BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N18 (1005 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 48 3e-05 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 48 3e-05 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 48 3e-05 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 48 3e-05 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 48 3e-05 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 44 4e-04 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 44 4e-04 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 42 0.002 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 42 0.002 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 42 0.002 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 41 0.002 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 41 0.002 BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p pro... 41 0.002 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 41 0.002 AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-P... 41 0.002 AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p pro... 39 0.009 AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA... 39 0.009 DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 prot... 39 0.012 BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p pro... 39 0.012 BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p pro... 39 0.012 AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-P... 39 0.012 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 38 0.016 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 38 0.016 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 38 0.016 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 38 0.016 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 38 0.016 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 38 0.016 AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA... 38 0.016 X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin pr... 38 0.022 BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p pro... 38 0.022 AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisom... 38 0.022 AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-P... 38 0.022 AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA... 38 0.022 U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding pr... 38 0.029 M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protei... 38 0.029 L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding pr... 38 0.029 BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p pro... 38 0.029 BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p pro... 38 0.029 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 38 0.029 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 38 0.029 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 38 0.029 AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA... 38 0.029 AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p pro... 36 0.067 AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-P... 36 0.067 AE014297-2494|AAN13768.1| 600|Drosophila melanogaster CG7129-PB... 36 0.067 AE014297-2493|AAF55531.1| 600|Drosophila melanogaster CG7129-PA... 36 0.067 AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-P... 36 0.067 BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p pro... 36 0.088 AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich pro... 36 0.088 AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA... 36 0.088 AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-P... 36 0.088 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 35 0.15 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 35 0.15 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 35 0.15 AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p pro... 35 0.15 AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-P... 35 0.15 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 35 0.15 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 35 0.15 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 35 0.15 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 35 0.15 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 35 0.15 X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. 34 0.27 BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p pro... 34 0.27 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 34 0.36 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 34 0.36 AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p pro... 34 0.36 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 34 0.36 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 34 0.36 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 34 0.36 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 34 0.36 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 34 0.36 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 34 0.36 AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA... 34 0.36 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 33 0.47 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 33 0.47 BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p pro... 33 0.47 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 33 0.47 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 33 0.47 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 33 0.47 AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB... 33 0.47 AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA... 33 0.47 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 33 0.47 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 33 0.47 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 33 0.47 BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p pro... 33 0.62 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 33 0.62 BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p pro... 33 0.62 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 33 0.62 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 33 0.62 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 33 0.62 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 33 0.62 AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like... 33 0.62 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 33 0.62 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 33 0.62 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 33 0.62 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 33 0.62 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 33 0.62 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 33 0.62 AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA... 33 0.62 AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA... 33 0.62 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 33 0.82 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 33 0.82 AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA p... 32 1.1 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 32 1.1 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 32 1.1 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 32 1.1 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 32 1.4 AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p pro... 32 1.4 AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA... 32 1.4 AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB... 32 1.4 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 32 1.4 X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. 31 1.9 X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein ... 31 1.9 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 31 1.9 AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p pro... 31 1.9 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 31 1.9 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 31 1.9 AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p pro... 31 1.9 AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA... 31 1.9 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 31 1.9 AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA... 31 1.9 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 31 1.9 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 31 1.9 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 31 1.9 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 31 1.9 U88570-1|AAB53050.1| 3190|Drosophila melanogaster CREB-binding p... 31 2.5 AE014298-1361|AAF46516.2| 3276|Drosophila melanogaster CG15319-P... 31 2.5 AE014296-2059|AAF49989.1| 747|Drosophila melanogaster CG7260-PA... 31 2.5 BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p pro... 31 3.3 AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p pro... 31 3.3 AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P... 31 3.3 AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P... 31 3.3 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 31 3.3 BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p pro... 30 4.4 BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p pro... 30 4.4 AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p pro... 30 4.4 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 30 4.4 AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA ... 30 4.4 U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade pro... 30 5.8 BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p pro... 30 5.8 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 30 5.8 BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p pro... 30 5.8 AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p pro... 30 5.8 AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p pro... 30 5.8 AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protei... 30 5.8 AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-assoc... 30 5.8 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 30 5.8 AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA... 30 5.8 AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA... 30 5.8 AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB... 30 5.8 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 30 5.8 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 29 7.6 AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH0604... 29 7.6 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 29 7.6 AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA... 29 7.6 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H F P P P P PPPP P P P G P PP Sbjct: 475 PPPPPPPPPLHAFVAPP-----PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 969 XP-----XXPPPPXP 998 P PPPP P Sbjct: 530 APIEGGGGIPPPPPP 544 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P PP P PPPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXX----PXXXXPGPGXXPXXXGXXXXPXPPXPXXP-----PPPXP 998 ++P P P PPPP P P P P P PP P P PPP P Sbjct: 473 VAPPPPP---PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H F P P P P PPPP P P P G P PP Sbjct: 485 PPPPPPPPPLHAFVAPP-----PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Query: 969 XP-----XXPPPPXP 998 P PPPP P Sbjct: 540 APIEGGGGIPPPPPP 554 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P PP P PPPP P Sbjct: 480 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 513 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXX----PXXXXPGPGXXPXXXGXXXXPXPPXPXXP-----PPPXP 998 ++P P P PPPP P P P P P PP P P PPP P Sbjct: 483 VAPPPPP---PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 538 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H F P P P P PPPP P P P G P PP Sbjct: 475 PPPPPPPPPLHAFVAPP-----PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Query: 969 XP-----XXPPPPXP 998 P PPPP P Sbjct: 530 APIEGGGGIPPPPPP 544 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P PP P PPPP P Sbjct: 470 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 503 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXX----PXXXXPGPGXXPXXXGXXXXPXPPXPXXP-----PPPXP 998 ++P P P PPPP P P P P P PP P P PPP P Sbjct: 473 VAPPPPP---PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 528 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H F P P P P PPPP P P P G P PP Sbjct: 633 PPPPPPPPPLHAFVAPP-----PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Query: 969 XP-----XXPPPPXP 998 P PPPP P Sbjct: 688 APIEGGGGIPPPPPP 702 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P PP P PPPP P Sbjct: 628 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 661 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXX----PXXXXPGPGXXPXXXGXXXXPXPPXPXXP-----PPPXP 998 ++P P P PPPP P P P P P PP P P PPP P Sbjct: 631 VAPPPPP---PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 686 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 47.6 bits (108), Expect = 3e-05 Identities = 27/75 (36%), Positives = 27/75 (36%), Gaps = 5/75 (6%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H F P P P P PPPP P P P G P PP Sbjct: 580 PPPPPPPPPLHAFVAPP-----PPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Query: 969 XP-----XXPPPPXP 998 P PPPP P Sbjct: 635 APIEGGGGIPPPPPP 649 Score = 31.1 bits (67), Expect = 2.5 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P PP P PPPP P Sbjct: 575 PHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPP 608 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/59 (33%), Positives = 22/59 (37%), Gaps = 9/59 (15%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXX----PXXXXPGPGXXPXXXGXXXXPXPPXPXXP-----PPPXP 998 ++P P P PPPP P P P P P PP P P PPP P Sbjct: 578 VAPPPPP---PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPP 633 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P + P P P P PPPP P P PG P P P Sbjct: 194 PDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQP 253 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 254 APQPPRPQPP 263 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP---PX 971 P P ++ P +P P P P PP P PGP P P P P Sbjct: 304 PAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPA-PAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 972 PXXPPPPXP 998 P PP P P Sbjct: 363 PPAPPAPAP 371 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P + P P P PPP P P PG P P P Sbjct: 182 PPSPQPGP-EYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYG 240 Query: 981 PPPPXP 998 PP P P Sbjct: 241 PPTPPP 246 Score = 37.5 bits (83), Expect = 0.029 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P S P P PP P P P P P PP Sbjct: 122 PQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ------PQPP 175 Query: 969 XPXXPPPPXP 998 P P PP P Sbjct: 176 APQPPSPPSP 185 Score = 37.1 bits (82), Expect = 0.038 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P P P P P P PP P Sbjct: 64 PAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPP 117 Score = 34.7 bits (76), Expect = 0.20 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P + S P P PP P P P P G P P Sbjct: 71 PQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAP--PPPSYGPPQTPPPR 128 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 129 PPPQPTPSAP 138 Score = 34.7 bits (76), Expect = 0.20 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPP P P P P P P Sbjct: 100 PPRPPPQPTPSA-PAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Query: 969 XPXXPPP 989 P P P Sbjct: 159 TPSAPAP 165 Score = 33.5 bits (73), Expect = 0.47 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXX---- 956 P PP P P P P P P P P PGP P Sbjct: 147 PQTPPPRPPPQPTPSAPAPSYGP-PQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 957 PXPPXPXXPPPPXP 998 P PP P PP P P Sbjct: 206 PQPPPP-PPPRPQP 218 Score = 33.1 bits (72), Expect = 0.62 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 2/72 (2%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPP--XXPXXXXPGPGXXPXXXGXXXXPX 962 P P P + P + P P P PPP P P P P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 963 PPXPXXPPPPXP 998 PP P P P P Sbjct: 169 PPQPQPPAPQPP 180 Score = 32.7 bits (71), Expect = 0.82 Identities = 20/69 (28%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = +3 Query: 801 PPXPXXH-LFKXXPXTKLSPXPXPXXXPPPPXXPXXXXP-----GPGXXPXXXGXXXXPX 962 PP P ++ P +P P P P PP P P P G P Sbjct: 319 PPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQPR 378 Query: 963 PPXPXXPPP 989 PP P P P Sbjct: 379 PPAPPAPTP 387 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 1/65 (1%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPP-PXXPXXXXPGPGXXPXXXGXXXXPXPPXPX 977 PP P P P PPP P P P P P P P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPS 136 Query: 978 XPPPP 992 P PP Sbjct: 137 APAPP 141 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P P P P P P P P P PP P Sbjct: 225 PPPPPP--PKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRP 270 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +3 Query: 801 PPXPXXH-LFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPX 977 PP P ++ P + +P P P P PP P PGP P P P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAP-PAPTYQPQPPAPPAPA-PGPTYQPRPPA----PPAPTPE 388 Query: 978 XPPPP 992 PPP Sbjct: 389 YGPPP 393 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 6/54 (11%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP------XXPPPPXP 998 P P P PP P PG P P P P PPPP P Sbjct: 253 PAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAP 306 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 43.6 bits (98), Expect = 4e-04 Identities = 22/70 (31%), Positives = 23/70 (32%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P + P P P P PPPP P P PG P P P Sbjct: 194 PDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYGPPTPPPGPGPAQP 253 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 254 APQPPRPQPP 263 Score = 39.9 bits (89), Expect = 0.005 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP---PX 971 P P ++ P +P P P P PP P PGP P P P P Sbjct: 304 PAPPAGPTYQPRPPAPPAPAPGPTYQPRPPAPPA-PAPGPTYQPRPPSPPAPPAPTYQPQ 362 Query: 972 PXXPPPPXP 998 P PP P P Sbjct: 363 PPAPPAPAP 371 Score = 39.5 bits (88), Expect = 0.007 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P + P P P PPP P P PG P P P Sbjct: 182 PPSPQPGP-EYLPPDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTPGYG 240 Query: 981 PPPPXP 998 PP P P Sbjct: 241 PPTPPP 246 Score = 37.5 bits (83), Expect = 0.029 Identities = 22/70 (31%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P S P P PP P P P P P PP Sbjct: 122 PQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQ------PQPP 175 Query: 969 XPXXPPPPXP 998 P P PP P Sbjct: 176 APQPPSPPSP 185 Score = 37.1 bits (82), Expect = 0.038 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P P P P P P PP P Sbjct: 64 PAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPP 117 Score = 34.7 bits (76), Expect = 0.20 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P + S P P PP P P P P G P P Sbjct: 71 PQTRPPPPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAP--PPPSYGPPQTPPPR 128 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 129 PPPQPTPSAP 138 Score = 34.7 bits (76), Expect = 0.20 Identities = 19/67 (28%), Positives = 19/67 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPP P P P P P P Sbjct: 100 PPRPPPQPTPSA-PAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQP 158 Query: 969 XPXXPPP 989 P P P Sbjct: 159 TPSAPAP 165 Score = 33.5 bits (73), Expect = 0.47 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 4/74 (5%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXX---- 956 P PP P P P P P P P P PGP P Sbjct: 147 PQTPPPRPPPQPTPSAPAPSYGP-PQPQPPAPQPPSPPSPQPGPEYLPPDQPKPRPTPSR 205 Query: 957 PXPPXPXXPPPPXP 998 P PP P PP P P Sbjct: 206 PQPPPP-PPPRPQP 218 Score = 33.1 bits (72), Expect = 0.62 Identities = 20/72 (27%), Positives = 22/72 (30%), Gaps = 2/72 (2%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPP--XXPXXXXPGPGXXPXXXGXXXXPX 962 P P P + P + P P P PPP P P P P Sbjct: 109 PSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYG 168 Query: 963 PPXPXXPPPPXP 998 PP P P P P Sbjct: 169 PPQPQPPAPQPP 180 Score = 32.7 bits (71), Expect = 0.82 Identities = 20/69 (28%), Positives = 23/69 (33%), Gaps = 6/69 (8%) Frame = +3 Query: 801 PPXPXXH-LFKXXPXTKLSPXPXPXXXPPPPXXPXXXXP-----GPGXXPXXXGXXXXPX 962 PP P ++ P +P P P P PP P P P G P Sbjct: 319 PPAPAPGPTYQPRPPAPPAPAPGPTYQPRPPSPPAPPAPTYQPQPPAPPAPAPGPTYQPR 378 Query: 963 PPXPXXPPP 989 PP P P P Sbjct: 379 PPAPPAPTP 387 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 1/65 (1%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPP-PXXPXXXXPGPGXXPXXXGXXXXPXPPXPX 977 PP P P P PPP P P P P P P P Sbjct: 77 PPPPPPQPTPPAPRPSYGPPQTQPPRPPPQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPS 136 Query: 978 XPPPP 992 P PP Sbjct: 137 APAPP 141 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P P P P P P P P P P P PP P Sbjct: 225 PPPPPP--PKPQPTPGYGPPTPPPGPGPAQPAPQPPRPQPPRPQPPRP 270 Score = 30.3 bits (65), Expect = 4.4 Identities = 21/65 (32%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Frame = +3 Query: 801 PPXPXXH-LFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPX 977 PP P ++ P + +P P P P PP P PGP P P P P Sbjct: 335 PPAPAPGPTYQPRPPSPPAP-PAPTYQPQPPAPPAPA-PGPTYQPRPPA----PPAPTPE 388 Query: 978 XPPPP 992 PPP Sbjct: 389 YGPPP 393 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 6/54 (11%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP------XXPPPPXP 998 P P P PP P PG P P P P PPPP P Sbjct: 253 PAPQPPRPQPPRPQPPRPQPGSEYLPPPGENEVTPTQPQPTAPVPEYGPPPPAP 306 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 846 KLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 + P P PPPP P P P P P PP PPPP P Sbjct: 128 RFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 178 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPX 971 P P F P + P P P PPPP P P P P P P Sbjct: 121 PQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 180 Query: 972 PXXPPPPXP 998 P PPP P Sbjct: 181 PTVEPPPPP 189 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXP 959 P PP P P + P P P PPPP P P P P P Sbjct: 168 PTVEPPPPPP---PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 224 Query: 960 XPPXPXXPPPPXP 998 PP PPPP P Sbjct: 225 APPKVELPPPPAP 237 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H + P P P PPPP P P P P P P Sbjct: 127 PRFDPPPP--HTIEPPPP----PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 180 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 181 PTVEPPPPPP 190 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P +P P PPPP P P P P P P Sbjct: 162 PPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEP 220 Query: 981 PPPPXP 998 PPPP P Sbjct: 221 PPPPAP 226 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +3 Query: 837 PXTKLSPXPX--PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P T + P P P PPPP P P P P P PP PPPP P Sbjct: 145 PPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 35.9 bits (79), Expect = 0.088 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPP P P P P P Sbjct: 146 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 205 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 206 EVEPPPPPAP 215 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 855 PXPX-PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P PG P P P PPPP P Sbjct: 98 PRPASPKVEPPPPAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAP 145 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P K P P P PP P P P P PP Sbjct: 95 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPP----PPHTIEPPPPPAPPTLVP 150 Query: 981 PPPPXP 998 PPPP P Sbjct: 151 PPPPAP 156 Score = 29.9 bits (64), Expect = 5.8 Identities = 26/101 (25%), Positives = 30/101 (29%) Frame = +3 Query: 630 PXLXPPPFIXVPLXXPXXPPLXLKIINXXLVXKPSPXXXQXXXXXXXXAFCXXPXXXPPX 809 P L PPP P P PP + P+P + P PP Sbjct: 146 PTLVPPPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP---PPP 201 Query: 810 PXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXP 932 P + P P P PPPP P P P P Sbjct: 202 PAPAEVEPPPP----PAPTELEPPPPPAPPKVELPPPPAPP 238 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 846 KLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 + P P PPPP P P P P P PP PPPP P Sbjct: 391 RFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPX 971 P P F P + P P P PPPP P P P P P P Sbjct: 384 PQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Query: 972 PXXPPPPXP 998 P PPP P Sbjct: 444 PTVEPPPPP 452 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXP 959 P PP P P + P P P PPPP P P P P P Sbjct: 431 PTVEPPPPPP---PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Query: 960 XPPXPXXPPPPXP 998 PP PPPP P Sbjct: 488 APPKVELPPPPAP 500 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H + P P P PPPP P P P P P P Sbjct: 390 PRFDPPPP--HTIEPPPP----PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 444 PTVEPPPPPP 453 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P +P P PPPP P P P P P P Sbjct: 425 PPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEP 483 Query: 981 PPPPXP 998 PPPP P Sbjct: 484 PPPPAP 489 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +3 Query: 837 PXTKLSPXPX--PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P T + P P P PPPP P P P P P PP PPPP P Sbjct: 408 PPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 35.9 bits (79), Expect = 0.088 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPP P P P P P Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 468 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 469 EVEPPPPPAP 478 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 855 PXPX-PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P PG P P P PPPP P Sbjct: 361 PRPASPKVEPPPPAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAP 408 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P K P P P PP P P P P PP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPP----PPHTIEPPPPPAPPTLVP 413 Query: 981 PPPPXP 998 PPPP P Sbjct: 414 PPPPAP 419 Score = 29.9 bits (64), Expect = 5.8 Identities = 26/101 (25%), Positives = 30/101 (29%) Frame = +3 Query: 630 PXLXPPPFIXVPLXXPXXPPLXLKIINXXLVXKPSPXXXQXXXXXXXXAFCXXPXXXPPX 809 P L PPP P P PP + P+P + P PP Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP---PPP 464 Query: 810 PXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXP 932 P + P P P PPPP P P P P Sbjct: 465 PAPAEVEPPPP----PAPTELEPPPPPAPPKVELPPPPAPP 501 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 41.5 bits (93), Expect = 0.002 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +3 Query: 846 KLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 + P P PPPP P P P P P PP PPPP P Sbjct: 391 RFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPP 441 Score = 41.1 bits (92), Expect = 0.002 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 3/69 (4%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPX 971 P P F P + P P P PPPP P P P P P P Sbjct: 384 PQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Query: 972 PXXPPPPXP 998 P PPP P Sbjct: 444 PTVEPPPPP 452 Score = 41.1 bits (92), Expect = 0.002 Identities = 24/73 (32%), Positives = 25/73 (34%), Gaps = 3/73 (4%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX---PPPPXXPXXXXPGPGXXPXXXGXXXXP 959 P PP P P + P P P PPPP P P P P P Sbjct: 431 PTVEPPPPPP---PAPPTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEPPPPP 487 Query: 960 XPPXPXXPPPPXP 998 PP PPPP P Sbjct: 488 APPKVELPPPPAP 500 Score = 40.7 bits (91), Expect = 0.003 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P H + P P P PPPP P P P P P P Sbjct: 390 PRFDPPPP--HTIEPPPP----PAPPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAP 443 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 444 PTVEPPPPPP 453 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/66 (31%), Positives = 23/66 (34%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P +P P PPPP P P P P P P Sbjct: 425 PPPPAPPTVEPPPPPPPAP-PTVEPPPPPPPAPTKVEPPPPPAPAEVEPPPPPAPTELEP 483 Query: 981 PPPPXP 998 PPPP P Sbjct: 484 PPPPAP 489 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/60 (35%), Positives = 22/60 (36%), Gaps = 6/60 (10%) Frame = +3 Query: 837 PXTKLSPXPX--PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P T + P P P PPPP P P P P P PP PPPP P Sbjct: 408 PPTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 35.9 bits (79), Expect = 0.088 Identities = 20/70 (28%), Positives = 20/70 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPP P P P P P Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAPA 468 Query: 969 XPXXPPPPXP 998 PPPP P Sbjct: 469 EVEPPPPPAP 478 Score = 35.5 bits (78), Expect = 0.12 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = +3 Query: 855 PXPX-PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P PG P P P PPPP P Sbjct: 361 PRPASPKVEPPPPAPPGVESP-PGPQPPASPRFDPPPPHTIEPPPPPAP 408 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P K P P P PP P P P P PP Sbjct: 358 PPPPRPASPKVEPPPPAPPGVESPPGPQPPASPRFDPP----PPHTIEPPPPPAPPTLVP 413 Query: 981 PPPPXP 998 PPPP P Sbjct: 414 PPPPAP 419 Score = 29.9 bits (64), Expect = 5.8 Identities = 26/101 (25%), Positives = 30/101 (29%) Frame = +3 Query: 630 PXLXPPPFIXVPLXXPXXPPLXLKIINXXLVXKPSPXXXQXXXXXXXXAFCXXPXXXPPX 809 P L PPP P P PP + P+P + P PP Sbjct: 409 PTLVPPPPPAPPTIKPPPPPAP-PTVEPPPPPPPAPPTVEPPPPPPPAPTKVEP---PPP 464 Query: 810 PXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXP 932 P + P P P PPPP P P P P Sbjct: 465 PAPAEVEPPPP----PAPTELEPPPPPAPPKVELPPPPAPP 501 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 5/71 (7%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-- 974 PP P L P P P P PPPP P P P G P PP P Sbjct: 487 PPPPPPPL----PAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIE 542 Query: 975 ---XXPPPPXP 998 PPPP P Sbjct: 543 GGGGIPPPPPP 553 Score = 31.9 bits (69), Expect = 1.4 Identities = 21/71 (29%), Positives = 22/71 (30%) Frame = +3 Query: 774 AFCXXPXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXX 953 AF P PP P P L+ P PPPP P P P G Sbjct: 496 AFVAPPPPPPPPP--------PPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGI 547 Query: 954 XPXPPXPXXPP 986 P PP P Sbjct: 548 PPPPPPMSASP 558 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 ++P P P PPPP P P P P P PPPP Sbjct: 483 VAPPPPP---PPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPP 527 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 5/71 (7%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-- 974 PP P L P P P P PPPP P P P G P PP P Sbjct: 582 PPPPPPPL----PAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIE 637 Query: 975 ---XXPPPPXP 998 PPPP P Sbjct: 638 GGGGIPPPPPP 648 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 8/74 (10%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX--------PPPPXXPXXXXPGPGXXPXXXG 944 P PP P F P P P P PPPP P P P G Sbjct: 580 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 639 Query: 945 XXXXPXPPXPXXPP 986 P PP P Sbjct: 640 GGIPPPPPPMSASP 653 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 ++P P P PPPP P P P P P PPPP Sbjct: 578 VAPPPPP---PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 622 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 819 HLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPP 989 H P P P PPPP P P G P PP P PPP Sbjct: 576 HAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP-----MANYGAPPPPPPPPPGSGSAPPP 630 Query: 990 PXP 998 P P Sbjct: 631 PPP 633 >BT022850-1|AAY55266.1| 538|Drosophila melanogaster IP13040p protein. Length = 538 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G P G PG G GGGG G G G G Sbjct: 336 GGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGG-GFGGGGGRGGAPGAPGSPG 394 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 395 GGGFGGQGGG 404 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G GPG G GG G G G Sbjct: 199 GGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYG 244 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXG--GGGXXXGXGXGXSLVXGXILKR 821 GGGG G GG G G PG PG G G GGG G G G G Sbjct: 364 GGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSP 423 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 424 GGGGFGGQGGG 434 Score = 37.5 bits (83), Expect = 0.029 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G PG PG G GG G G G G Sbjct: 394 GGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAG 440 Score = 36.7 bits (81), Expect = 0.050 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -3 Query: 997 GXGGGGXXG--XGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXIL 827 G GGGG G GG G P G G G G GGG G G G G G Sbjct: 236 GQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPG 295 Query: 826 KRXXXGXGGXXXG 788 G GG G Sbjct: 296 SPGGGGFGGQGGG 308 Score = 36.3 bits (80), Expect = 0.067 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G G G G PG G GGGG G G G Sbjct: 202 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGG 249 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGG-GGXXXGXGXG 854 GGGG G GG G G PG PG G GG GG G G G Sbjct: 298 GGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGG 345 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXG 866 G GGGG G GG G P G G G GGGG G Sbjct: 276 GYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGG 319 Score = 35.5 bits (78), Expect = 0.12 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G G G G G G G GGGG G G G G Sbjct: 172 GAGGGGG-GGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPG 230 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 231 GGGFGGQGGG 240 Score = 34.7 bits (76), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GG G GG G G PG G GGGG G G Sbjct: 272 GAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG 315 Score = 34.3 bits (75), Expect = 0.27 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG----PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G PG PG G GG G G G G Sbjct: 231 GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGG 282 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G PG PG G GG G G G G Sbjct: 299 GGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGG 347 Score = 32.7 bits (71), Expect = 0.82 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G G G GG G G G G G GGG G G G Sbjct: 169 GGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGG 216 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G G Sbjct: 304 GQGGGGGF-GGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGG 351 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 GGGG G GG G G G G GGG G G G G Sbjct: 263 GGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 314 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G PG PG G GGGG G G G Sbjct: 395 GGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGG-GFGAGGG 442 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGG-XXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G P G PG G G GGGG G G G Sbjct: 272 GAGGGYGGGGGGGRGGGGAPGAPG-SPG-GGGFGGQGGGGGFGGGGGRG 318 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXP-GPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G P GPG GGG G G Sbjct: 425 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 473 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/46 (43%), Positives = 20/46 (43%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G G G P G PG G G GGGG G G G Sbjct: 403 GGGGYGGGAGRG--GAPGAPG-SPG-GGGFGGQGGGGGFGAGGGRG 444 Score = 30.7 bits (66), Expect = 3.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGP--GXXXXGXXGGGGXXXGXG 860 G GGG G G G P G GP G G G GG G G Sbjct: 432 GGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPG 479 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/71 (35%), Positives = 25/71 (35%), Gaps = 5/71 (7%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-- 974 PP P L P P P P PPPP P P P G P PP P Sbjct: 715 PPPPPPPL----PAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIE 770 Query: 975 ---XXPPPPXP 998 PPPP P Sbjct: 771 GGGGIPPPPPP 781 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/74 (28%), Positives = 21/74 (28%), Gaps = 8/74 (10%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX--------PPPPXXPXXXXPGPGXXPXXXG 944 P PP P F P P P P PPPP P P P G Sbjct: 713 PPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAPIEGG 772 Query: 945 XXXXPXPPXPXXPP 986 P PP P Sbjct: 773 GGIPPPPPPMSASP 786 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 ++P P P PPPP P P P P P PPPP Sbjct: 711 VAPPPPP---PPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPP 755 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 3/63 (4%) Frame = +3 Query: 819 HLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPP 989 H P P P PPPP P P G P PP P PPP Sbjct: 709 HAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPP-----MANYGAPPPPPPPPPGSGSAPPP 763 Query: 990 PXP 998 P P Sbjct: 764 PPP 766 >AE013599-1243|AAF58688.1| 610|Drosophila melanogaster CG13214-PA, isoform A protein. Length = 610 Score = 41.1 bits (92), Expect = 0.002 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G P G PG G GGGG G G G G Sbjct: 408 GGAGGGYGGGGGRGGGGAPGAPGAPGSPGGGGFGGQGGGG-GFGGGGGRGGAPGAPGSPG 466 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 467 GGGFGGQGGG 476 Score = 38.7 bits (86), Expect = 0.012 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G GPG G GG G G G Sbjct: 271 GGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYG 316 Score = 38.3 bits (85), Expect = 0.016 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXG--GGGXXXGXGXGXSLVXGXILKR 821 GGGG G GG G G PG PG G G GGG G G G G Sbjct: 436 GGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGFGGQGGGGGYGGGAGRGGAPGAPGSP 495 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 496 GGGGFGGQGGG 506 Score = 37.5 bits (83), Expect = 0.029 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G PG PG G GG G G G G Sbjct: 466 GGGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGGGFGAG 512 Score = 36.7 bits (81), Expect = 0.050 Identities = 26/73 (35%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = -3 Query: 997 GXGGGGXXG--XGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXIL 827 G GGGG G GG G P G G G G GGG G G G G G Sbjct: 308 GQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPG 367 Query: 826 KRXXXGXGGXXXG 788 G GG G Sbjct: 368 SPGGGGFGGQGGG 380 Score = 36.3 bits (80), Expect = 0.067 Identities = 25/70 (35%), Positives = 27/70 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G GP G GGGG G G G + + G R Sbjct: 46 GFGGGGGFGGGGAGGG---YGGGGGGGPAGGFGGGPGGGG-AGGFGGGNNGLGGFANGRP 101 Query: 817 XXGXGGXXXG 788 GG G Sbjct: 102 IAPGGGGGGG 111 Score = 36.3 bits (80), Expect = 0.067 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G G G G PG G GGGG G G G Sbjct: 274 GGGAGGGGGYGSGGGSGRGGAPGGPGAPGGGGFGGQGGGGGYGGAGGG 321 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 2/48 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGG-GGXXXGXGXG 854 GGGG G GG G G PG PG G GG GG G G G Sbjct: 370 GGGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGG 417 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXG 866 G GGGG G GG G P G G G GGGG G Sbjct: 348 GYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGGGRGG 391 Score = 35.5 bits (78), Expect = 0.12 Identities = 24/70 (34%), Positives = 24/70 (34%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G G G G G G G GGGG G G G G Sbjct: 244 GAGGGGG-GGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGGSGRGGAPGGPGAPG 302 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 303 GGGFGGQGGG 312 Score = 34.7 bits (76), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GG G GG G G PG G GGGG G G Sbjct: 344 GAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGGG 387 Score = 34.3 bits (75), Expect = 0.27 Identities = 20/52 (38%), Positives = 20/52 (38%), Gaps = 4/52 (7%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG----PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G PG PG G GG G G G G Sbjct: 303 GGGFGGQGGGGGYGGAGGGAGRGGSPGGPGSPGGGGFGGQGGAGGGYGGGGG 354 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G PG PG G GG G G G G Sbjct: 371 GGGFGGQGGGGGFGGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGG 419 Score = 32.7 bits (71), Expect = 0.82 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G G G GG G G G G G GGG G G G Sbjct: 241 GGQGAGGGGGGGSGYGGGSGFGGGGAGGGSGGGGGGAGGGGGYGSGGG 288 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G G Sbjct: 376 GQGGGGGF-GGGGGRGGAPGAPGSPGGGGYGGQGGAGGGYGGGGGRGGG 423 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 GGGG G GG G G G G GGG G G G G Sbjct: 335 GGGGFGGQGGAGGGYGGGGGGGRGGGGAPGAPGSPGGGGFGGQGGGGGFGGG 386 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G PG PG G GGGG G G G Sbjct: 467 GGGFGGQGGGGGYGGGAGRGGAPGAPGSPGGGGFGGQGGGG-GFGAGGG 514 Score = 31.5 bits (68), Expect = 1.9 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGG-XXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G P G PG G G GGGG G G G Sbjct: 344 GAGGGYGGGGGGGRGGGGAPGAPG-SPG-GGGFGGQGGGGGFGGGGGRG 390 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXP-GPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G P GPG GGG G G Sbjct: 497 GGGFGGQGGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGG 545 Score = 30.7 bits (66), Expect = 3.3 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXG-XGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G P G PG G G GGGG G G G Sbjct: 472 GQGGGG--GYGGGAGRGGAPGAPG-SPG-GGGFGGQGGGGGFGAGGGRG 516 Score = 30.7 bits (66), Expect = 3.3 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGP--GXXXXGXXGGGGXXXGXG 860 G GGG G G G P G GP G G G GG G G Sbjct: 504 GGGGGFGAGGGRGGAGGAPGGPGSPGGPGYGGGAGGPGGAGGRPGGPG 551 >AY118781-1|AAM50641.1| 117|Drosophila melanogaster GH13168p protein. Length = 117 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGG-XXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G P G GPG G GGGG G G G Sbjct: 58 GGGGGGYYNGGGGGGGGRRPVYSGNF-GPGYGNGGGGGGGGYGGGGGGG 105 >AE014297-3096|AAF55954.1| 117|Drosophila melanogaster CG5778-PA protein. Length = 117 Score = 39.1 bits (87), Expect = 0.009 Identities = 22/49 (44%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGG-XXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G P G GPG G GGGG G G G Sbjct: 58 GGGGGGYYNGGGGGGGGRRPVYSGNF-GPGYGNGGGGGGGGYGGGGGGG 105 >DQ539309-1|ABG02830.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539308-1|ABG02829.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539307-1|ABG02828.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539306-1|ABG02827.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539305-1|ABG02826.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539304-1|ABG02825.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539303-1|ABG02824.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539302-1|ABG02823.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539301-1|ABG02822.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539300-1|ABG02821.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539299-1|ABG02820.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539298-1|ABG02819.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539297-1|ABG02818.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539296-1|ABG02817.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539295-1|ABG02816.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539294-1|ABG02815.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539293-1|ABG02814.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539292-1|ABG02813.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539291-1|ABG02812.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539290-1|ABG02811.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539289-1|ABG02810.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539288-1|ABG02809.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539287-1|ABG02808.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539286-1|ABG02807.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539285-1|ABG02806.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539284-1|ABG02805.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539283-1|ABG02804.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539282-1|ABG02803.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >DQ539281-1|ABG02802.1| 342|Drosophila melanogaster CG17108 protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >BT030113-1|ABN49252.1| 342|Drosophila melanogaster IP06991p protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >BT011144-1|AAR82812.1| 356|Drosophila melanogaster GH24939p protein. Length = 356 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 228 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 283 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 284 KGHGGGGGFKG 294 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 287 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 346 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 347 SAGAGGGYHG 356 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 85 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 131 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 162 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 209 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 122 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 180 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 181 GGIGGGGGHSG 191 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 147 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 195 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 156 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 201 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 265 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 319 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 125 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 172 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 182 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 235 >AE014134-1932|AAF52992.1| 342|Drosophila melanogaster CG17108-PA protein. Length = 342 Score = 38.7 bits (86), Expect = 0.012 Identities = 26/71 (36%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL-KR 821 G GGGG GG G P G PG G G GG G G G G G + K Sbjct: 214 GHGGGGFGPGGGGGGGFGPGGGGFGPGIG----GGGGGFGPGIGGGSGGGHFGGGLSHKH 269 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 270 KGHGGGGGFKG 280 Score = 37.1 bits (82), Expect = 0.038 Identities = 23/70 (32%), Positives = 23/70 (32%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGG G GG G G GP G GGGG G G S Sbjct: 273 GGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLGGGPGGGGSYGGGYGGGSGASASASASA 332 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 333 SAGAGGGYHG 342 Score = 35.1 bits (77), Expect = 0.15 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G P G G G G GGG G G G Sbjct: 71 GFGSGGDLGLGGGGVGGGPFAGGHAGG-GVISGGGHSGGGGGFGGGPG 117 Score = 34.3 bits (75), Expect = 0.27 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG-GGGXXXGXGXGXS 848 GGGG G GG G P G G G G G GGG G G G S Sbjct: 148 GGGGHSG-GGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPGFGGGIGGS 195 Score = 33.5 bits (73), Expect = 0.47 Identities = 25/71 (35%), Positives = 26/71 (36%), Gaps = 3/71 (4%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG---XGXSLVXGXILKR 821 GGGG G G G G GPG G GGGG G G G S + G Sbjct: 108 GGGGFGGGPGFGSGGHSGG-GIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFG 166 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 167 GGIGGGGGHSG 177 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 1/49 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGX-GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 133 GFGSGGYSGGGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGG 181 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G GGG G G G Sbjct: 142 GGGGIGGGGGHSGGGSGIGGGPGFGGGIGGGGGHSGGGGGIGGGPG 187 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/55 (34%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPG-PGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGG G G G G G G G GGGG G G G ++ G Sbjct: 251 GIGGGSGGGHFGGGLSHKHKGHGGGGGFKGGYGGGGGGGGGGGGGYGIGPAVSLG 305 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGG G GG G G G GGGG G G G Sbjct: 111 GFGGGPGFGSGGHSGGGIGDGPGFGSGGYSGGGGGIGGGGGHSGGGSG 158 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 6/54 (11%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXG------GGGXXXGXGXG 854 G GGGG GG G P G G G G GGG G G G Sbjct: 168 GIGGGGGHSGGGGGIGGGPGFGGGIGGSGSSASSSVGVIGGGHGGGGHGGGGFG 221 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 525 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 584 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 585 PPGPTRPGPPGP 596 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 519 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 560 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 522 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 579 Query: 981 PPPPXP 998 P PP P Sbjct: 580 PGPPGP 585 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 557 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 610 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 568 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 617 Query: 981 PPPPXP 998 P PP P Sbjct: 618 PGPPGP 623 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 201 PPGPTRPGPPGP 212 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 195 Query: 981 PPPPXP 998 P PP P Sbjct: 196 PGPPGP 201 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 184 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 233 Query: 981 PPPPXP 998 P PP P Sbjct: 234 PGPPGP 239 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 555 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 614 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 615 PPGPTRPGPPGP 626 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 590 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 609 Query: 981 PPPPXP 998 P PP P Sbjct: 610 PGPPGP 615 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 598 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 647 Query: 981 PPPPXP 998 P PP P Sbjct: 648 PGPPGP 653 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 555 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 614 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 615 PPGPTRPGPPGP 626 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 549 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 590 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 552 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 609 Query: 981 PPPPXP 998 P PP P Sbjct: 610 PGPPGP 615 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 587 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 640 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 598 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 647 Query: 981 PPPPXP 998 P PP P Sbjct: 648 PGPPGP 653 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 201 PPGPTRPGPPGP 212 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 195 Query: 981 PPPPXP 998 P PP P Sbjct: 196 PGPPGP 201 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 184 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 233 Query: 981 PPPPXP 998 P PP P Sbjct: 234 PGPPGP 239 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 38.3 bits (85), Expect = 0.016 Identities = 24/72 (33%), Positives = 24/72 (33%), Gaps = 6/72 (8%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPP-PPXXPXXXXPGPGXXPXXXGXXXX-----PX 962 PP P P P P PP PP P PGP P G P Sbjct: 141 PPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPGPTGPTRPGPPG 200 Query: 963 PPXPXXPPPPXP 998 PP P P PP P Sbjct: 201 PPGPTRPGPPGP 212 Score = 33.1 bits (72), Expect = 0.62 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP P P P G P PP P PP P Sbjct: 135 PNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGPPGPPGP 176 Score = 32.7 bits (71), Expect = 0.82 Identities = 21/66 (31%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P PP P P PGP P G P P P Sbjct: 138 PPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPGP-PGPPGP-TRPGPYGPPGPPGPTGPTR 195 Query: 981 PPPPXP 998 P PP P Sbjct: 196 PGPPGP 201 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P P P P G P P P P P P Sbjct: 173 PPGPTRPGPYGPPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGPTRP 226 Score = 30.3 bits (65), Expect = 4.4 Identities = 20/66 (30%), Positives = 20/66 (30%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P P P P PP PGP P PP P Sbjct: 184 PPGPPGPTGPTRPGPPGPPGPTRPGPPGPPGPTRPGPPGP----------TRPGPPGPTR 233 Query: 981 PPPPXP 998 P PP P Sbjct: 234 PGPPGP 239 >AE014296-852|AAF47904.2| 242|Drosophila melanogaster CG11345-PA protein. Length = 242 Score = 38.3 bits (85), Expect = 0.016 Identities = 23/66 (34%), Positives = 26/66 (39%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P +L P K++P P P PPPP P P P PP P Sbjct: 105 PPKPA-YLPPPPPVVKVNP-PKPAYLPPPPPVVKVNPPKPSYLPPPP-PVVKVNPPKPAY 161 Query: 981 PPPPXP 998 PPP P Sbjct: 162 VPPPPP 167 Score = 35.9 bits (79), Expect = 0.088 Identities = 23/70 (32%), Positives = 26/70 (37%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P +L P K++P P P PPPP P P P PP Sbjct: 84 PVVRTPKPA-YLPPPPPVIKVNP-PKPAYLPPPPPVVKVNPPKPAYLPPPP-PVVKVNPP 140 Query: 969 XPXXPPPPXP 998 P PPP P Sbjct: 141 KPSYLPPPPP 150 Score = 33.5 bits (73), Expect = 0.47 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P +L P K++P P P PPPP P P P P Sbjct: 122 PPKPA-YLPPPPPVVKVNP-PKPSYLPPPPPVVKVNPPKPAYVPPPPPAVKVNPPKPAYL 179 Query: 981 PPPP 992 PP P Sbjct: 180 PPAP 183 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/70 (28%), Positives = 21/70 (30%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P + P P PPPP P P P PP Sbjct: 65 PVTVPPPVYLPPATVKPEIPVVRTPKPAYLPPPPPVIKVNPPKPAYLPPPP-PVVKVNPP 123 Query: 969 XPXXPPPPXP 998 P PPP P Sbjct: 124 KPAYLPPPPP 133 >X05285-1|CAA28903.1| 147|Drosophila melanogaster fibrillarin protein. Length = 147 Score = 37.9 bits (84), Expect = 0.022 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGGG G GG G G G G G GGG G G G G G R Sbjct: 31 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 90 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 91 GGGGRGGGGRG 101 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXG-XXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 64 GRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAG 110 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 988 GGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 GGG G GG G G G G GGGG G G Sbjct: 17 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRG 59 >BT015282-1|AAT94511.1| 1250|Drosophila melanogaster LD04601p protein. Length = 1250 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGG-GGXXXGXGXGXS 848 G GGG G GG G G GPG G GG GG G G G S Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGS 820 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGG G G G P G G G G GGG G G G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 30.3 bits (65), Expect = 4.4 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G G G G GG G G G G GGG G G G + G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGG 878 G GGGG G GG G G G G G GGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 >AF255733-1|AAF71288.1| 1250|Drosophila melanogaster DNA topoisomerase III alpha protein. Length = 1250 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGG-GGXXXGXGXGXS 848 G GGG G GG G G GPG G GG GG G G G S Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGS 820 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGG G G G P G G G G GGG G G G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 30.3 bits (65), Expect = 4.4 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G G G G GG G G G G GGG G G G + G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGG 878 G GGGG G GG G G G G G GGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 >AE014134-3114|AAF53813.2| 1250|Drosophila melanogaster CG10123-PA protein. Length = 1250 Score = 37.9 bits (84), Expect = 0.022 Identities = 21/51 (41%), Positives = 21/51 (41%), Gaps = 1/51 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGG-GGXXXGXGXGXS 848 G GGG G GG G G GPG G GG GG G G G S Sbjct: 770 GGGGGPGPGPGGGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGS 820 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGG G G G P G G G G GGG G G G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSG 826 Score = 30.3 bits (65), Expect = 4.4 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G G G G GG G G G G GGG G G G + G Sbjct: 781 GGGSGRGAGSGGWSSGPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGG 834 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGG 878 G GGGG G GG G G G G G GGG Sbjct: 796 GPGGGGSGGGGGSGGWGSGTGGGGSGGWGSGTGGGGLGGG 835 >AE013599-3536|AAF46950.1| 344|Drosophila melanogaster CG9888-PA protein. Length = 344 Score = 37.9 bits (84), Expect = 0.022 Identities = 26/71 (36%), Positives = 26/71 (36%), Gaps = 1/71 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGGG G GG G G G G G GGG G G G G G R Sbjct: 24 GRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGGGGRGGGGGGGRGAFGGRGGGGGR 83 Query: 820 XXXGXGGXXXG 788 G GG G Sbjct: 84 GGGGRGGGGRG 94 Score = 33.5 bits (73), Expect = 0.47 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXG-XXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 57 GRGGGGRGGGGGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGGAG 103 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -3 Query: 988 GGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 GGG G GG G G G G GGGG G G Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRG 52 >U13178-1|AAA86955.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 37.5 bits (83), Expect = 0.029 Identities = 25/73 (34%), Positives = 26/73 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G GGGG G G G R Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGR-------YDRG 265 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 266 GGGGGGGGGGNVQ 278 >M15765-1|AAA70425.1| 365|Drosophila melanogaster unknown protein protein. Length = 365 Score = 37.5 bits (83), Expect = 0.029 Identities = 25/73 (34%), Positives = 26/73 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G GGGG G G G R Sbjct: 175 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGR-------YDRG 227 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 228 GGGGGGGGGGNVQ 240 >L37083-1|AAC41563.1| 404|Drosophila melanogaster RNA binding protein protein. Length = 404 Score = 37.5 bits (83), Expect = 0.029 Identities = 25/73 (34%), Positives = 26/73 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G GGGG G G G R Sbjct: 213 GGGGGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGNGGGGGGR-------YDRG 265 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 266 GGGGGGGGGGNVQ 278 >BT025941-1|ABG02185.1| 207|Drosophila melanogaster IP14143p protein. Length = 207 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPP-PXXPXXXXPGPGXXPXXXGXXXXPXP 965 P P P P P P P PPP P P P P P P Sbjct: 34 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPT---PITTPPP 90 Query: 966 PXPXXPPPPXP 998 P P PPPP P Sbjct: 91 PPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 855 PXPXPXXXPPPPXX---PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P P P P P P P P P Sbjct: 54 PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >BT025938-1|ABG02182.1| 207|Drosophila melanogaster IP14043p protein. Length = 207 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPP-PXXPXXXXPGPGXXPXXXGXXXXPXP 965 P P P P P P P PPP P P P P P P Sbjct: 34 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPT---PITTPPP 90 Query: 966 PXPXXPPPPXP 998 P P PPPP P Sbjct: 91 PPPSAPPPPDP 101 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 855 PXPXPXXXPPPPXX---PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P P P P P P P P P Sbjct: 54 PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 104 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 37.5 bits (83), Expect = 0.029 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P PP P PGP P P PP P PPP P Sbjct: 213 PGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYP 252 Score = 33.5 bits (73), Expect = 0.47 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 804 PXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 P P + P P P P PPPP PGP P G P P P Sbjct: 37 PAPAQSVIYKLPPQHYYPPPPPP--PPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 91 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXX--PXPPXPXXPPPPXP 998 P P P PP P P P P P PP P PP P P Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 265 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P + P P PPPP P P P G P P P Sbjct: 215 PPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 274 Query: 981 PPPP 992 P P Sbjct: 275 VPWP 278 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 PP P G G P PP P PPPP P Sbjct: 124 PPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPP 163 Score = 29.9 bits (64), Expect = 5.8 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP- 965 P PP P P P P P PPPP P P P P P P Sbjct: 219 PGTGPPGPPGPPGTTYPQPPPPPPPPP---PPPPSYPYPPYPYPPPGPYPGPWIPLPVPV 275 Query: 966 PXP 974 P P Sbjct: 276 PWP 278 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 37.5 bits (83), Expect = 0.029 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P PP P PGP P P PP P PPP P Sbjct: 215 PGPPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYP 254 Score = 33.5 bits (73), Expect = 0.47 Identities = 18/57 (31%), Positives = 19/57 (33%) Frame = +3 Query: 804 PXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 P P + P P P P PPPP PGP P G P P P Sbjct: 39 PAPAQSVIYKLPPQHYYPPPPPP--PPPPPQHCNCPPGPPGPPGPPGLPGTPGPQGP 93 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/50 (34%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXX--PXPPXPXXPPPPXP 998 P P P PP P P P P P PP P PP P P Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 267 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P P + P P PPPP P P P G P P P Sbjct: 217 PPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYPGPWIPLPVP 276 Query: 981 PPPP 992 P P Sbjct: 277 VPWP 280 Score = 30.3 bits (65), Expect = 4.4 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 PP P G G P PP P PPPP P Sbjct: 126 PPGLPGPPGHKSGHGHHDHHDHHHHHPAPPPPPPPPPPPP 165 Score = 29.9 bits (64), Expect = 5.8 Identities = 20/63 (31%), Positives = 20/63 (31%), Gaps = 1/63 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP- 965 P PP P P P P P PPPP P P P P P P Sbjct: 221 PGTGPPGPPGPPGTTYPQPPPPPPPPP---PPPPSYPYPPYPYPPPGPYPGPWIPLPVPV 277 Query: 966 PXP 974 P P Sbjct: 278 PWP 280 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 37.5 bits (83), Expect = 0.029 Identities = 20/49 (40%), Positives = 21/49 (42%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 +P P P PPPP P P PG P P PP P PPP P Sbjct: 43 NPVPDPTRPPPPPPSPPCGRPPPGSPP--------PGPP-PPGPPPGCP 82 Score = 30.7 bits (66), Expect = 3.3 Identities = 20/67 (29%), Positives = 20/67 (29%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P P P P PPPP P GPG P Sbjct: 48 PTRPPPPPPS------PPCGRPPPGSPPPGPPPPGPPPGCPGGPGGPLQHRQWDNGPRQW 101 Query: 969 XPXXPPP 989 P PPP Sbjct: 102 QPRRPPP 108 >AE014134-759|AAF50995.3| 1118|Drosophila melanogaster CG15635-PA protein. Length = 1118 Score = 37.5 bits (83), Expect = 0.029 Identities = 23/71 (32%), Positives = 23/71 (32%), Gaps = 1/71 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPP-PXXPXXXXPGPGXXPXXXGXXXXPXP 965 P P P P P P P PPP P P P P P P Sbjct: 16 PFHFPYVPDNFPTPSAPAPPPKPRPPPPPPPPPTTTRPPTTTPTPTTTPT---PITTPPP 72 Query: 966 PXPXXPPPPXP 998 P P PPPP P Sbjct: 73 PPPSAPPPPDP 83 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 855 PXPXPXXXPPPPXX---PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PPPP P P P P P P P P P P Sbjct: 36 PKPRPPPPPPPPPTTTRPPTTTPTPTTTPTPITTPPPPPPSAPPPPDPATP 86 >AY069664-1|AAL39809.1| 600|Drosophila melanogaster LD44138p protein. Length = 600 Score = 36.3 bits (80), Expect = 0.067 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P PPP PG G P PP P PPPP P Sbjct: 375 PKAPKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPP 418 >AE014298-3143|AAF50813.1| 183|Drosophila melanogaster CG10918-PA protein. Length = 183 Score = 36.3 bits (80), Expect = 0.067 Identities = 21/47 (44%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPG-XXXXGXXGGGGXXXGXG 860 G GGGG G GG G P G GPG G GGGG G G Sbjct: 43 GRGGGGFGGRGGPGGTGGPGGFG---GPGRFGGPGGLGGGGGFGGPG 86 >AE014297-2494|AAN13768.1| 600|Drosophila melanogaster CG7129-PB, isoform B protein. Length = 600 Score = 36.3 bits (80), Expect = 0.067 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P PPP PG G P PP P PPPP P Sbjct: 375 PKAPKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPP 418 >AE014297-2493|AAF55531.1| 600|Drosophila melanogaster CG7129-PA, isoform A protein. Length = 600 Score = 36.3 bits (80), Expect = 0.067 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P PPP PG G P PP P PPPP P Sbjct: 375 PKAPKPPPFIGGHLPPGYSIPSGYAGSETPPSPPMPKGPPPPPP 418 >AE013599-1244|AAS64915.1| 253|Drosophila melanogaster CG13214-PB, isoform B protein. Length = 253 Score = 36.3 bits (80), Expect = 0.067 Identities = 25/70 (35%), Positives = 27/70 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G GP G GGGG G G G + + G R Sbjct: 46 GFGGGGGFGGGGAGGGYGGGGGG---GPAGGFGGGPGGGG-AGGFGGGNNGLGGFANGRP 101 Query: 817 XXGXGGXXXG 788 GG G Sbjct: 102 IAPGGGGGGG 111 >BT004476-1|AAO42640.1| 286|Drosophila melanogaster LP07342p protein. Length = 286 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG GG G G G G G GGGG G G G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXX 812 GGGG G G G G G G G GGG G G S G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 811 GXGGXXXG 788 G GG G Sbjct: 87 GGGGGGFG 94 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXS 848 G G GG G G G G G G G GGGG G G G S Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFS 82 Score = 33.9 bits (74), Expect = 0.36 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGG G G G G G G G GGG G G G G G + Sbjct: 58 GGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGG 117 Query: 820 XXXGXGG 800 G GG Sbjct: 118 FGGGGGG 124 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLV 842 G GGGG G GG G G G G GG G G G G +LV Sbjct: 84 GGGGGGGGGFGG----GFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLV 131 >AJ271041-1|CAB66004.1| 286|Drosophila melanogaster Gly-rich protein protein. Length = 286 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG GG G G G G G GGGG G G G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXX 812 GGGG G G G G G G G GGG G G S G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 811 GXGGXXXG 788 G GG G Sbjct: 87 GGGGGGFG 94 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXS 848 G G GG G G G G G G G GGGG G G G S Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFS 82 Score = 33.9 bits (74), Expect = 0.36 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGG G G G G G G G GGG G G G G G + Sbjct: 58 GGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGG 117 Query: 820 XXXGXGG 800 G GG Sbjct: 118 FGGGGGG 124 >AE014297-4048|AAF56656.1| 286|Drosophila melanogaster CG5812-PA protein. Length = 286 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG GG G G G G G GGGG G G G Sbjct: 76 GGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGGFGGG 121 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXX 812 GGGG G G G G G G G GGG G G S G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGGG 86 Query: 811 GXGGXXXG 788 G GG G Sbjct: 87 GGGGGGFG 94 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXS 848 G G GG G G G G G G G GGGG G G G S Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFS 82 Score = 33.9 bits (74), Expect = 0.36 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGG G G G G G G G GGG G G G G G + Sbjct: 58 GGFGGGFGGGSGGGGFSSGGGGGFSSGGGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGG 117 Query: 820 XXXGXGG 800 G GG Sbjct: 118 FGGGGGG 124 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLV 842 G GGGG G GG G G G G GG G G G G +LV Sbjct: 84 GGGGGGGGGFGG----GFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLV 131 >AE014296-3444|AAF51657.1| 98|Drosophila melanogaster CG11458-PA protein. Length = 98 Score = 35.9 bits (79), Expect = 0.088 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = -3 Query: 988 GGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGG G GG G G G G G GGGG G G G Sbjct: 21 GGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGG 65 Score = 33.5 bits (73), Expect = 0.47 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G G G G G G GGGG G G G Sbjct: 39 GGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGG 86 Score = 32.3 bits (70), Expect = 1.1 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 4/74 (5%) Frame = -3 Query: 997 GXGGGGXXGXGGX----GXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXI 830 G GGGG G GG G G G G G GGGG G G + G Sbjct: 21 GGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGGGGGKHGGGNGGGG-- 78 Query: 829 LKRXXXGXGGXXXG 788 K G GG G Sbjct: 79 -KHGGGGGGGGGGG 91 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG GG G G G G GGGG G G Sbjct: 51 GGGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 31.9 bits (69), Expect = 1.4 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G G GGGG G G Sbjct: 53 GGGGGGKHGGGGGGGGKH----GGGNGGGGKHGGGGGGGGGGGKHGGG 96 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G G G G G G G GGGG G G Sbjct: 52 GGGGGGGKHGGGGGGGGKHGGGNGGGGKHGGGGGGGGGGGKHGGGG 97 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 407 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 465 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 466 GPGAPPPPPP 475 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 450 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 410 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 468 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 469 GPGAPPPPPP 478 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 439 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 453 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 553 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 611 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 612 GPGAPPPPPP 621 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 582 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 622 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 551 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 596 >AY069099-1|AAL39244.1| 562|Drosophila melanogaster GH11670p protein. Length = 562 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXT-KLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP 965 P PP P K P K +P P P P PP P P P P P Sbjct: 57 PAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTP 116 Query: 966 PXPXXPPPP 992 P PP Sbjct: 117 PPAKPSSPP 125 >AE014296-1574|AAF50325.2| 562|Drosophila melanogaster CG32031-PA, isoform A protein. Length = 562 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/69 (30%), Positives = 22/69 (31%), Gaps = 1/69 (1%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXT-KLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP 965 P PP P K P K +P P P P PP P P P P P Sbjct: 57 PAVVPPAPKPDPPKPAPAVAKPTPVPVPATAPAPPKEEPAPKPKPEPVPSPVVAPPKPTP 116 Query: 966 PXPXXPPPP 992 P PP Sbjct: 117 PPAKPSSPP 125 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 552 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 610 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 611 GPGAPPPPPP 620 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 581 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 621 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 550 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 595 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 407 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 465 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 466 GPGAPPPPPP 475 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 450 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 407 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 465 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 466 GPGAPPPPPP 475 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 450 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 407 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 465 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 466 GPGAPPPPPP 475 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 436 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 476 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 405 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 450 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 35.1 bits (77), Expect = 0.15 Identities = 21/70 (30%), Positives = 22/70 (31%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP P +P PPPP P P P G P P Sbjct: 410 PAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP-PAPPAMGGGPPPAPG 468 Query: 969 XPXXPPPPXP 998 P PPPP P Sbjct: 469 GPGAPPPPPP 478 Score = 31.1 bits (67), Expect = 2.5 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +3 Query: 852 SPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP 974 +P P PPP P G G P G P PP P Sbjct: 439 APPPPAMGGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPP 479 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP GP P PP PPP P Sbjct: 408 PAPAPPPPPPSFGGAAGGGPPPPAPPQMFNGAPPPPAMGGGPPPAP 453 >X71975-1|CAA50795.1| 239|Drosophila melanogaster GCR 101 protein. Length = 239 Score = 34.3 bits (75), Expect = 0.27 Identities = 23/68 (33%), Positives = 23/68 (33%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXX 812 GGGG G GG G G G G G GG G G G G R Sbjct: 172 GGGGGGGFGGRGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGG----GGGGFNRGRG 227 Query: 811 GXGGXXXG 788 G GG G Sbjct: 228 GGGGGGGG 235 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G GGGG G G Sbjct: 193 GRGGGGGRGGGGFRGGAGRNGGGGGGG-GGFNRGRGGGGGGGGGRG 237 >BT028801-1|ABI34182.1| 286|Drosophila melanogaster LP21747p protein. Length = 286 Score = 34.3 bits (75), Expect = 0.27 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXX 812 GGGG G G G G G G G GGG G G S G Sbjct: 27 GGGGGSGGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFSSGVG 86 Query: 811 GXGGXXXG 788 G GG G Sbjct: 87 GGGGGGFG 94 Score = 34.3 bits (75), Expect = 0.27 Identities = 19/50 (38%), Positives = 19/50 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXS 848 G G GG G G G G G G G GGGG G G G S Sbjct: 33 GGGSGGGLGGGFGGGSSGGFGGGIGGGFGGGFGGGSGGGGFSSGGGGGFS 82 Score = 33.9 bits (74), Expect = 0.36 Identities = 22/67 (32%), Positives = 23/67 (34%), Gaps = 1/67 (1%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG-GXXXGXGXGXSLVXGXILKR 821 G GGG G G G G G G G GGG G G G G G + Sbjct: 58 GGFGGGFGGGSGGGGFSSGGGGGFSSGVGGGGGGGFGGGFGGGSGGGSGGGFGGGGSIGG 117 Query: 820 XXXGXGG 800 G GG Sbjct: 118 FGGGGGG 124 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/52 (38%), Positives = 21/52 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLV 842 G GGGG G GG G G G G GG G G G G +LV Sbjct: 84 GVGGGGGGGFGG----GFGGGSGGGSGGGFGGGGSIGGFGGGGGGGGGTTLV 131 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P PG PP P PPPP P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPG-------------PPPPGPPPPPGP 113 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P PG PP P PPPP P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPG-------------PPPPGPPPPPGP 143 >AY075501-1|AAO39496.1| 299|Drosophila melanogaster RE52135p protein. Length = 299 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRG-GGGGRGGGGGFGRGGG 52 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P PPPP P P P P PP P PPPP P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 P P PPPP P P P P PP P P Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P PPPP P P P P PP P PPPP P Sbjct: 318 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 366 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 P P PPPP P P P P PP P P Sbjct: 330 PPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 374 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P PPPP P P P P PP P PPPP P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 P P PPPP P P P P PP P P Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 33.9 bits (74), Expect = 0.36 Identities = 17/49 (34%), Positives = 17/49 (34%), Gaps = 3/49 (6%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P PPPP P P P P PP P PPPP P Sbjct: 351 PGAARAPPPPNRPPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPP 399 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 P P PPPP P P P P PP P P Sbjct: 363 PPPISTAPPPPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVGEIP 407 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P PG PP P PPPP P Sbjct: 111 PGPPAYPPPPQRPWGPPPPPG-------------PPPPGPPPPPGP 143 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 33.9 bits (74), Expect = 0.36 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = +3 Query: 861 PXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P PG PP P PPPP P Sbjct: 81 PGPPAYPPPPQRPWGPPPPPG-------------PPPPGPPPPPGP 113 >AE013599-3129|AAF46672.1| 237|Drosophila melanogaster CG4038-PA protein. Length = 237 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 8 GGGGGGGRGFGGGGGGGGRGFGGGGGGRG-GGGGRGGGGGFGRGGG 52 Score = 33.9 bits (74), Expect = 0.36 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 192 GRGGGG--GRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRG 235 Score = 32.7 bits (71), Expect = 0.82 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G G GG G GG G G G G G GGGG G G G Sbjct: 190 GGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGG--GGGRG 235 Score = 32.3 bits (70), Expect = 1.1 Identities = 25/70 (35%), Positives = 25/70 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G G GGGG G G G R Sbjct: 174 GGGGGG--GFGGRG--------GGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRG 223 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 224 RGGGGGGGGG 233 Score = 31.9 bits (69), Expect = 1.4 Identities = 22/67 (32%), Positives = 22/67 (32%) Frame = -3 Query: 988 GGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRXXXG 809 GGG G G G G G G G GG G G G G G R G Sbjct: 173 GGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRG----RGGGG 228 Query: 808 XGGXXXG 788 GG G Sbjct: 229 GGGGGRG 235 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P G P PP P PPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +3 Query: 879 PPPPXXP--XXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P P G P PP P PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 7/71 (9%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPG-PGXXPXXXGXXXXPXPPXP- 974 PP P P P PPPP P G P P G P PP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 975 -----XXPPPP 992 PPPP Sbjct: 574 MMRPGGGPPPP 584 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPG-------PGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P G P P G P PP PPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P P P P P P G P PP P PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P G P PP P PPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +3 Query: 879 PPPPXXP--XXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P P G P PP P PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 7/71 (9%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPG-PGXXPXXXGXXXXPXPPXP- 974 PP P P P PPPP P G P P G P PP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 975 -----XXPPPP 992 PPPP Sbjct: 574 MMRPGGGPPPP 584 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPG-------PGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P G P P G P PP PPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P P P P P P G P PP P PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT004875-1|AAO45231.1| 399|Drosophila melanogaster LD22761p protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G G GGG G G G G R Sbjct: 214 GGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGG-----GGRYDRG 260 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 261 GGGGGGGGGGNVQ 273 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKR 821 G GGGG G GG G G G GGG G G G G + R Sbjct: 217 GGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXX-GXXXXPXPPXPXXPPPP 992 P P PPPP P G G P PP P PPPP Sbjct: 356 PGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 402 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXX-GXXXXPXPPXPXXPPPP 992 P P PPPP P G G P PP P PPPP Sbjct: 161 PGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 207 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 33.5 bits (73), Expect = 0.47 Identities = 24/79 (30%), Positives = 24/79 (30%), Gaps = 9/79 (11%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXX-PPPPXXPXXXXPGPGXX----PXXXGXXX 953 P PP P P P P P PPPP P P P P G Sbjct: 120 PEDQPPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEGQAL 179 Query: 954 X----PXPPXPXXPPPPXP 998 P P PPPP P Sbjct: 180 IMTLLPPDPPEDQPPPPPP 198 >AE014298-2351|AAN09389.1| 399|Drosophila melanogaster CG3606-PB, isoform B protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G G GGG G G G G R Sbjct: 214 GGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGG-----GGRYDRG 260 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 261 GGGGGGGGGGNVQ 273 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKR 821 G GGGG G GG G G G GGG G G G G + R Sbjct: 217 GGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 >AE014298-2350|AAF48578.2| 399|Drosophila melanogaster CG3606-PA, isoform A protein. Length = 399 Score = 33.5 bits (73), Expect = 0.47 Identities = 26/73 (35%), Positives = 27/73 (36%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G GG G G G G G GGG G G G G R Sbjct: 214 GGGGGGGGGRGGFG--------GRRGGGGGGGGGGGGGGRFDRGGGGG-----GGRYDRG 260 Query: 817 XXGXGGXXXGXLQ 779 G GG G +Q Sbjct: 261 GGGGGGGGGGNVQ 273 Score = 30.7 bits (66), Expect = 3.3 Identities = 19/59 (32%), Positives = 20/59 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKR 821 G GGGG G GG G G G GGG G G G G + R Sbjct: 217 GGGGGGRGGFGGRRGGGGGGGGGGGGGGRFDRGGGGGGGRYDRGGGGGGGGGGGNVQPR 275 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXX-GXXXXPXPPXPXXPPPP 992 P P PPPP P G G P PP P PPPP Sbjct: 726 PGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPP 772 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P G P PP P PPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +3 Query: 879 PPPPXXP--XXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P P G P PP P PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 7/71 (9%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPG-PGXXPXXXGXXXXPXPPXP- 974 PP P P P PPPP P G P P G P PP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 975 -----XXPPPP 992 PPPP Sbjct: 574 MMRPGGGPPPP 584 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPG-------PGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P G P P G P PP PPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P P P P P P G P PP P PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 33.5 bits (73), Expect = 0.47 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 5/45 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P G P PP P PPPP P Sbjct: 515 PPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPP 559 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 7/47 (14%) Frame = +3 Query: 879 PPPPXXP--XXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPPXP 998 PPPP P P P P G P PP P PPPP P Sbjct: 526 PPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMP 572 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/71 (30%), Positives = 22/71 (30%), Gaps = 7/71 (9%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPG-PGXXPXXXGXXXXPXPPXP- 974 PP P P P PPPP P G P P G P PP P Sbjct: 514 PPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPG 573 Query: 975 -----XXPPPP 992 PPPP Sbjct: 574 MMRPGGGPPPP 584 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/55 (32%), Positives = 18/55 (32%), Gaps = 7/55 (12%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPG-------PGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P G P P G P PP PPP P Sbjct: 516 PPPGGGGAPPPPPPPMPGRAGGGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP----XXPPPPXP 998 P P P P P P G P PP P PPPP P Sbjct: 501 PSPNKLPKVNIPMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPP 544 >BT021407-1|AAX33555.1| 720|Drosophila melanogaster LD06749p protein. Length = 720 Score = 33.1 bits (72), Expect = 0.62 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 660 GRGGGGRGGGGGFGG----RGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.3 bits (70), Expect = 1.1 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G G GGGG G G Sbjct: 646 GRGGGGRGGGGGFGGRGG-GGRGGGGGFGGRGGGGRGGGGFGGRGGRG 692 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 622 >BT003208-1|AAO24963.1| 478|Drosophila melanogaster SD23764p protein. Length = 478 Score = 33.1 bits (72), Expect = 0.62 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 7/77 (9%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P L P P P P PP P P P G P PP Sbjct: 182 PLPAKPYPYPDL-AAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPP 240 Query: 969 XPXXP-------PPPXP 998 P P PPP P Sbjct: 241 PPPPPAGGVLVMPPPPP 257 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 583 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 33.1 bits (72), Expect = 0.62 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPP 992 PPPP P P P P P PP P PPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 843 TKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP--PXPXXPPPPXP 998 T++S P P PPP P P P P P PPPP P Sbjct: 361 TQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 392 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 428 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 33.1 bits (72), Expect = 0.62 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 + P P PPPP P P P P PP P PPPP P Sbjct: 637 VDPSYPPPPPPPPPPPPPQTCCAPVRPP--YAPPVRPLPP-PPPPPPPVP 683 >AF162774-1|AAF68853.2| 720|Drosophila melanogaster Nopp140-like nucleolar protein protein. Length = 720 Score = 33.1 bits (72), Expect = 0.62 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 660 GRGGGGRGGGGGFGG----RGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.3 bits (70), Expect = 1.1 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G G GGGG G G Sbjct: 646 GRGGGGRGGGGGFGGRGG-GGRGGGGGFGGRGGGGRGGGGFGGRGGRG 692 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 33.1 bits (72), Expect = 0.62 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +3 Query: 849 LSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 + P P PPPP P P P P PP P PPPP P Sbjct: 777 VDPSYPPPPPPPPPPPPPQTCCAPVRPP--YAPPVRPLPP-PPPPPPPVP 823 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 547 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 583 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 586 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 622 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 33.1 bits (72), Expect = 0.62 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 882 PPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 PPP P P P P PP P PPPP Sbjct: 888 PPPAPPMLKAIPPPPPPMAPSMMPPPPPPCPGAPPPP 924 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 33.1 bits (72), Expect = 0.62 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPP 992 PPPP P P P P P PP P PPPP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 426 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 843 TKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP--PXPXXPPPPXP 998 T++S P P PPP P P P P P PPPP P Sbjct: 361 TQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 33.1 bits (72), Expect = 0.62 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 5/43 (11%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPPPP 992 PPPP P P P P P PP P PPPP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPPPSSGMAGVPPPP 542 Score = 30.7 bits (66), Expect = 3.3 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 2/54 (3%) Frame = +3 Query: 843 TKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXP--PXPXXPPPPXP 998 T++S P P PPP P P P P P PPPP P Sbjct: 477 TQISSTPVPVSPPPPTAASVGVPPPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 >AE014296-3628|AAF51788.3| 720|Drosophila melanogaster CG7421-PA, isoform A protein. Length = 720 Score = 33.1 bits (72), Expect = 0.62 Identities = 19/46 (41%), Positives = 19/46 (41%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGGG G GG G G G G G GGGG G G Sbjct: 660 GRGGGGRGGGGGFGG----RGGGGRGGGGFGGRGGRGGGGRGGGFG 701 Score = 32.3 bits (70), Expect = 1.1 Identities = 19/48 (39%), Positives = 19/48 (39%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G G GGGG G G Sbjct: 646 GRGGGGRGGGGGFGGRGG-GGRGGGGGFGGRGGGGRGGGGFGGRGGRG 692 >AE013599-1621|AAF58436.2| 478|Drosophila melanogaster CG3884-PA, isoform A protein. Length = 478 Score = 33.1 bits (72), Expect = 0.62 Identities = 23/77 (29%), Positives = 23/77 (29%), Gaps = 7/77 (9%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P L P P P P PP P P P G P PP Sbjct: 182 PLPAKPYPYPDL-AAMPFPDRPPAYTPTPDPMPPVGGVMVMPSPTPPPPAGGVLVMPRPP 240 Query: 969 XPXXP-------PPPXP 998 P P PPP P Sbjct: 241 PPPPPAGGVLVMPPPPP 257 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 32.7 bits (71), Expect = 0.82 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P G P PP PPP P Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPP---PPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P GP P G P PP PPP P Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGP--PPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P P PP P GP P P P PPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPP 481 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P P PPP P P P P PP PPPP Sbjct: 132 PKPAPQYGPPPQPAPQYGPPPPKPAPQYG------PPPTQYGPPPP 171 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 PPPP P GP P P PP PPP P Sbjct: 435 PPPP--PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGP------GXXPXXXGXXXXPXPPXPXXPPPP 992 P P PPPP P P G P G P PP PPP Sbjct: 449 PPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 32.7 bits (71), Expect = 0.82 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P G P PP PPP P Sbjct: 438 PPPSGNYGPPPPPPSGNYGPPP---PPPSGNYGPPPPPSGNYGPPPPP 482 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP P GP P G P PP PPP P Sbjct: 447 PPPPPSGNYGPPPPPPSGNYGP--PPPPSGNYGPPPPPSGNYGPPPPP 492 Score = 31.1 bits (67), Expect = 2.5 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P P PP P GP P P P PPPP Sbjct: 436 PPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPP 481 Score = 30.3 bits (65), Expect = 4.4 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P P PPP P P P P PP PPPP Sbjct: 132 PKPAPQYGPPPQPAPQYGPPPPKPAPQYG------PPPTQYGPPPP 171 Score = 29.9 bits (64), Expect = 5.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 879 PPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 PPPP P GP P P PP PPP P Sbjct: 435 PPPP--PPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPP 472 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 6/52 (11%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGP------GXXPXXXGXXXXPXPPXPXXPPPP 992 P P PPPP P P G P G P PP PPP Sbjct: 449 PPPSGNYGPPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPPPPSGNYGPPP 500 >AE014298-9|AAX52465.1| 193|Drosophila melanogaster CG13376-PA protein. Length = 193 Score = 32.3 bits (70), Expect = 1.1 Identities = 22/66 (33%), Positives = 24/66 (36%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXILKRX 818 G GGGG G G G G G G GGGG G G S ++K Sbjct: 58 GGGGGGGGWSSGGGGGGGGWSSGGGGGGGGWSSG--GGGGGWSSGGGGGSGSDVKLIKII 115 Query: 817 XXGXGG 800 G GG Sbjct: 116 SLGGGG 121 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 32.3 bits (70), Expect = 1.1 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 8/58 (13%) Frame = +3 Query: 843 TKLSPXPXPXXXPPP---PXXPXXXXPG-----PGXXPXXXGXXXXPXPPXPXXPPPP 992 T+L P P P PPP P P P P P P PP PPPP Sbjct: 311 TRLPPPPPPPRTPPPTRPPTKPPTTRPPATYLPPTNKPPPPVTTRRPTPPPTRPPPPP 368 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P P + +P P PP P P P P PP Sbjct: 258 PTNKPLPPVTTRLPPPPPSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPP 317 Query: 969 XPXXPPPP 992 P PPP Sbjct: 318 PPPRTPPP 325 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 2/48 (4%) Frame = +3 Query: 855 PXPXPXXXPP--PPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PP PP P P P P P PP P PPP Sbjct: 193 PPTRPPTRPPTRPPTPPPTYLP-PTNKPLPPVTTRLPPPPPPPRTPPP 239 Score = 29.9 bits (64), Expect = 5.8 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 10/78 (12%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPX--TKLSPXPXPXXXPPP---PXXPXXXXPG-----PGXXPXX 938 P PP K P T+L P P P PPP P P P P P Sbjct: 205 PPTPPPTYLPPTNKPLPPVTTRLPPPPPPPRTPPPTRPPTRPPTTRPPATYLPPTNKPLP 264 Query: 939 XGXXXXPXPPXPXXPPPP 992 P PP PPP Sbjct: 265 PVTTRLPPPPPSPRTPPP 282 Score = 29.5 bits (63), Expect = 7.6 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPP--PPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P P PP PP P P P P P PP PPP P Sbjct: 179 PVRTTQPPTRPPTRPPTRPPTRPPTRPPTP--PPTYLPPTNKPLPPVTTRLPPPPP 232 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 32.3 bits (70), Expect = 1.1 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPG---XXPXXXGXXXXPXPPXPXXPPPPXP 998 P K P P P PPPP P P P P PPPP P Sbjct: 254 PVPKYVPPPTPTYIPPPPKKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 310 Score = 31.1 bits (67), Expect = 2.5 Identities = 28/127 (22%), Positives = 33/127 (25%), Gaps = 1/127 (0%) Frame = +3 Query: 621 VXXPXLXPPPFIXVPLXXPXXPPLXLKIINXXLVXKPSPXXXQXXXXXXXXAFCXXPXXX 800 + P PP +P P PP+ + P P Q P Sbjct: 232 IPFPPPTNPPQKYLPPVVPTSPPVPKYVPPPTPTYIPPPPKKQGYDYPKPAI----PFPP 287 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPG-XXPXXXGXXXXPXPPXPX 977 P P T+ P P P PPP P P P PP Sbjct: 288 PTAPPQKYLPPVTTTQAPPPPPPKYLPPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTT 347 Query: 978 XPPPPXP 998 PP P Sbjct: 348 TKAPPPP 354 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 32.3 bits (70), Expect = 1.1 Identities = 31/124 (25%), Positives = 36/124 (29%), Gaps = 5/124 (4%) Frame = +3 Query: 642 PPPFIXVPLXXPXXPPLXLKIINXXLVXKPSPXXXQXXXXXXXXAFCXXPXXXPPXPXXH 821 PPP V P PP K++ P + PP P Sbjct: 196 PPPTKKVVYTPPPPPPPPKKVV----YTPPPTGILKDDGYHYGQPSVKFEVSAPPAPKVE 251 Query: 822 LFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-----XXPP 986 + P K+ P P PPP P P P P PP P PP Sbjct: 252 -YLPPPTKKVVIAPPPVYVPPPTKKVIYTPPPP---PPTKKVVYTPPPPPPTKKVVYTPP 307 Query: 987 PPXP 998 PP P Sbjct: 308 PPPP 311 Score = 31.1 bits (67), Expect = 2.5 Identities = 22/71 (30%), Positives = 24/71 (33%), Gaps = 5/71 (7%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP-- 974 PP P + P K+ P P PPP P P P P PP P Sbjct: 132 PPPPKVE-YLPPPTKKVVIAPPPVYVPPPTKKVVYTPPPP---PPTKKVVYTPPPPPPTK 187 Query: 975 ---XXPPPPXP 998 PPPP P Sbjct: 188 KVVYTPPPPPP 198 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP---XPXXPPPPXP 998 P T P P P PPPP P P P P P P P P P Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 >AY113557-1|AAM29562.1| 93|Drosophila melanogaster RH06401p protein. Length = 93 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G GGG G G Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G G GGG G G G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYG--GGGQKNGGGGHGGGGQG 68 >AE014298-2542|AAF48711.1| 133|Drosophila melanogaster CG5172-PA, isoform A protein. Length = 133 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G GGG G G Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G G GGG G G G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYG--GGGQKNGGGGHGGGGQG 68 >AE014298-2541|AAS65393.1| 95|Drosophila melanogaster CG5172-PB, isoform B protein. Length = 95 Score = 31.9 bits (69), Expect = 1.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G GG G G G G GGG G G Sbjct: 26 GGGGGGYGGGGGGGYGGGGGGQSGYGGGGQKNGGGGHGGGGQGSYGGG 73 Score = 31.1 bits (67), Expect = 2.5 Identities = 18/46 (39%), Positives = 18/46 (39%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 GGGG G GG G G G G G GGG G G G Sbjct: 25 GGGGGGGYGGGGGGGYGGGGGGQSGYG--GGGQKNGGGGHGGGGQG 68 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/57 (31%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP---XPXXPPPPXP 998 P T P P P PPPP P P P P P P P P P Sbjct: 330 PVTAAPPPPPPPPPPPPPPPPAQTSAIPSPPPFPTKGAVKPLSPSLATPLNMPQPPP 386 >X73134-1|CAA51651.1| 127|Drosophila melanogaster GCR 20 protein. Length = 127 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXG 866 G G GG G GG G P G GPG G GG G G Sbjct: 85 GGGFGGQGGFGGGGFGGRPG--GGFGGPGGGFGGPGGGFGGGFG 126 >X71976-1|CAA50796.1| 188|Drosophila melanogaster GCR 1 protein protein. Length = 188 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG 881 G GGGG G GG G P P G GGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P +P P P P P P G P PP P PPPP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AY119132-1|AAM50992.1| 188|Drosophila melanogaster RE35358p protein. Length = 188 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG 881 G GGGG G GG G P P G GGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP +L P K P PP P P P P PP Sbjct: 115 PPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPP 174 Query: 969 XPXXPPPPXP 998 PPP P Sbjct: 175 ESKYLPPPTP 184 Score = 29.9 bits (64), Expect = 5.8 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P T L P P PPP P P P P P Sbjct: 154 PPPPPPPVVAPKP-TYLPPSPPESKYLPPPTPEVKYLP-PAPVARYLPPKVAPSLPPPPP 211 Query: 981 PPPPXP 998 PPP P Sbjct: 212 PPPVAP 217 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P +P P P P P P G P PP P PPPP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AY070976-1|AAL48598.1| 127|Drosophila melanogaster RE07460p protein. Length = 127 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXG 866 G G GG G GG G P G GPG G GG G G Sbjct: 85 GGGFGGQGGFGGGGFGGRPG--GGFGGPGGGFGGPGGGFGGGFG 126 >AE014297-4805|AAF57194.1| 188|Drosophila melanogaster CG2150-PA protein. Length = 188 Score = 31.5 bits (68), Expect = 1.9 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG 881 G GGGG G GG G P P G GGG Sbjct: 95 GGGGGGGGGGGGGGYPSGPSSSYGPPSTSYGAPGIGGGG 133 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 31.5 bits (68), Expect = 1.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPG 923 P KL P P P PPPP P P PG Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSP-PG 95 >AE014297-1701|AAF54959.1| 127|Drosophila melanogaster CG9757-PA protein. Length = 127 Score = 31.5 bits (68), Expect = 1.9 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXG 866 G G GG G GG G P G GPG G GG G G Sbjct: 85 GGGFGGQGGFGGGGFGGRPG--GGFGGPGGGFGGPGGGFGGGFG 126 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 31.5 bits (68), Expect = 1.9 Identities = 17/57 (29%), Positives = 18/57 (31%), Gaps = 3/57 (5%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXP---XXPPPPXP 998 P +P P P P P P G P PP P PPPP P Sbjct: 155 PAKAAAPAAAPAPAAPKAAPAPAAAPKPAPPPPAAGAPKPPPPPPPKAAPRPPPPAP 211 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P K P P P PPPP P P P G P PP Sbjct: 255 PTRKPSQPVGVSAKTTPPPP-PPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 Query: 969 XP 974 P Sbjct: 314 PP 315 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/70 (27%), Positives = 20/70 (28%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP +L P K P PP P P P P PP Sbjct: 115 PPPPPPPKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPPVVAPKPTYLPPSPP 174 Query: 969 XPXXPPPPXP 998 PPP P Sbjct: 175 ESKYLPPPTP 184 Score = 29.9 bits (64), Expect = 5.8 Identities = 20/66 (30%), Positives = 21/66 (31%) Frame = +3 Query: 801 PPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXX 980 PP P + P T L P P PPP P P P P P Sbjct: 154 PPPPPPPVVAPKP-TYLPPSPPESKYLPPPTPEVKYLP-PAPVARYLPPKVAPSLPPPPP 211 Query: 981 PPPPXP 998 PPP P Sbjct: 212 PPPVAP 217 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 31.5 bits (68), Expect = 1.9 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P P P K P P P PPPP P P P G P PP Sbjct: 255 PTRKPSQPVGVSAKTTPPPP-PPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPP 313 Query: 969 XP 974 P Sbjct: 314 PP 315 >U88570-1|AAB53050.1| 3190|Drosophila melanogaster CREB-binding protein homolog protein. Length = 3190 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/55 (29%), Positives = 20/55 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL 827 G GG G GG G PG G G G G G G ++ G ++ Sbjct: 47 GAGGGNGGGGASGVTTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVV 101 >AE014298-1361|AAF46516.2| 3276|Drosophila melanogaster CG15319-PB protein. Length = 3276 Score = 31.1 bits (67), Expect = 2.5 Identities = 16/55 (29%), Positives = 20/55 (36%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXGXIL 827 G GG G GG G PG G G G G G G ++ G ++ Sbjct: 47 GAGGGNGGGGASGVTTNPTSGPNPGGGPNKPAAQGPGSGTGGVGVGVNVGVGGVV 101 >AE014296-2059|AAF49989.1| 747|Drosophila melanogaster CG7260-PA protein. Length = 747 Score = 31.1 bits (67), Expect = 2.5 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXGXSLVXG 836 G GGGG G G G G G G GGG G +V G Sbjct: 73 GGGGGGAGGGAGSGSPQHVTHNGHGHGHGLGGVAAVSGGGASVSGNGGHRVVGG 126 >BT001738-1|AAN71493.1| 331|Drosophila melanogaster RE72617p protein. Length = 331 Score = 30.7 bits (66), Expect = 3.3 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 2/70 (2%) Frame = -3 Query: 991 GGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGG--GXXXGXGXGXSLVXGXILKRX 818 GGGG G GG G G G G GGG G G G G G + Sbjct: 10 GGGGGGGGGGGGFRGRGGGGGGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGG---RGG 66 Query: 817 XXGXGGXXXG 788 G GG G Sbjct: 67 GGGRGGGGRG 76 Score = 30.3 bits (65), Expect = 4.4 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G G G G G G GGGG G G Sbjct: 30 GGGGGGFGGGRGRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGG 77 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXGXG 854 G GGGG G G G G G G GGG G G G Sbjct: 41 GRGGGGDRGGRGGFGGGRGAFGGRGGGGGRGGGGRGGGGRGGGGRGGG 88 >AY129464-1|AAM76206.1| 981|Drosophila melanogaster SD10723p protein. Length = 981 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGG GG G G GPG G GG G G Sbjct: 913 GAGGGVAGSAGGGGSQTPVGPAGGNGGPGGAGGGGGAGGAAGSGPG 958 >AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB, isoform B protein. Length = 2309 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGG GG G G GPG G GG G G Sbjct: 2241 GAGGGVAGSAGGGGSQTPVGPAGGNGGPGGAGGGGGAGGAAGSGPG 2286 >AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA, isoform A protein. Length = 2309 Score = 30.7 bits (66), Expect = 3.3 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = -3 Query: 997 GXGGGGXXGXGGXGXXXXPXXXGXXPGPGXXXXGXXGGGGXXXGXG 860 G GGG GG G G GPG G GG G G Sbjct: 2241 GAGGGVAGSAGGGGSQTPVGPAGGNGGPGGAGGGGGAGGAAGSGPG 2286 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 30.7 bits (66), Expect = 3.3 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 1/43 (2%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPX-PPXPXXPPPP 992 P P PP P P P G P PP P PPP Sbjct: 35 PVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPP 77 >BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p protein. Length = 451 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 888 PXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PG P G P P P PPPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPP 362 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P GPG G P PP P PP P P Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPP 361 >BT016106-1|AAV36991.1| 840|Drosophila melanogaster LD20133p protein. Length = 840 Score = 30.3 bits (65), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P PP P P PG G P PP PPPP Sbjct: 741 PPNGATPPMPPNQYQPAPG---APQGPYGGPPPPQAYGPPPP 779 >AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p protein. Length = 451 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 888 PXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PG P G P P P PPPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPP 362 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P GPG G P PP P PP P P Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPP 361 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 30.3 bits (65), Expect = 4.4 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXX--PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P P PP P P P PG P P PP PPP Sbjct: 533 PPGAYPPPPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQQPPPGPPQSQYGPPP 586 Score = 30.3 bits (65), Expect = 4.4 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 867 PXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P PP P P PG G P PP PPPP Sbjct: 827 PPNGATPPMPPNQYQPAPG---APQGPYGGPPPPQAYGPPPP 865 >AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA protein. Length = 451 Score = 30.3 bits (65), Expect = 4.4 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 888 PXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPP 992 P P PG P G P P P PPPP Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPP 362 Score = 29.9 bits (64), Expect = 5.8 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 897 PXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P GPG G P PP P PP P P Sbjct: 328 PFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPP 361 >U18130-1|AAC46512.1| 1047|Drosophila melanogaster masquerade protein. Length = 1047 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 825 FKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGP---GXXPXXXGXXXXPXPPXPXXPPPPX 995 F+ T P P P PP P P P P P P PPPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 996 P 998 P Sbjct: 638 P 638 >BT016087-1|AAV36972.1| 749|Drosophila melanogaster LD41296p protein. Length = 749 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P + P P P PP P PG P G P P PPP P Sbjct: 512 PVPQQVPLPQQQGGPAPPPGMPQMHPHPGHPP--PGHSLMPPHMGPHQPPPGMP 563 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P PP P PPPP P Sbjct: 34 PAPVKSYIPPPPPPPPPA-PKNTYIPPPAAPAKAYIPPPP-PPPPPAP 79 >BT001597-1|AAN71352.1| 1047|Drosophila melanogaster RE29416p protein. Length = 1047 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 825 FKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGP---GXXPXXXGXXXXPXPPXPXXPPPPX 995 F+ T P P P PP P P P P P P PPPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 996 P 998 P Sbjct: 638 P 638 >AY052044-1|AAK93468.1| 581|Drosophila melanogaster LP06006p protein. Length = 581 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 825 FKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGP---GXXPXXXGXXXXPXPPXPXXPPPPX 995 F+ T P P P PP P P P P P P PPPP Sbjct: 112 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 171 Query: 996 P 998 P Sbjct: 172 P 172 >AY051669-1|AAK93093.1| 457|Drosophila melanogaster LD22190p protein. Length = 457 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P + P P P PP P PG P G P P PPP P Sbjct: 220 PVPQQVPLPQQQGGPAPPPGMPQMHPHPGHPP--PGHSLMPPHMGPHQPPPGMP 271 >AJ002520-1|CAC20093.1| 749|Drosophila melanogaster DALAO protein protein. Length = 749 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P + P P P PP P PG P G P P PPP P Sbjct: 512 PVPQQVPLPQQQGGPAPPPGMPQMHPHPGHPP--PGHSLMPPHMGPHQPPPGMP 563 >AF348329-1|AAK31343.1| 749|Drosophila melanogaster Brahma-associated protein 111kD protein. Length = 749 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P + P P P PP P PG P G P P PPP P Sbjct: 512 PVPQQVPLPQQQGGPAPPPGMPQMHPHPGHPP--PGHSLMPPHMGPHQPPPGMP 563 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 29.9 bits (64), Expect = 5.8 Identities = 19/78 (24%), Positives = 22/78 (28%), Gaps = 4/78 (5%) Frame = +3 Query: 777 FCXXPXXXPPXPXXHLF----KXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXG 944 + P PP P + P + P P PPPP Sbjct: 111 YADPPAPRPPAPAPPTTQPPRRVRPQVRPRPRPTTLAPPPPPNYDYDYDYDAQPAAPAEP 170 Query: 945 XXXXPXPPXPXXPPPPXP 998 P PP P PP P P Sbjct: 171 PPPPPPPPPPTAPPRPRP 188 >AE014298-1284|AAF46450.1| 749|Drosophila melanogaster CG7055-PA protein. Length = 749 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +3 Query: 837 PXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P + P P P PP P PG P G P P PPP P Sbjct: 512 PVPQQVPLPQQQGGPAPPPGMPQMHPHPGHPP--PGHSLMPPHMGPHQPPPGMP 563 >AE014297-4122|AAF56703.2| 1183|Drosophila melanogaster CG6599-PA protein. Length = 1183 Score = 29.9 bits (64), Expect = 5.8 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 828 KXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXP 983 K P T +P P P PP P P P P PP P P Sbjct: 862 KPKPNTNPTPIPPPTAAPPGPPSAESKKP-PAAPQPRPSTPQTPTPPQPEPP 912 >AE014296-779|AAF47850.1| 1047|Drosophila melanogaster CG15002-PB protein. Length = 1047 Score = 29.9 bits (64), Expect = 5.8 Identities = 18/61 (29%), Positives = 19/61 (31%), Gaps = 3/61 (4%) Frame = +3 Query: 825 FKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGP---GXXPXXXGXXXXPXPPXPXXPPPPX 995 F+ T P P P PP P P P P P P PPPP Sbjct: 578 FQTRNDTAYYPAPPPPPIGPPQAYPPQTPPYSYMNNPPPQGPPPQMAPHHPNPYQPPPPA 637 Query: 996 P 998 P Sbjct: 638 P 638 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 29.9 bits (64), Expect = 5.8 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 855 PXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPPPXP 998 P P PPPP P P P PP P PPPP P Sbjct: 34 PAPVKSYIPPPPPPPPPA-PKNTYIPPPAAPAKAYIPPPP-PPPPPAP 79 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 828 KXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 K P SP P PPP P P P P P P PPP Sbjct: 286 KQPPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASP-SPSPSPPPP 338 >AF184225-1|AAD55736.1| 377|Drosophila melanogaster BcDNA.GH06048 protein. Length = 377 Score = 29.5 bits (63), Expect = 7.6 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP LF P P P P P P PG P G P P Sbjct: 150 PINSPPIRPGGLFPGGPSPGGPSPGEPSPGEPSPGGPSPGGPSPG-GPSPGG--PSPGGP 206 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 207 SPGGPSPGGP 216 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +3 Query: 828 KXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPPXPXXPPP 989 K P SP P PPP P P P P P P PPP Sbjct: 2553 KQPPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASP-SPSPSPPPP 2605 >AE013599-4026|AAF47319.2| 377|Drosophila melanogaster CG2668-PA protein. Length = 377 Score = 29.5 bits (63), Expect = 7.6 Identities = 21/70 (30%), Positives = 21/70 (30%) Frame = +3 Query: 789 PXXXPPXPXXHLFKXXPXTKLSPXPXPXXXPPPPXXPXXXXPGPGXXPXXXGXXXXPXPP 968 P PP LF P P P P P P PG P G P P Sbjct: 150 PINSPPIRPGGLFPGGPSPGGPSPGEPSPGEPSPGGPSPGGPSPG-GPSPGG--PSPGGP 206 Query: 969 XPXXPPPPXP 998 P P P P Sbjct: 207 SPGGPSPGGP 216 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,289,294 Number of Sequences: 53049 Number of extensions: 900222 Number of successful extensions: 8986 Number of sequences better than 10.0: 183 Number of HSP's better than 10.0 without gapping: 2880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6211 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 5099321547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -