BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP01_F_N15 (911 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_1025 - 10506144-10506226,10506643-10506699,10507502-105076... 32 0.73 11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435,322... 29 3.9 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 29 6.8 06_02_0019 - 10656005-10657511,10657712-10658739 28 9.0 >12_01_1025 - 10506144-10506226,10506643-10506699,10507502-10507605, 10507884-10507937,10508107-10508193,10509027-10509214, 10509793-10509854,10510084-10510354,10510756-10510834, 10511715-10511913,10512816-10512960,10513324-10513416, 10514449-10514736 Length = 569 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = +3 Query: 438 ETFYKTACFARVHLNQGQFLYAF-YIAVIQRSDCHGF 545 ETF+ TAC R HL QG+ + A+ Y+ + DC GF Sbjct: 427 ETFFTTACMGRGHLCQGKLVDAYRYLHKEKDMDC-GF 462 >11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435, 3228525-3228659,3229262-3229344,3229442-3229535, 3229649-3229735 Length = 423 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = -1 Query: 590 IHKHFRVYFIRSRNNETVAIRALDNSDVEGIQELTLIEMHT 468 IHK FR++ R + E +AIRA NS + L L +M T Sbjct: 319 IHKPFRIHLGRGLHGECLAIRADGNSKLSHEIGLELSKMST 359 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/24 (58%), Positives = 14/24 (58%) Frame = +2 Query: 455 CLFCACASQSRSILVCLLHRCYPA 526 CLFC SR ILVC L RC A Sbjct: 58 CLFCEANFISRRILVCDLLRCLVA 81 >06_02_0019 - 10656005-10657511,10657712-10658739 Length = 844 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/32 (31%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = -2 Query: 601 STXIFINILGY-TSYGAGTTKPWQSERWITAM 509 +T I ++++G +YGAG+++ W++ ++ AM Sbjct: 750 NTTIVLDMIGLLVAYGAGSSREWETSGYVIAM 781 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,972,799 Number of Sequences: 37544 Number of extensions: 356341 Number of successful extensions: 689 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2588957540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -