Sbjct: 396 PPPPPPPPPMPGKL 409 Score = 22.2 bits (45), Expect(2) = 6.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +1 Query: 760 PXPSXPPPXPP 792 P P PPP PP Sbjct: 392 PTPPPPPPPPP 402 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,044,017 Number of Sequences: 53049 Number of extensions: 835690 Number of successful extensions: 19509 Number of sequences better than 10.0: 283 Number of HSP's better than 10.0 without gapping: 3403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10452 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4464466254 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -