BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N16 (929 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220... 100 3e-21 >03_04_0129 + 17520753-17520842,17521651-17521741,17521887-17522070, 17522149-17522224 Length = 146 Score = 99.5 bits (237), Expect = 3e-21 Identities = 42/82 (51%), Positives = 59/82 (71%) Frame = +3 Query: 228 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGXIARKALQSLEALK 407 W+Y R A+I R IY+R +GV KI+GGR+RNG P HFC+SSG I+R LQ L+ + Sbjct: 55 WYYTRAASIARKIYLRQGIGVGGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMG 114 Query: 408 LVEKVQDGGRILTTQGRRDLEQ 473 +++ GGR++T+QGRRDL+Q Sbjct: 115 IIDVDPKGGRLITSQGRRDLDQ 136 Score = 60.1 bits (139), Expect = 2e-09 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +1 Query: 85 TVKDVEQDXIVKTVAAHLKKTGKVKVPEXMDLVKTARFKELAPX*P 222 TVKDV VK +AHLK++GK+++PE +D+VKTARFKEL P P Sbjct: 8 TVKDVNPHEFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDP 53 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,637,869 Number of Sequences: 37544 Number of extensions: 349732 Number of successful extensions: 2678 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2431 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2659245980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -