BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N18 (1005 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 24 1.9 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.3 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 5.7 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 7.6 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 24.2 bits (50), Expect = 1.9 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 340 DRGKLTGQAYGTRVLGPGGDSTSYGG 417 D+ +TG AYG + PG S + G Sbjct: 66 DKNGMTGDAYGGLNIRPGQPSRQHAG 91 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 3.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 445 WRSHWPSLDDHRNWY 401 W +H P+ D NWY Sbjct: 661 WLNHSPNYDQVTNWY 675 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.6 bits (46), Expect = 5.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 963 PPXPXXPPPP 992 PP P PPPP Sbjct: 338 PPKPAPPPPP 347 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 7.6 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +1 Query: 193 KVSPTPSRYSRLCHLGQGNGGREGLRDFGRERPRXFLVK 309 + S SRY L H + + +G R R+R R + K Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRSREYKKK 264 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 233,445 Number of Sequences: 438 Number of extensions: 6665 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 33379164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -